SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0039
         (616 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U02964-1|AAA03444.1|  376|Anopheles gambiae actin 1D protein.         189   7e-50
U02933-1|AAA56882.1|  376|Anopheles gambiae actin 1D protein.         189   7e-50
U02930-1|AAA56881.1|  376|Anopheles gambiae actin 1D protein.         189   7e-50
CR954256-1|CAJ14142.1|  376|Anopheles gambiae actin protein.          181   1e-47
AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcript...    25   2.6  
AY027891-1|AAK15783.1|  801|Anopheles gambiae collagen IV alpha ...    24   4.5  
AY330181-1|AAQ16287.1|  156|Anopheles gambiae odorant-binding pr...    23   5.9  
EF519478-1|ABP73565.1|  165|Anopheles gambiae CTLMA2 protein.          23   7.8  
AY578798-1|AAT07303.1|  356|Anopheles gambiae baboon protein.          23   7.8  
AY062204-1|AAL58565.1|  150|Anopheles gambiae cytochrome P450 CY...    23   7.8  
AY062200-1|AAL58561.1|  151|Anopheles gambiae cytochrome P450 CY...    23   7.8  
AJ459779-1|CAD30839.1|  405|Anopheles gambiae clip-domain serine...    23   7.8  
AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/T...    23   7.8  
AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/T...    23   7.8  
AF002238-1|AAB97731.1|  327|Anopheles gambiae ribosomal protein ...    23   7.8  

>U02964-1|AAA03444.1|  376|Anopheles gambiae actin 1D protein.
          Length = 376

 Score =  189 bits (460), Expect = 7e-50
 Identities = 93/119 (78%), Positives = 95/119 (79%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE
Sbjct: 49  GQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 108

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFETFNTPAMYVAIQA                SGD G+ H  PI
Sbjct: 109 APLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGD-GVSHTVPI 166



 Score =  116 bits (280), Expect = 5e-28
 Identities = 53/53 (100%), Positives = 53/53 (100%)
 Frame = +1

Query: 94  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 53


>U02933-1|AAA56882.1|  376|Anopheles gambiae actin 1D protein.
          Length = 376

 Score =  189 bits (460), Expect = 7e-50
 Identities = 93/119 (78%), Positives = 95/119 (79%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE
Sbjct: 49  GQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 108

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFETFNTPAMYVAIQA                SGD G+ H  PI
Sbjct: 109 APLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGD-GVSHTVPI 166



 Score =  116 bits (280), Expect = 5e-28
 Identities = 53/53 (100%), Positives = 53/53 (100%)
 Frame = +1

Query: 94  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 53


>U02930-1|AAA56881.1|  376|Anopheles gambiae actin 1D protein.
          Length = 376

 Score =  189 bits (460), Expect = 7e-50
 Identities = 93/119 (78%), Positives = 95/119 (79%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE
Sbjct: 49  GQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 108

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPKANREKMTQIMFETFNTPAMYVAIQA                SGD G+ H  PI
Sbjct: 109 APLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGD-GVSHTVPI 166



 Score =  116 bits (280), Expect = 5e-28
 Identities = 53/53 (100%), Positives = 53/53 (100%)
 Frame = +1

Query: 94  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 53


>CR954256-1|CAJ14142.1|  376|Anopheles gambiae actin protein.
          Length = 376

 Score =  181 bits (441), Expect = 1e-47
 Identities = 88/119 (73%), Positives = 93/119 (78%)
 Frame = +3

Query: 237 GTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 416
           G +   VGDEAQSKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHPVLLTE
Sbjct: 49  GNKDAYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 108

Query: 417 APLNPKANREKMTQIMFETFNTPAMYVAIQACSRCTRPVVPPVSCWTSGDGGLPHPCPI 593
           APLNPK+NREKMTQIMFETF  PA+YVAIQA                SGD G+ H  PI
Sbjct: 109 APLNPKSNREKMTQIMFETFAAPAVYVAIQAVLSLYASGRTTGVVLDSGD-GVSHTVPI 166



 Score =  107 bits (258), Expect = 2e-25
 Identities = 47/53 (88%), Positives = 50/53 (94%)
 Frame = +1

Query: 94  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS 252
           MCD++  ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMG KD+
Sbjct: 1   MCDDDAGALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGNKDA 53


>AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcriptase
           protein.
          Length = 1248

 Score = 24.6 bits (51), Expect = 2.6
 Identities = 11/21 (52%), Positives = 12/21 (57%)
 Frame = -1

Query: 601 FRKMGHGCGRPPSPEVQHDTG 539
           FR+  H CG  PSPE    TG
Sbjct: 932 FREFLHVCGFAPSPECPACTG 952


>AY027891-1|AAK15783.1|  801|Anopheles gambiae collagen IV alpha 1
           chain precursor protein.
          Length = 801

 Score = 23.8 bits (49), Expect = 4.5
 Identities = 9/17 (52%), Positives = 11/17 (64%)
 Frame = +3

Query: 201 GKAPPSGRDGRYGTEGL 251
           G+  P GRDG +G  GL
Sbjct: 344 GQPGPRGRDGNFGPVGL 360


>AY330181-1|AAQ16287.1|  156|Anopheles gambiae odorant-binding
           protein AgamOBP55 protein.
          Length = 156

 Score = 23.4 bits (48), Expect = 5.9
 Identities = 8/20 (40%), Positives = 14/20 (70%)
 Frame = +1

Query: 88  FKMCDEEVAALVVDNGSGMC 147
           +++C E+ A   +DNG+ MC
Sbjct: 42  YRVCHEQHATPQMDNGTVMC 61


>EF519478-1|ABP73565.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 23.0 bits (47), Expect = 7.8
 Identities = 8/16 (50%), Positives = 10/16 (62%)
 Frame = -2

Query: 207 PSHDRGEHGARSIISC 160
           P+H RGEHG +    C
Sbjct: 121 PNHARGEHGQQPAERC 136


>AY578798-1|AAT07303.1|  356|Anopheles gambiae baboon protein.
          Length = 356

 Score = 23.0 bits (47), Expect = 7.8
 Identities = 17/48 (35%), Positives = 23/48 (47%)
 Frame = -2

Query: 165 SCETGLAHTGAIVYYQRGNFFVAHLELVFN*IVLL*INKLTCYCTASL 22
           S  TGLAH    +   RG   +AH +L    I++   + LTC C   L
Sbjct: 162 SIATGLAHLHMDIVGTRGKPAIAHRDLKSKNILVK--SNLTC-CIGDL 206


>AY062204-1|AAL58565.1|  150|Anopheles gambiae cytochrome P450
           CYP4C28 protein.
          Length = 150

 Score = 23.0 bits (47), Expect = 7.8
 Identities = 8/17 (47%), Positives = 11/17 (64%)
 Frame = +2

Query: 275 QKRYPDPQIPHRTRNRH 325
           +K YPD  +P  + NRH
Sbjct: 117 EKFYPDRFLPENSTNRH 133


>AY062200-1|AAL58561.1|  151|Anopheles gambiae cytochrome P450
           CYP4G17 protein.
          Length = 151

 Score = 23.0 bits (47), Expect = 7.8
 Identities = 8/13 (61%), Positives = 10/13 (76%)
 Frame = +2

Query: 287 PDPQIPHRTRNRH 325
           PD  +P RT+NRH
Sbjct: 122 PDNFLPERTQNRH 134


>AJ459779-1|CAD30839.1|  405|Anopheles gambiae clip-domain serine
           protease protein.
          Length = 405

 Score = 23.0 bits (47), Expect = 7.8
 Identities = 8/22 (36%), Positives = 14/22 (63%)
 Frame = -1

Query: 475 NVSNMIWVIFSLLALGLRGASV 410
           ++   IW I  +++LG+RG  V
Sbjct: 361 DMKRAIWYITGIVSLGVRGCGV 382


>AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/Thr
            phosphatase protein.
          Length = 1977

 Score = 23.0 bits (47), Expect = 7.8
 Identities = 10/21 (47%), Positives = 10/21 (47%)
 Frame = -1

Query: 265  SSPTKSPSVPYRPSRPDGGAF 203
            S P   PSVPY   RP    F
Sbjct: 1365 SLPLTPPSVPYASDRPPVATF 1385


>AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/Thr
            phosphatase protein.
          Length = 1978

 Score = 23.0 bits (47), Expect = 7.8
 Identities = 10/21 (47%), Positives = 10/21 (47%)
 Frame = -1

Query: 265  SSPTKSPSVPYRPSRPDGGAF 203
            S P   PSVPY   RP    F
Sbjct: 1362 SLPLTPPSVPYASDRPPVATF 1382


>AF002238-1|AAB97731.1|  327|Anopheles gambiae ribosomal protein L5
           protein.
          Length = 327

 Score = 23.0 bits (47), Expect = 7.8
 Identities = 15/46 (32%), Positives = 22/46 (47%)
 Frame = -1

Query: 271 CASSPTKSPSVPYRPSRPDGGAFPRSRGTRREEHHLLRNRPCTYRS 134
           C S P +  S   RP+     ++PRSR T + +    R RP  + S
Sbjct: 271 CRSPPARRRSRSTRPT-----SWPRSRPTSKPKRLPRRRRPFFFSS 311


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 755,309
Number of Sequences: 2352
Number of extensions: 17238
Number of successful extensions: 63
Number of sequences better than 10.0: 15
Number of HSP's better than 10.0 without gapping: 52
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 59
length of database: 563,979
effective HSP length: 61
effective length of database: 420,507
effective search space used: 60132501
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).