SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0035
         (392 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U02964-1|AAA03444.1|  376|Anopheles gambiae actin 1D protein.         103   2e-24
U02933-1|AAA56882.1|  376|Anopheles gambiae actin 1D protein.         103   2e-24
U02930-1|AAA56881.1|  376|Anopheles gambiae actin 1D protein.         103   2e-24
CR954256-1|CAJ14142.1|  376|Anopheles gambiae actin protein.          100   2e-23
X95912-1|CAA65156.1|  696|Anopheles gambiae immune factor protein.     24   1.7  
AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical prote...    24   1.7  
AY330181-1|AAQ16287.1|  156|Anopheles gambiae odorant-binding pr...    23   3.0  
AY578810-1|AAT07315.1|  897|Anopheles gambiae smurf protein.           23   4.0  
AY062204-1|AAL58565.1|  150|Anopheles gambiae cytochrome P450 CY...    23   4.0  
AY062200-1|AAL58561.1|  151|Anopheles gambiae cytochrome P450 CY...    23   4.0  
AJ439060-13|CAD27764.1|  319|Anopheles gambiae putative transcri...    23   5.3  
AY027891-1|AAK15783.1|  801|Anopheles gambiae collagen IV alpha ...    22   7.0  
AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-sign...    22   9.2  

>U02964-1|AAA03444.1|  376|Anopheles gambiae actin 1D protein.
          Length = 376

 Score =  103 bits (248), Expect = 2e-24
 Identities = 45/47 (95%), Positives = 46/47 (97%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI TNWDDM
Sbjct: 37  GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDM 83



 Score = 81.0 bits (191), Expect = 1e-17
 Identities = 37/39 (94%), Positives = 37/39 (94%)
 Frame = +2

Query: 143 MCDEEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           MCDEEVAALVVDNGSGMCKAGFAG DAPRAVFPSIVG P
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 39


>U02933-1|AAA56882.1|  376|Anopheles gambiae actin 1D protein.
          Length = 376

 Score =  103 bits (248), Expect = 2e-24
 Identities = 45/47 (95%), Positives = 46/47 (97%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI TNWDDM
Sbjct: 37  GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDM 83



 Score = 81.0 bits (191), Expect = 1e-17
 Identities = 37/39 (94%), Positives = 37/39 (94%)
 Frame = +2

Query: 143 MCDEEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           MCDEEVAALVVDNGSGMCKAGFAG DAPRAVFPSIVG P
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 39


>U02930-1|AAA56881.1|  376|Anopheles gambiae actin 1D protein.
          Length = 376

 Score =  103 bits (248), Expect = 2e-24
 Identities = 45/47 (95%), Positives = 46/47 (97%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI TNWDDM
Sbjct: 37  GRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDM 83



 Score = 81.0 bits (191), Expect = 1e-17
 Identities = 37/39 (94%), Positives = 37/39 (94%)
 Frame = +2

Query: 143 MCDEEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           MCDEEVAALVVDNGSGMCKAGFAG DAPRAVFPSIVG P
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 39


>CR954256-1|CAJ14142.1|  376|Anopheles gambiae actin protein.
          Length = 376

 Score =  100 bits (239), Expect = 2e-23
 Identities = 43/47 (91%), Positives = 45/47 (95%)
 Frame = +1

Query: 250 GKPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIATNWDDM 390
           G+PRHQGVMVGMG KD+YVGDEAQSKRGILTLKYPIEHGI TNWDDM
Sbjct: 37  GRPRHQGVMVGMGNKDAYVGDEAQSKRGILTLKYPIEHGIITNWDDM 83



 Score = 75.4 bits (177), Expect = 7e-16
 Identities = 33/39 (84%), Positives = 35/39 (89%)
 Frame = +2

Query: 143 MCDEEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSP 259
           MCD++  ALVVDNGSGMCKAGFAG DAPRAVFPSIVG P
Sbjct: 1   MCDDDAGALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP 39


>X95912-1|CAA65156.1|  696|Anopheles gambiae immune factor protein.
          Length = 696

 Score = 24.2 bits (50), Expect = 1.7
 Identities = 11/26 (42%), Positives = 13/26 (50%)
 Frame = -2

Query: 91  RPAVTANREKQIPDCRPGAGTPAPGI 14
           +P  TA      PD  P   TP+PGI
Sbjct: 433 QPMFTAQSTSPGPDRSPATLTPSPGI 458


>AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical protein
           protein.
          Length = 1645

 Score = 24.2 bits (50), Expect = 1.7
 Identities = 12/37 (32%), Positives = 16/37 (43%)
 Frame = -1

Query: 257 GFPRSRETLREEHHILRSRPCTYRSHCLLPTRQLLRR 147
           G  + R TL E       +P  +R H LLP   +  R
Sbjct: 838 GAGKRRPTLTESTSFELKKPKDFRKHSLLPLNNVFDR 874


>AY330181-1|AAQ16287.1|  156|Anopheles gambiae odorant-binding
           protein AgamOBP55 protein.
          Length = 156

 Score = 23.4 bits (48), Expect = 3.0
 Identities = 8/20 (40%), Positives = 14/20 (70%)
 Frame = +2

Query: 137 FKMCDEEVAALVVDNGSGMC 196
           +++C E+ A   +DNG+ MC
Sbjct: 42  YRVCHEQHATPQMDNGTVMC 61


>AY578810-1|AAT07315.1|  897|Anopheles gambiae smurf protein.
          Length = 897

 Score = 23.0 bits (47), Expect = 4.0
 Identities = 11/27 (40%), Positives = 14/27 (51%)
 Frame = +3

Query: 9   GRIPGAGVPAPGRQSGICFSRLAVTAG 89
           G + G GVP P +Q  I  S  + T G
Sbjct: 219 GTVNGGGVPHPQQQQHILGSPTSATNG 245


>AY062204-1|AAL58565.1|  150|Anopheles gambiae cytochrome P450
           CYP4C28 protein.
          Length = 150

 Score = 23.0 bits (47), Expect = 4.0
 Identities = 8/17 (47%), Positives = 11/17 (64%)
 Frame = +3

Query: 324 QKRYPDPQIPHRTRNRH 374
           +K YPD  +P  + NRH
Sbjct: 117 EKFYPDRFLPENSTNRH 133


>AY062200-1|AAL58561.1|  151|Anopheles gambiae cytochrome P450
           CYP4G17 protein.
          Length = 151

 Score = 23.0 bits (47), Expect = 4.0
 Identities = 8/13 (61%), Positives = 10/13 (76%)
 Frame = +3

Query: 336 PDPQIPHRTRNRH 374
           PD  +P RT+NRH
Sbjct: 122 PDNFLPERTQNRH 134


>AJ439060-13|CAD27764.1|  319|Anopheles gambiae putative
           transcription factor protein.
          Length = 319

 Score = 22.6 bits (46), Expect = 5.3
 Identities = 8/20 (40%), Positives = 14/20 (70%)
 Frame = -2

Query: 277 PSRPDGGASHDRGKHCARSI 218
           P R DGGA+++  +H  +S+
Sbjct: 88  PQRLDGGAAYELEQHTKQSL 107


>AY027891-1|AAK15783.1|  801|Anopheles gambiae collagen IV alpha 1
           chain precursor protein.
          Length = 801

 Score = 22.2 bits (45), Expect = 7.0
 Identities = 8/13 (61%), Positives = 9/13 (69%)
 Frame = +3

Query: 261 PSGRDGRYGTEGL 299
           P GRDG +G  GL
Sbjct: 348 PRGRDGNFGPVGL 360


>AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative
           FGF-signaling promoter protein.
          Length = 1197

 Score = 21.8 bits (44), Expect = 9.2
 Identities = 8/22 (36%), Positives = 12/22 (54%)
 Frame = +3

Query: 57  ICFSRLAVTAGRLIFILSHLHL 122
           +CF ++    GRL F   H+ L
Sbjct: 231 VCFDKITKQRGRLPFKFLHIKL 252


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 464,517
Number of Sequences: 2352
Number of extensions: 10551
Number of successful extensions: 29
Number of sequences better than 10.0: 13
Number of HSP's better than 10.0 without gapping: 24
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 29
length of database: 563,979
effective HSP length: 58
effective length of database: 427,563
effective search space used: 30784536
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).