SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0034
         (628 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF020851-1|AAC31864.1|  214|Anopheles gambiae unknown protein.         32   0.017
AF020850-1|AAC31863.1|  214|Anopheles gambiae unknown protein.         32   0.017
AF020849-1|AAC31862.1|  214|Anopheles gambiae unknown protein.         32   0.017
AF017062-1|AAC47144.2|  649|Anopheles gambiae soluble guanylyl c...    28   0.28 
AJ439353-4|CAD27926.1|  338|Anopheles gambiae putative hox prote...    25   2.6  

>AF020851-1|AAC31864.1|  214|Anopheles gambiae unknown protein.
          Length = 214

 Score = 31.9 bits (69), Expect = 0.017
 Identities = 12/25 (48%), Positives = 17/25 (68%)
 Frame = +2

Query: 374 PASQRLTWSSLPSPCWSSRKFTTPR 448
           P++QR + SS P+PCW S K   P+
Sbjct: 133 PSNQRSSSSSKPTPCWESNKDVFPK 157


>AF020850-1|AAC31863.1|  214|Anopheles gambiae unknown protein.
          Length = 214

 Score = 31.9 bits (69), Expect = 0.017
 Identities = 12/25 (48%), Positives = 17/25 (68%)
 Frame = +2

Query: 374 PASQRLTWSSLPSPCWSSRKFTTPR 448
           P++QR + SS P+PCW S K   P+
Sbjct: 133 PSNQRSSSSSKPTPCWESNKDVFPK 157


>AF020849-1|AAC31862.1|  214|Anopheles gambiae unknown protein.
          Length = 214

 Score = 31.9 bits (69), Expect = 0.017
 Identities = 12/25 (48%), Positives = 17/25 (68%)
 Frame = +2

Query: 374 PASQRLTWSSLPSPCWSSRKFTTPR 448
           P++QR + SS P+PCW S K   P+
Sbjct: 133 PSNQRSSSSSKPTPCWESNKDVFPK 157


>AF017062-1|AAC47144.2|  649|Anopheles gambiae soluble guanylyl
           cyclase beta subunit protein.
          Length = 649

 Score = 27.9 bits (59), Expect = 0.28
 Identities = 19/56 (33%), Positives = 32/56 (57%), Gaps = 3/56 (5%)
 Frame = -3

Query: 296 AFRDLVLLLSKYSSEL-LTSS--VLPDSWEYCLRNIFLNRAITATRIHTELPKRVS 138
           A RDLVLL  K+ +E  LT++  +L D  +   R++   +  T   +++ LPK V+
Sbjct: 427 ASRDLVLLSEKFEAEYKLTTNLEILTDRLQQTYRDLESEKQKTDRLLYSVLPKTVA 482


>AJ439353-4|CAD27926.1|  338|Anopheles gambiae putative hox protein
           protein.
          Length = 338

 Score = 24.6 bits (51), Expect = 2.6
 Identities = 8/25 (32%), Positives = 15/25 (60%)
 Frame = -3

Query: 605 LLKSHPDVLSPDGKVPNTPAKECVI 531
           LL+ HP  + P   +P+TP  + ++
Sbjct: 68  LLQQHPPSVFPHAALPHTPTNQPIV 92


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 716,156
Number of Sequences: 2352
Number of extensions: 15901
Number of successful extensions: 25
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 25
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 25
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 61050630
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).