SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0004
         (717 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U02964-1|AAA03444.1|  376|Anopheles gambiae actin 1D protein.         301   2e-83
U02933-1|AAA56882.1|  376|Anopheles gambiae actin 1D protein.         301   2e-83
U02930-1|AAA56881.1|  376|Anopheles gambiae actin 1D protein.         301   2e-83
CR954256-1|CAJ14142.1|  376|Anopheles gambiae actin protein.          275   1e-75
DQ974162-1|ABJ52802.1|  418|Anopheles gambiae serpin 3 protein.        27   0.77 
AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein.            23   9.5  

>U02964-1|AAA03444.1|  376|Anopheles gambiae actin 1D protein.
          Length = 376

 Score =  301 bits (738), Expect = 2e-83
 Identities = 140/140 (100%), Positives = 140/140 (100%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA
Sbjct: 237 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 296

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM
Sbjct: 297 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 356

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WISKQEYDESGPSIVHRKCF
Sbjct: 357 WISKQEYDESGPSIVHRKCF 376


>U02933-1|AAA56882.1|  376|Anopheles gambiae actin 1D protein.
          Length = 376

 Score =  301 bits (738), Expect = 2e-83
 Identities = 140/140 (100%), Positives = 140/140 (100%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA
Sbjct: 237 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 296

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM
Sbjct: 297 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 356

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WISKQEYDESGPSIVHRKCF
Sbjct: 357 WISKQEYDESGPSIVHRKCF 376


>U02930-1|AAA56881.1|  376|Anopheles gambiae actin 1D protein.
          Length = 376

 Score =  301 bits (738), Expect = 2e-83
 Identities = 140/140 (100%), Positives = 140/140 (100%)
 Frame = -3

Query: 706 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 527
           LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA
Sbjct: 237 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 296

Query: 526 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 347
           NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM
Sbjct: 297 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 356

Query: 346 WISKQEYDESGPSIVHRKCF 287
           WISKQEYDESGPSIVHRKCF
Sbjct: 357 WISKQEYDESGPSIVHRKCF 376


>CR954256-1|CAJ14142.1|  376|Anopheles gambiae actin protein.
          Length = 376

 Score =  275 bits (674), Expect = 1e-75
 Identities = 127/139 (91%), Positives = 132/139 (94%)
 Frame = -3

Query: 703 EKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYAN 524
           EKSYELPDGQVITIGNERFR PEALFQPSFLGME+ GIHET YNSIM+CDVDIRKDLYAN
Sbjct: 238 EKSYELPDGQVITIGNERFRAPEALFQPSFLGMESTGIHETVYNSIMRCDVDIRKDLYAN 297

Query: 523 TVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMW 344
           +VLSGGTTMYPGIADRMQKEIT+LAPST+KIKIIAPPERKYSVWIGGSILASLSTFQ MW
Sbjct: 298 SVLSGGTTMYPGIADRMQKEITSLAPSTIKIKIIAPPERKYSVWIGGSILASLSTFQTMW 357

Query: 343 ISKQEYDESGPSIVHRKCF 287
           ISK EYDE GP IVHRKCF
Sbjct: 358 ISKHEYDEGGPGIVHRKCF 376


>DQ974162-1|ABJ52802.1|  418|Anopheles gambiae serpin 3 protein.
          Length = 418

 Score = 26.6 bits (56), Expect = 0.77
 Identities = 15/34 (44%), Positives = 19/34 (55%)
 Frame = -1

Query: 330 STTSLAPPLYTGSASKRTARRCLQQPAAGCSIQA 229
           S  +L   LY GSAS+    R LQQ  +G + QA
Sbjct: 70  SVKALLALLYEGSASRSETERELQQALSGGNSQA 103


>AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein.
          Length = 1356

 Score = 23.0 bits (47), Expect = 9.5
 Identities = 9/23 (39%), Positives = 14/23 (60%)
 Frame = -2

Query: 383  IDPRLPLYLPTDVDLETGVRRVW 315
            +DP + LYL T+  L+ G +  W
Sbjct: 1188 LDPDIRLYLKTNTYLQWGDKLFW 1210


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 759,819
Number of Sequences: 2352
Number of extensions: 16503
Number of successful extensions: 42
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 42
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 42
length of database: 563,979
effective HSP length: 63
effective length of database: 415,803
effective search space used: 72765525
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).