SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0026
         (630 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U02964-1|AAA03444.1|  376|Anopheles gambiae actin 1D protein.         194   2e-51
U02933-1|AAA56882.1|  376|Anopheles gambiae actin 1D protein.         194   2e-51
U02930-1|AAA56881.1|  376|Anopheles gambiae actin 1D protein.         194   2e-51
CR954256-1|CAJ14142.1|  376|Anopheles gambiae actin protein.          186   7e-49
AB090814-2|BAC57904.1| 1049|Anopheles gambiae reverse transcript...    27   0.37 
AJ439060-1|CAD27752.1|  763|Anopheles gambiae hypothetical prote...    26   1.1  
AJ438610-9|CAD27481.1|  763|Anopheles gambiae hypothetical prote...    26   1.1  
U43500-1|AAA93303.1|  280|Anopheles gambiae a-CD36 protein.            25   2.6  
AJ010193-1|CAA09032.1|  684|Anopheles gambiae prophenoloxidase p...    25   2.6  
AY027891-1|AAK15783.1|  801|Anopheles gambiae collagen IV alpha ...    24   3.5  
AY578799-1|AAT07304.1|  679|Anopheles gambiae brinker protein.         24   4.6  
AB097127-1|BAC82595.1| 1209|Anopheles gambiae reverse transcript...    24   4.6  
AY330181-1|AAQ16287.1|  156|Anopheles gambiae odorant-binding pr...    23   6.1  
AJ276487-1|CAB90819.1|  375|Anopheles gambiae serine protease pr...    23   6.1  
EF519478-1|ABP73565.1|  165|Anopheles gambiae CTLMA2 protein.          23   8.0  
AY062200-1|AAL58561.1|  151|Anopheles gambiae cytochrome P450 CY...    23   8.0  
AJ459779-1|CAD30839.1|  405|Anopheles gambiae clip-domain serine...    23   8.0  

>U02964-1|AAA03444.1|  376|Anopheles gambiae actin 1D protein.
          Length = 376

 Score =  194 bits (473), Expect = 2e-51
 Identities = 93/112 (83%), Positives = 95/112 (84%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
Sbjct: 62  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 121

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFNTPAMYVAIQAVLSLYASG        S    S   P  +GYALP
Sbjct: 122 QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALP 173



 Score =  135 bits (326), Expect = 1e-33
 Identities = 62/62 (100%), Positives = 62/62 (100%)
 Frame = +1

Query: 70  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 249
           MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 250 SK 255
           SK
Sbjct: 61  SK 62


>U02933-1|AAA56882.1|  376|Anopheles gambiae actin 1D protein.
          Length = 376

 Score =  194 bits (473), Expect = 2e-51
 Identities = 93/112 (83%), Positives = 95/112 (84%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
Sbjct: 62  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 121

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFNTPAMYVAIQAVLSLYASG        S    S   P  +GYALP
Sbjct: 122 QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALP 173



 Score =  135 bits (326), Expect = 1e-33
 Identities = 62/62 (100%), Positives = 62/62 (100%)
 Frame = +1

Query: 70  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 249
           MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 250 SK 255
           SK
Sbjct: 61  SK 62


>U02930-1|AAA56881.1|  376|Anopheles gambiae actin 1D protein.
          Length = 376

 Score =  194 bits (473), Expect = 2e-51
 Identities = 93/112 (83%), Positives = 95/112 (84%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
Sbjct: 62  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 121

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETFNTPAMYVAIQAVLSLYASG        S    S   P  +GYALP
Sbjct: 122 QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALP 173



 Score =  135 bits (326), Expect = 1e-33
 Identities = 62/62 (100%), Positives = 62/62 (100%)
 Frame = +1

Query: 70  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 249
           MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 250 SK 255
           SK
Sbjct: 61  SK 62


>CR954256-1|CAJ14142.1|  376|Anopheles gambiae actin protein.
          Length = 376

 Score =  186 bits (452), Expect = 7e-49
 Identities = 88/112 (78%), Positives = 93/112 (83%)
 Frame = +3

Query: 252 QRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 431
           +RGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPK+NREKMT
Sbjct: 62  KRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKSNREKMT 121

Query: 432 QIMFETFNTPAMYVAIQAVLSLYASGVPPVSCWTSATVSSTPCPFTKGYALP 587
           QIMFETF  PA+YVAIQAVLSLYASG        S    S   P  +GYALP
Sbjct: 122 QIMFETFAAPAVYVAIQAVLSLYASGRTTGVVLDSGDGVSHTVPIYEGYALP 173



 Score =  126 bits (304), Expect = 6e-31
 Identities = 56/62 (90%), Positives = 59/62 (95%)
 Frame = +1

Query: 70  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 249
           MCD++  ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMG KD+YVGDEAQ
Sbjct: 1   MCDDDAGALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGNKDAYVGDEAQ 60

Query: 250 SK 255
           SK
Sbjct: 61  SK 62


>AB090814-2|BAC57904.1| 1049|Anopheles gambiae reverse transcriptase
           protein.
          Length = 1049

 Score = 27.5 bits (58), Expect = 0.37
 Identities = 23/88 (26%), Positives = 35/88 (39%), Gaps = 1/88 (1%)
 Frame = +3

Query: 363 PEEHPVLLTEAPLNPKANREKMTQIM-FETFNTPAMYVAIQAVLSLYASGVPPVSCWTSA 539
           PE  PV +T   +   ANR K       +     A+  A+ A   ++    PP    T  
Sbjct: 386 PETDPVPITRQEIINLANRLKCGNAPGIDGIPNMAIKAAMLAYPDVFKKRAPPNLSPTIN 445

Query: 540 TVSSTPCPFTKGYALPPRHSLRFGT*PG 623
           T  + P P T+   +   + L+ G  PG
Sbjct: 446 TPETDPVPITRQEIINLANRLKCGKAPG 473


>AJ439060-1|CAD27752.1|  763|Anopheles gambiae hypothetical protein
           protein.
          Length = 763

 Score = 25.8 bits (54), Expect = 1.1
 Identities = 13/24 (54%), Positives = 14/24 (58%)
 Frame = -2

Query: 569 RKWARCGRHRRRSPARYRWYAGRV 498
           R+W R G   RR P  YR  AGRV
Sbjct: 116 RRWTRSGATGRRQPHPYR--AGRV 137


>AJ438610-9|CAD27481.1|  763|Anopheles gambiae hypothetical protein
           protein.
          Length = 763

 Score = 25.8 bits (54), Expect = 1.1
 Identities = 13/24 (54%), Positives = 14/24 (58%)
 Frame = -2

Query: 569 RKWARCGRHRRRSPARYRWYAGRV 498
           R+W R G   RR P  YR  AGRV
Sbjct: 116 RRWTRSGATGRRQPHPYR--AGRV 137


>U43500-1|AAA93303.1|  280|Anopheles gambiae a-CD36 protein.
          Length = 280

 Score = 24.6 bits (51), Expect = 2.6
 Identities = 11/25 (44%), Positives = 14/25 (56%)
 Frame = -2

Query: 305 VSDDSVFDGVFEGQDTSLLCASSPT 231
           V DD VFD   +  + S  C S+PT
Sbjct: 222 VGDDRVFDNGVKYPEASCWCNSNPT 246


>AJ010193-1|CAA09032.1|  684|Anopheles gambiae prophenoloxidase
           protein.
          Length = 684

 Score = 24.6 bits (51), Expect = 2.6
 Identities = 13/49 (26%), Positives = 21/49 (42%)
 Frame = +2

Query: 431 PDHVRNIQHARHVRRHPSRALAVRVRRTTGIVLDFGDGVFHTVPIYERI 577
           P   R+     +  RHP+  L+   R   G+++   D    T  I+E I
Sbjct: 273 PKITRSSDGRSYPARHPNETLSDLKRVEDGVIVSIADMELWTTRIFEAI 321


>AY027891-1|AAK15783.1|  801|Anopheles gambiae collagen IV alpha 1
           chain precursor protein.
          Length = 801

 Score = 24.2 bits (50), Expect = 3.5
 Identities = 12/33 (36%), Positives = 17/33 (51%)
 Frame = +3

Query: 177 GKAPPSGRDGRYGTEGLLCRR*GTEQRGILTLK 275
           G+  P GRDG +G  GL  ++      G+  LK
Sbjct: 344 GQPGPRGRDGNFGPVGLPGQKGDRGSEGLHGLK 376


>AY578799-1|AAT07304.1|  679|Anopheles gambiae brinker protein.
          Length = 679

 Score = 23.8 bits (49), Expect = 4.6
 Identities = 14/35 (40%), Positives = 19/35 (54%)
 Frame = +2

Query: 401 QPQGQQREDDPDHVRNIQHARHVRRHPSRALAVRV 505
           Q + QQ+EDD  H +  QH  H     + A +VRV
Sbjct: 641 QQEEQQQEDDHHHHQ--QHHHHHHAEVTTAGSVRV 673


>AB097127-1|BAC82595.1| 1209|Anopheles gambiae reverse transcriptase
           protein.
          Length = 1209

 Score = 23.8 bits (49), Expect = 4.6
 Identities = 9/22 (40%), Positives = 13/22 (59%)
 Frame = +1

Query: 454 TRPPCTSPSKPCSRCTRPAYHR 519
           T P   S  +PCS+  +PA+ R
Sbjct: 287 TYPQGDSEGRPCSKAEKPAWMR 308


>AY330181-1|AAQ16287.1|  156|Anopheles gambiae odorant-binding
           protein AgamOBP55 protein.
          Length = 156

 Score = 23.4 bits (48), Expect = 6.1
 Identities = 8/20 (40%), Positives = 14/20 (70%)
 Frame = +1

Query: 64  FKMCDEEVAALVVDNGSGMC 123
           +++C E+ A   +DNG+ MC
Sbjct: 42  YRVCHEQHATPQMDNGTVMC 61


>AJ276487-1|CAB90819.1|  375|Anopheles gambiae serine protease
           protein.
          Length = 375

 Score = 23.4 bits (48), Expect = 6.1
 Identities = 11/29 (37%), Positives = 14/29 (48%)
 Frame = +1

Query: 463 PCTSPSKPCSRCTRPAYHRYRAGLRRRCL 549
           PCT+P+    RC R     Y   L R+ L
Sbjct: 29  PCTTPNGTAGRCVRVRECGYVLDLLRKDL 57


>EF519478-1|ABP73565.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 23.0 bits (47), Expect = 8.0
 Identities = 8/16 (50%), Positives = 10/16 (62%)
 Frame = -1

Query: 183 PSHDRGEHGARSIISC 136
           P+H RGEHG +    C
Sbjct: 121 PNHARGEHGQQPAERC 136


>AY062200-1|AAL58561.1|  151|Anopheles gambiae cytochrome P450
           CYP4G17 protein.
          Length = 151

 Score = 23.0 bits (47), Expect = 8.0
 Identities = 8/13 (61%), Positives = 10/13 (76%)
 Frame = +2

Query: 263 PDPQIPHRTRNRH 301
           PD  +P RT+NRH
Sbjct: 122 PDNFLPERTQNRH 134


>AJ459779-1|CAD30839.1|  405|Anopheles gambiae clip-domain serine
           protease protein.
          Length = 405

 Score = 23.0 bits (47), Expect = 8.0
 Identities = 8/22 (36%), Positives = 14/22 (63%)
 Frame = -3

Query: 451 NVSNMIWVIFSLLALGLRGASV 386
           ++   IW I  +++LG+RG  V
Sbjct: 361 DMKRAIWYITGIVSLGVRGCGV 382


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 791,297
Number of Sequences: 2352
Number of extensions: 19004
Number of successful extensions: 68
Number of sequences better than 10.0: 17
Number of HSP's better than 10.0 without gapping: 55
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 64
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 61468785
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).