SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0028
         (633 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

M93690-1|AAA29364.1|  613|Anopheles gambiae ORF1 protein.              35   0.002
AB090813-1|BAC57901.1|  724|Anopheles gambiae gag-like protein p...    31   0.040
AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal...    29   0.12 
M93691-1|AAA29366.1|  574|Anopheles gambiae protein ( Anopheles ...    28   0.21 
M93689-1|AAA29368.1|  442|Anopheles gambiae protein ( Anopheles ...    26   0.86 
AY645022-1|AAT92558.1|  165|Anopheles gambiae hairy protein.           26   0.86 
AY146760-1|AAO12075.1|  313|Anopheles gambiae odorant-binding pr...    25   1.5  
AF393487-1|AAL60412.1|  304|Anopheles gambiae odorant binding pr...    25   1.5  
AJ297930-1|CAC35450.1|  104|Anopheles gambiae hypothetical prote...    25   2.0  
AB090816-1|BAC57907.1|  455|Anopheles gambiae gag-like protein p...    25   2.0  
EF427621-5|ABO09853.1|   62|Anopheles gambiae tal-like protein A...    24   3.5  
DQ139954-1|ABA29475.1|  451|Anopheles gambiae protein O-fucosylt...    24   3.5  
AY994093-1|AAX86006.1|   45|Anopheles gambiae metallothionein 1 ...    24   4.6  
M93691-2|AAA29365.1| 1222|Anopheles gambiae protein ( Anopheles ...    23   6.1  
AY331408-1|AAQ97589.1|  100|Anopheles gambiae agCP14332 protein.       23   6.1  
AY331404-1|AAQ97585.1|  100|Anopheles gambiae agCP14332 protein.       23   6.1  
AY331403-1|AAQ97584.1|  103|Anopheles gambiae agCP14332 protein.       23   6.1  
AY994094-1|AAX86007.1|   41|Anopheles gambiae metallothionein 2 ...    23   8.1  
AY578805-1|AAT07310.1|  753|Anopheles gambiae medea protein.           23   8.1  

>M93690-1|AAA29364.1|  613|Anopheles gambiae ORF1 protein.
          Length = 613

 Score = 34.7 bits (76), Expect = 0.002
 Identities = 18/58 (31%), Positives = 31/58 (53%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQ 265
           +Q  QQ++ + RE     +Q QH   +Q +   + QQ   H  +QQ+ Q++ Q  +QQ
Sbjct: 247 QQQQQQQRNQQREWQQQQQQQQHQQREQQQQQRVQQQNQQHQRQQQQQQQQRQQQQQQ 304



 Score = 29.9 bits (64), Expect = 0.070
 Identities = 27/108 (25%), Positives = 47/108 (43%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
           +QH Q+EQ + ++     +Q Q    +Q       QQ+      QQ+ Q++ Q  +QQ +
Sbjct: 227 QQHQQREQQQ-QQQQQQQQQQQQQQQQQRNQQREWQQQQQQQQHQQREQQQQQRVQQQNQ 285

Query: 258 LHRGYGRSEGRCCYQRTQCPAGDINLCSVWRNVLRYSLSVSHVGWSNQ 115
            H+   R + +   QR Q    +     +W  V+R   +      SNQ
Sbjct: 286 QHQ---RQQQQQQQQRQQQQQQEQQ--ELWTTVVRRRQNTQQQQQSNQ 328



 Score = 25.4 bits (53), Expect = 1.5
 Identities = 15/62 (24%), Positives = 29/62 (46%)
 Frame = -1

Query: 444 GSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQ 265
           G +Q  Q++Q +  +     +Q Q    +Q +     Q+      +QQ+ Q++ Q  EQQ
Sbjct: 216 GPQQQEQRQQQQQHQQREQQQQQQQQQQQQQQQQQQQQRNQQREWQQQQQQQQHQQREQQ 275

Query: 264 ME 259
            +
Sbjct: 276 QQ 277



 Score = 24.6 bits (51), Expect = 2.6
 Identities = 18/79 (22%), Positives = 35/79 (44%)
 Frame = -1

Query: 441 SRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQM 262
           SR    ++  + +E     +QHQ    +Q +     QQ+     +Q+  QR  Q  +QQ 
Sbjct: 208 SRNRRGRQGPQQQEQRQQQQQHQQREQQQQQQQQQQQQQQQQQQQQRNQQREWQQ-QQQQ 266

Query: 261 ELHRGYGRSEGRCCYQRTQ 205
           + H+   + + +   Q+ Q
Sbjct: 267 QQHQQREQQQQQRVQQQNQ 285



 Score = 24.2 bits (50), Expect = 3.5
 Identities = 13/64 (20%), Positives = 30/64 (46%)
 Frame = -1

Query: 450 HMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*E 271
           H    Q  QQ+Q + ++     +Q ++   +  +     Q +     +QQ+VQ++ Q  +
Sbjct: 229 HQQREQQQQQQQQQQQQQQQQQQQQRNQQREWQQQQQQQQHQQREQQQQQRVQQQNQQHQ 288

Query: 270 QQME 259
           +Q +
Sbjct: 289 RQQQ 292


>AB090813-1|BAC57901.1|  724|Anopheles gambiae gag-like protein
           protein.
          Length = 724

 Score = 30.7 bits (66), Expect = 0.040
 Identities = 20/78 (25%), Positives = 37/78 (47%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
           +Q  QQ+QGE   P    +Q Q    +Q +     Q++     +Q++ Q+R Q  +QQ +
Sbjct: 286 QQQQQQQQGERYVPPQLRQQRQQQQHQQQQQQQQQQRQQQQRQQQRQQQQRQQQQQQQQQ 345

Query: 258 LHRGYGRSEGRCCYQRTQ 205
             +   R + +   Q+ Q
Sbjct: 346 QRQQQQRQQQQQQQQQHQ 363



 Score = 29.5 bits (63), Expect = 0.093
 Identities = 26/86 (30%), Positives = 39/86 (45%), Gaps = 8/86 (9%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQ-------HQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQ 280
           +Q  QQ+QGE   P    +Q        Q    +Q +    G++ VP  L QQ+ Q++ Q
Sbjct: 253 QQQQQQQQGERYVPPQLRQQRQQQQRPRQQQQQQQQQQQQQGERYVPPQLRQQRQQQQHQ 312

Query: 279 L*EQQMELHR-GYGRSEGRCCYQRTQ 205
             +QQ +  R    R + R   QR Q
Sbjct: 313 QQQQQQQQQRQQQQRQQQRQQQQRQQ 338



 Score = 28.7 bits (61), Expect = 0.16
 Identities = 20/78 (25%), Positives = 38/78 (48%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
           RQ  QQ+Q + ++     +Q Q    +Q R     QQ+     +QQ+ QR+ Q  +QQ +
Sbjct: 303 RQQRQQQQHQQQQ-----QQQQQQRQQQQRQQQRQQQQRQQQQQQQQQQRQQQQRQQQQQ 357

Query: 258 LHRGYGRSEGRCCYQRTQ 205
             + + + + +   Q+ Q
Sbjct: 358 QQQQHQQQQQQWQQQQQQ 375



 Score = 28.3 bits (60), Expect = 0.21
 Identities = 25/98 (25%), Positives = 41/98 (41%)
 Frame = -1

Query: 543 LSLCRKALCSFSSIEQTLVQIHTGNVLEVLDHMGSRQHMQQEQGECREPLAGLEQHQHSM 364
           L LCR+   +    E  L+   T +VLE+     +       QG  RE     +Q     
Sbjct: 124 LRLCREENAALRR-ENELLLTGTRSVLELQTAANATLQQSSGQGGNRETARKRQQRLRRR 182

Query: 363 AKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQMELHR 250
            ++ +     QQ+     +QQ+ Q+R Q  +QQ +  R
Sbjct: 183 ERERQQQQQQQQQQQQQQQQQQQQQRQQ--QQQCQQQR 218



 Score = 27.5 bits (58), Expect = 0.37
 Identities = 20/78 (25%), Positives = 36/78 (46%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
           R   QQ+Q + ++   G E++     +Q R     QQ+     +Q++ Q+R Q  +QQ  
Sbjct: 278 RPRQQQQQQQQQQQQQG-ERYVPPQLRQQRQQQQHQQQQQQQQQQRQQQQRQQQRQQQQR 336

Query: 258 LHRGYGRSEGRCCYQRTQ 205
             +   + + R   QR Q
Sbjct: 337 QQQQQQQQQQRQQQQRQQ 354



 Score = 27.1 bits (57), Expect = 0.49
 Identities = 15/57 (26%), Positives = 28/57 (49%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQ 268
           RQ  Q++Q   ++     +Q Q    +Q +     QQ+  H  +QQ+ Q++ Q  +Q
Sbjct: 322 RQQQQRQQQRQQQQRQQQQQQQQQQRQQQQRQQQQQQQQQHQQQQQQWQQQQQQQQQ 378



 Score = 25.8 bits (54), Expect = 1.1
 Identities = 13/59 (22%), Positives = 30/59 (50%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQM 262
           +Q +++ + E ++     +Q Q    +Q +     QQ+     +QQ  Q+++Q  +QQ+
Sbjct: 176 QQRLRRRERERQQQQQQQQQQQQQQQQQQQQQRQQQQQCQQQRQQQPQQQQLQQPQQQL 234



 Score = 25.4 bits (53), Expect = 1.5
 Identities = 14/64 (21%), Positives = 29/64 (45%)
 Frame = -1

Query: 450 HMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*E 271
           H   +Q  QQ++ + +      +Q +    +Q +     QQ      +QQ+ Q++ Q  +
Sbjct: 311 HQQQQQQQQQQRQQQQRQQQRQQQQRQQQQQQQQQQRQQQQRQQQQQQQQQHQQQQQQWQ 370

Query: 270 QQME 259
           QQ +
Sbjct: 371 QQQQ 374



 Score = 25.0 bits (52), Expect = 2.0
 Identities = 15/57 (26%), Positives = 27/57 (47%)
 Frame = -1

Query: 450 HMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQ 280
           H   +Q  QQ+Q + ++P   L   + +  +    P L QQ+      QQ+ Q++ Q
Sbjct: 362 HQQQQQQWQQQQQQQQQPRQSLPHRKQTQLQ--LSPRLQQQQQQQQQSQQQQQQQPQ 416



 Score = 24.6 bits (51), Expect = 2.6
 Identities = 15/62 (24%), Positives = 29/62 (46%)
 Frame = -1

Query: 444 GSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQ 265
           G+R+  ++ Q   R      +Q Q    +Q +     QQ+     +Q + QR+ Q  +QQ
Sbjct: 167 GNRETARKRQQRLRRRERERQQQQQQQQQQQQQQQQQQQQQRQQQQQCQQQRQQQPQQQQ 226

Query: 264 ME 259
           ++
Sbjct: 227 LQ 228



 Score = 24.6 bits (51), Expect = 2.6
 Identities = 11/42 (26%), Positives = 23/42 (54%)
 Frame = -1

Query: 384 EQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
           ++H+    +Q +    G++ VP  L QQ+ Q++    +QQ +
Sbjct: 245 QRHRQPQQQQQQQQQQGERYVPPQLRQQRQQQQRPRQQQQQQ 286



 Score = 24.6 bits (51), Expect = 2.6
 Identities = 15/60 (25%), Positives = 27/60 (45%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
           +Q  QQ+Q + +      +Q Q    +Q +     QQ+      QQ+ Q+  Q  +QQ +
Sbjct: 319 QQQRQQQQRQQQRQQQQRQQQQQQQQQQRQQQQRQQQQQQQQQHQQQQQQWQQQQQQQQQ 378



 Score = 24.2 bits (50), Expect = 3.5
 Identities = 15/63 (23%), Positives = 28/63 (44%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQME 259
           +Q  +Q+Q   ++      Q Q    +Q R     QQ+     + Q+ Q++ Q  +QQ +
Sbjct: 318 QQQQRQQQQRQQQRQQQQRQQQQQQQQQQRQQQQRQQQQQQQQQHQQQQQQWQQQQQQQQ 377

Query: 258 LHR 250
             R
Sbjct: 378 QPR 380



 Score = 24.2 bits (50), Expect = 3.5
 Identities = 14/53 (26%), Positives = 22/53 (41%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQ 280
           RQ  QQ+Q + R+     +Q Q     Q +     QQ+      +Q +  R Q
Sbjct: 336 RQQQQQQQQQQRQQQQRQQQQQQQQQHQQQQQQWQQQQQQQQQPRQSLPHRKQ 388



 Score = 23.8 bits (49), Expect = 4.6
 Identities = 14/41 (34%), Positives = 23/41 (56%)
 Frame = -1

Query: 387 LEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQ 265
           L+Q Q    +Q +    G++ VP  L QQ+ Q++ Q  +QQ
Sbjct: 435 LQQQQQQQQQQQQ----GERYVPPQLRQQRQQQQPQQQQQQ 471



 Score = 23.8 bits (49), Expect = 4.6
 Identities = 17/53 (32%), Positives = 25/53 (47%), Gaps = 2/53 (3%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLL--EQQKVQRR 286
           +Q  QQ+QGE   P   L Q +     Q +     QQ+ P     +QQ+ Q+R
Sbjct: 440 QQQQQQQQGERYVP-PQLRQQRQQQQPQQQQQQRPQQQRPQQQRPQQQRSQQR 491



 Score = 23.4 bits (48), Expect = 6.1
 Identities = 13/54 (24%), Positives = 24/54 (44%)
 Frame = -1

Query: 438 RQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL 277
           +Q  QQ++ + +      +Q QH   +Q       QQ+ P      + Q ++QL
Sbjct: 340 QQQQQQQRQQQQRQQQQQQQQQHQQQQQQWQQQQQQQQQPRQSLPHRKQTQLQL 393


>AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal
            growth factor receptorprotein.
          Length = 1433

 Score = 29.1 bits (62), Expect = 0.12
 Identities = 14/45 (31%), Positives = 23/45 (51%)
 Frame = -1

Query: 465  LEVLDHMGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQ 331
            L+ L H   +Q +QQ+Q + ++     +QHQ    + H  P L Q
Sbjct: 1297 LQTLQHQ-YQQQLQQQQQQQQQQQQQHQQHQQHQLQHHHQPQLSQ 1340



 Score = 27.1 bits (57), Expect = 0.49
 Identities = 16/49 (32%), Positives = 23/49 (46%)
 Frame = -1

Query: 447  MGSRQHMQQEQGECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQ 301
            M + QH Q +    ++PL  L QHQ+    Q +     QQ+  H   QQ
Sbjct: 1280 MPTHQHSQIQLQPIQQPLQTL-QHQYQQQLQQQQQQQQQQQQQHQQHQQ 1327


>M93691-1|AAA29366.1|  574|Anopheles gambiae protein ( Anopheles
           gambiae RT2 retroposon. ).
          Length = 574

 Score = 28.3 bits (60), Expect = 0.21
 Identities = 15/51 (29%), Positives = 28/51 (54%), Gaps = 4/51 (7%)
 Frame = -1

Query: 426 QQEQGECREPLAGLEQHQHSMAKQ--HRMPLLG--QQEVPHLLEQQKVQRR 286
           QQ+Q + +    G+ QHQ    ++   R  + G  QQ+   + +QQ++QR+
Sbjct: 287 QQQQRQLQRQAVGIAQHQQQQQQRQPQRQAVAGSQQQQQERMQQQQQLQRK 337


>M93689-1|AAA29368.1|  442|Anopheles gambiae protein ( Anopheles
           gambiae T1 retroposon. ).
          Length = 442

 Score = 26.2 bits (55), Expect = 0.86
 Identities = 21/73 (28%), Positives = 28/73 (38%)
 Frame = +2

Query: 371 CWCCSNPASGSLHSPCSCCICCRLPIWSSTSSTFPVWICTSVCSIDEKEHKAFLQRLKTK 550
           C C S+  + S    CS C     P  S+ S +     C  VC      H   L R  T+
Sbjct: 22  CSCHSSVCAVSFVMQCSTC---NAPTDSANSVS-----CAGVCGSKHHTHCTGLSRDSTR 73

Query: 551 DLLVDKSLYWWMK 589
           +L  +  L W  K
Sbjct: 74  ELGRNNQLLWLCK 86


>AY645022-1|AAT92558.1|  165|Anopheles gambiae hairy protein.
          Length = 165

 Score = 26.2 bits (55), Expect = 0.86
 Identities = 11/18 (61%), Positives = 12/18 (66%)
 Frame = -1

Query: 69  SSNYKGSSDEYDRFEREH 16
           SS + GSS  YDR  REH
Sbjct: 49  SSGHSGSSSLYDRVPREH 66


>AY146760-1|AAO12075.1|  313|Anopheles gambiae odorant-binding
           protein AgamOBP31 protein.
          Length = 313

 Score = 25.4 bits (53), Expect = 1.5
 Identities = 9/14 (64%), Positives = 11/14 (78%)
 Frame = +3

Query: 15  DVLSQIYRTHRCCL 56
           DV S++Y THR CL
Sbjct: 242 DVCSEVYNTHRDCL 255


>AF393487-1|AAL60412.1|  304|Anopheles gambiae odorant binding
           protein 1 protein.
          Length = 304

 Score = 25.4 bits (53), Expect = 1.5
 Identities = 9/14 (64%), Positives = 11/14 (78%)
 Frame = +3

Query: 15  DVLSQIYRTHRCCL 56
           DV S++Y THR CL
Sbjct: 242 DVCSEVYNTHRDCL 255


>AJ297930-1|CAC35450.1|  104|Anopheles gambiae hypothetical protein
           protein.
          Length = 104

 Score = 25.0 bits (52), Expect = 2.0
 Identities = 8/12 (66%), Positives = 10/12 (83%)
 Frame = -1

Query: 234 EGRCCYQRTQCP 199
           EG+CC +R QCP
Sbjct: 46  EGQCCPKRYQCP 57


>AB090816-1|BAC57907.1|  455|Anopheles gambiae gag-like protein
           protein.
          Length = 455

 Score = 25.0 bits (52), Expect = 2.0
 Identities = 11/35 (31%), Positives = 20/35 (57%)
 Frame = -1

Query: 384 EQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQ 280
           EQ Q S+ +Q +     QQ+     +QQ+ QR+++
Sbjct: 186 EQQQRSLQQQQQQQQQQQQQQQEQQQQQQQQRKIR 220


>EF427621-5|ABO09853.1|   62|Anopheles gambiae tal-like protein AA
           protein.
          Length = 62

 Score = 24.2 bits (50), Expect = 3.5
 Identities = 12/39 (30%), Positives = 16/39 (41%)
 Frame = -1

Query: 414 GECREPLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQK 298
           G  R P +G    Q S    H       Q +PH  +QQ+
Sbjct: 9   GMYRRPGSGASSSQRSPFHHHHQQQQNHQRMPHHHQQQQ 47


>DQ139954-1|ABA29475.1|  451|Anopheles gambiae protein
           O-fucosyltransferase 2 protein.
          Length = 451

 Score = 24.2 bits (50), Expect = 3.5
 Identities = 14/36 (38%), Positives = 17/36 (47%), Gaps = 1/36 (2%)
 Frame = -1

Query: 126 WSNQRSSGYCWNSCD-CTRFSSNYKGSSDEYDRFER 22
           W  +RS  +     D  TRF + Y  SSD  DR  R
Sbjct: 251 WEARRSMRFAPPLVDVATRFRAEYLNSSDRADRTVR 286


>AY994093-1|AAX86006.1|   45|Anopheles gambiae metallothionein 1
           protein.
          Length = 45

 Score = 23.8 bits (49), Expect = 4.6
 Identities = 13/42 (30%), Positives = 14/42 (33%)
 Frame = +2

Query: 302 CCSNRCGTSCCPSSGILCCFAILCWCCSNPASGSLHSPCSCC 427
           CC N C  +    SG  C     C C S    G       CC
Sbjct: 5   CCGNDCKCTSGCGSGQPCATDCKCACAS---GGCKEKSGGCC 43


>M93691-2|AAA29365.1| 1222|Anopheles gambiae protein ( Anopheles
           gambiae RT2 retroposon. ).
          Length = 1222

 Score = 23.4 bits (48), Expect = 6.1
 Identities = 16/54 (29%), Positives = 27/54 (50%)
 Frame = -1

Query: 387 LEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQRRVQL*EQQMELHRGYGRSEGR 226
           L+ HQ + A+Q       QQ+   L +QQ  Q++ Q  ++Q    +G   S+ R
Sbjct: 228 LQNHQQT-AQQSSQQQQQQQQQQSLQQQQLSQQQQQQRQRQPSSQQGDSSSQRR 280


>AY331408-1|AAQ97589.1|  100|Anopheles gambiae agCP14332 protein.
          Length = 100

 Score = 23.4 bits (48), Expect = 6.1
 Identities = 9/38 (23%), Positives = 16/38 (42%)
 Frame = -2

Query: 437 GSICSRSRESVGSRWQDWSSTSIVWRSSIGCRYWGSKR 324
           GS+C        +   D ++ S++W        WG K+
Sbjct: 62  GSLCGSPVSRAQTDDDDEAAASVMWCKGTNTEEWGRKK 99


>AY331404-1|AAQ97585.1|  100|Anopheles gambiae agCP14332 protein.
          Length = 100

 Score = 23.4 bits (48), Expect = 6.1
 Identities = 9/38 (23%), Positives = 16/38 (42%)
 Frame = -2

Query: 437 GSICSRSRESVGSRWQDWSSTSIVWRSSIGCRYWGSKR 324
           GS+C        +   D ++ S++W        WG K+
Sbjct: 62  GSLCGSPVSRAQTDDDDAAAASVMWCKGTNTEEWGRKK 99


>AY331403-1|AAQ97584.1|  103|Anopheles gambiae agCP14332 protein.
          Length = 103

 Score = 23.4 bits (48), Expect = 6.1
 Identities = 11/40 (27%), Positives = 17/40 (42%), Gaps = 2/40 (5%)
 Frame = -2

Query: 437 GSICSR--SRESVGSRWQDWSSTSIVWRSSIGCRYWGSKR 324
           GS+C    SR        D ++ S++W        WG K+
Sbjct: 63  GSLCGSPVSRAQTDDDDDDAAAASVMWCKGTNTEEWGRKK 102


>AY994094-1|AAX86007.1|   41|Anopheles gambiae metallothionein 2
           protein.
          Length = 41

 Score = 23.0 bits (47), Expect = 8.1
 Identities = 10/29 (34%), Positives = 12/29 (41%)
 Frame = +2

Query: 248 PLCNSICCSYSCTLRCTFCCSNRCGTSCC 334
           P C + C    C  RCT  C +     CC
Sbjct: 15  PNCGAGC---GCESRCTCPCKDGAKEGCC 40


>AY578805-1|AAT07310.1|  753|Anopheles gambiae medea protein.
          Length = 753

 Score = 23.0 bits (47), Expect = 8.1
 Identities = 16/68 (23%), Positives = 30/68 (44%), Gaps = 3/68 (4%)
 Frame = -1

Query: 459 VLDHMGSRQHMQQEQGECRE---PLAGLEQHQHSMAKQHRMPLLGQQEVPHLLEQQKVQR 289
           V  H+    ++    G+  +   P  G  Q   S A+Q++     QQ+     + Q+ Q+
Sbjct: 372 VSPHLQQNGYVSASNGQSAQAGGPAGGQAQPSQSAAQQYQPQQQQQQQQQQQPQSQQQQQ 431

Query: 288 RVQL*EQQ 265
           + Q  +QQ
Sbjct: 432 QQQQQQQQ 439


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 537,341
Number of Sequences: 2352
Number of extensions: 11668
Number of successful extensions: 139
Number of sequences better than 10.0: 19
Number of HSP's better than 10.0 without gapping: 52
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 97
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 61886940
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).