SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0031
         (558 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ459959-1|CAD31058.1|  462|Anopheles gambiae dopachrome convers...    36   9e-04
AJ535203-1|CAD59403.1| 1229|Anopheles gambiae SMC1 protein protein.    26   0.96 
AY176049-1|AAO19580.1|  515|Anopheles gambiae cytochrome P450 CY...    23   6.8  

>AJ459959-1|CAD31058.1|  462|Anopheles gambiae dopachrome conversion
           enzyme protein.
          Length = 462

 Score = 35.9 bits (79), Expect = 9e-04
 Identities = 22/54 (40%), Positives = 31/54 (57%), Gaps = 5/54 (9%)
 Frame = +1

Query: 256 GIPATLNYIPLDAPY-EPSPKLTPYPSFEGNEL-GNCQ---TGLTTVYRVKADQ 402
           GIP+TLN + L  P+   +  L PYP+F  NEL  + Q     + TVYR + D+
Sbjct: 74  GIPSTLNVVDLSPPFPNTNVILKPYPNFALNELRADLQPDANRIVTVYRPRVDR 127


>AJ535203-1|CAD59403.1| 1229|Anopheles gambiae SMC1 protein protein.
          Length = 1229

 Score = 25.8 bits (54), Expect = 0.96
 Identities = 10/26 (38%), Positives = 16/26 (61%)
 Frame = +1

Query: 448  DNVTNVCPVHAQCILT*TLIKSSRKY 525
            D +  +CP  A+C+++ TLI    KY
Sbjct: 1197 DVLIGICPYPAECLVSQTLIFDLEKY 1222


>AY176049-1|AAO19580.1|  515|Anopheles gambiae cytochrome P450
           CYP12F3 protein.
          Length = 515

 Score = 23.0 bits (47), Expect = 6.8
 Identities = 10/29 (34%), Positives = 13/29 (44%)
 Frame = +1

Query: 295 PYEPSPKLTPYPSFEGNELGNCQTGLTTV 381
           PY+  P  T +  F G   G C  GL  +
Sbjct: 39  PYKSIPGPTLWQLFRGFSKGGCYDGLNLI 67


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 621,302
Number of Sequences: 2352
Number of extensions: 13398
Number of successful extensions: 59
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 56
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 58
length of database: 563,979
effective HSP length: 61
effective length of database: 420,507
effective search space used: 52142868
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).