SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0042
         (619 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY748849-1|AAV28195.1|  106|Anopheles gambiae cytochrome P450 pr...    26   0.85 
AJ439060-11|CAD27762.1| 1881|Anopheles gambiae putative cell-adh...    25   2.0  
AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase pr...    25   2.6  
AY347952-1|AAR28375.1|  634|Anopheles gambiae putative sulfakini...    24   3.4  
DQ974166-1|ABJ52806.1|  494|Anopheles gambiae serpin 6 protein.        23   7.9  

>AY748849-1|AAV28195.1|  106|Anopheles gambiae cytochrome P450
           protein.
          Length = 106

 Score = 26.2 bits (55), Expect = 0.85
 Identities = 10/29 (34%), Positives = 19/29 (65%)
 Frame = -3

Query: 419 GTEVIMSIYWLLKAPEYLVDSGKDESEQY 333
           GTEV+++IY +   P+Y  D+ +   E++
Sbjct: 35  GTEVMLNIYVMQNDPQYYPDADQFRPERF 63


>AJ439060-11|CAD27762.1| 1881|Anopheles gambiae putative cell-adhesion
            protein protein.
          Length = 1881

 Score = 25.0 bits (52), Expect = 2.0
 Identities = 11/34 (32%), Positives = 17/34 (50%)
 Frame = -3

Query: 170  FLMHNMRSFFDFEIMNFVHTECH*YRHILKALIK 69
            F   +MR +FDF ++      CH   H+   LI+
Sbjct: 1582 FPQKSMRGYFDFSVLANDSYGCHDRAHVFIYLIR 1615


>AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase
           protein.
          Length = 1253

 Score = 24.6 bits (51), Expect = 2.6
 Identities = 10/24 (41%), Positives = 14/24 (58%)
 Frame = -2

Query: 549 YPLSQIITVWHNVCNIRCAGFCYL 478
           +P S  I +W  V +I CA  CY+
Sbjct: 25  FPTSNAI-IWTTVTHILCAYLCYI 47


>AY347952-1|AAR28375.1|  634|Anopheles gambiae putative sulfakinin
           GPCR protein.
          Length = 634

 Score = 24.2 bits (50), Expect = 3.4
 Identities = 8/20 (40%), Positives = 14/20 (70%)
 Frame = +2

Query: 29  SWEPFFI*FHN*SLLLMPLI 88
           +WE  ++ FH+  LL +PL+
Sbjct: 269 AWEKAYVLFHDVGLLFLPLL 288


>DQ974166-1|ABJ52806.1|  494|Anopheles gambiae serpin 6 protein.
          Length = 494

 Score = 23.0 bits (47), Expect = 7.9
 Identities = 14/53 (26%), Positives = 25/53 (47%)
 Frame = -2

Query: 369 SSRLWERRIRTILRMNRISKRSMRLKHTLTNNRRPCRRLVTEIDIITSVRRVG 211
           SSR   RR++  L    +     ++K   T  R P   L   +D++ S +++G
Sbjct: 351 SSRTAIRRLQATLTGKMLDSWISQMKLQSTMVRLPKMHLRNSVDLLQSFQKLG 403


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 618,731
Number of Sequences: 2352
Number of extensions: 12345
Number of successful extensions: 19
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 18
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 19
length of database: 563,979
effective HSP length: 61
effective length of database: 420,507
effective search space used: 60553008
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).