SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0036
         (602 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ535208-1|CAD59408.1| 1133|Anopheles gambiae SMC6 protein protein.    28   0.20 
U50468-1|AAA93472.1|   91|Anopheles gambiae protein ( Anopheles ...    27   0.47 
AY785361-1|AAV52865.1|  960|Anopheles gambiae male-specific tran...    23   0.61 
AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein.    27   0.62 
AY146720-1|AAO12080.1|  147|Anopheles gambiae odorant-binding pr...    23   5.8  
AJ535203-1|CAD59403.1| 1229|Anopheles gambiae SMC1 protein protein.    23   7.6  
AJ302656-1|CAC35521.1|  385|Anopheles gambiae gSG1b protein prot...    23   7.6  

>AJ535208-1|CAD59408.1| 1133|Anopheles gambiae SMC6 protein protein.
          Length = 1133

 Score = 28.3 bits (60), Expect = 0.20
 Identities = 13/41 (31%), Positives = 24/41 (58%)
 Frame = -3

Query: 153 LSEDYGKDLTSVQNLQKKHALLEADVSSHAERIDAIREPGR 31
           L E YG    ++Q++Q K A +E  + + +ER+  I++  R
Sbjct: 380 LKEAYGTVRRTLQDVQAKQAAIERGMRNASERVTRIQKDAR 420


>U50468-1|AAA93472.1|   91|Anopheles gambiae protein ( Anopheles
           gambiae putativetubulin alpha chain mRNA, complete cds.
           ).
          Length = 91

 Score = 27.1 bits (57), Expect = 0.47
 Identities = 17/43 (39%), Positives = 23/43 (53%), Gaps = 6/43 (13%)
 Frame = +2

Query: 353 RRPLSRRREACW----PAAP--VRSSDVSAPCHSGWSDPSTSR 463
           R P +RR EA      P++P   ++S    PC S WS PS+ R
Sbjct: 35  RCPRTRRSEAVMTRSTPSSPRLAQASTCPVPCSSIWSRPSSMR 77


>AY785361-1|AAV52865.1|  960|Anopheles gambiae male-specific
           transcription factor FRU-MA protein.
          Length = 960

 Score = 22.6 bits (46), Expect(2) = 0.61
 Identities = 9/21 (42%), Positives = 13/21 (61%)
 Frame = -3

Query: 450 GSDQPEWQGAETSELRTGAAG 388
           GSD PE++GA    + +G  G
Sbjct: 541 GSDGPEYEGAGRGGVGSGIGG 561



 Score = 22.2 bits (45), Expect(2) = 0.61
 Identities = 9/12 (75%), Positives = 10/12 (83%)
 Frame = -3

Query: 297 GRAGRNMGATGA 262
           GRAG  +GATGA
Sbjct: 569 GRAGGGVGATGA 580


>AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein.
          Length = 1376

 Score = 26.6 bits (56), Expect = 0.62
 Identities = 17/48 (35%), Positives = 23/48 (47%)
 Frame = -2

Query: 157  AAQRGLREGSDQRAESPEEARAVGGRRELAXXXXXXXXXXRPSQFIKK 14
            AAQ  +R+G+D+R +  EEA  +  R EL             S  IKK
Sbjct: 946  AAQSAIRKGNDERTQLEEEANKL--REELEEMKLAIEKAHEGSSSIKK 991


>AY146720-1|AAO12080.1|  147|Anopheles gambiae odorant-binding
           protein AgamOBP15 protein.
          Length = 147

 Score = 23.4 bits (48), Expect = 5.8
 Identities = 11/31 (35%), Positives = 17/31 (54%)
 Frame = -1

Query: 170 KLKDSCSARTTGRI*PACRISRRSTRCWRPT 78
           K+   C+ ++TG I  AC  +    RCW+ T
Sbjct: 104 KVLAKCN-KSTGPIADACERAYSHHRCWKET 133


>AJ535203-1|CAD59403.1| 1229|Anopheles gambiae SMC1 protein protein.
          Length = 1229

 Score = 23.0 bits (47), Expect = 7.6
 Identities = 10/38 (26%), Positives = 21/38 (55%)
 Frame = -1

Query: 476 KFATDDSYLDPTNLNGKVQKHQNFEQELQANKPRVDEI 363
           K++ +D      N+N   ++ ++F +EL    P++ EI
Sbjct: 726 KYSMNDLETSKKNINEYDRQLEDFTRELDQIGPKISEI 763


>AJ302656-1|CAC35521.1|  385|Anopheles gambiae gSG1b protein
           protein.
          Length = 385

 Score = 23.0 bits (47), Expect = 7.6
 Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 1/42 (2%)
 Frame = -1

Query: 410 NFEQELQANKPRVDEITAVGKRLLELEHFAQPQI-SSRVEEL 288
           + E++  A KP  DE+   G  LL L + AQ +  ++ ++EL
Sbjct: 77  HLEKQAAATKPIRDELRRFGGTLLPLLNSAQVKTDAAELDEL 118


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 587,738
Number of Sequences: 2352
Number of extensions: 11784
Number of successful extensions: 30
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 27
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 30
length of database: 563,979
effective HSP length: 61
effective length of database: 420,507
effective search space used: 58450473
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).