SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0025
         (588 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 pr...    25   1.8  
M93689-2|AAA29367.1|  975|Anopheles gambiae protein ( Anopheles ...    23   7.3  
AJ010299-1|CAA09070.1|  722|Anopheles gambiae stat protein.            23   7.3  
AY957503-1|AAY41942.1|  596|Anopheles gambiae vasa-like protein ...    23   9.7  
AY705398-1|AAU12507.1|  555|Anopheles gambiae nicotinic acetylch...    23   9.7  
AY705397-1|AAU12506.1|  555|Anopheles gambiae nicotinic acetylch...    23   9.7  
AJ001042-1|CAA04496.1|  395|Anopheles gambiae putative gram nega...    23   9.7  
AF387862-2|AAL56548.1|  942|Anopheles gambiae pol polyprotein pr...    23   9.7  
AF081533-1|AAD29854.1|  395|Anopheles gambiae putative gram nega...    23   9.7  

>AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1
           precursor protein.
          Length = 1623

 Score = 25.0 bits (52), Expect = 1.8
 Identities = 10/29 (34%), Positives = 17/29 (58%)
 Frame = +3

Query: 489 RCRENYCFAEATNTSAISGERMRIQSFQH 575
           RC+ N   +E T ++A+ G+R R+    H
Sbjct: 281 RCKCNGHASECTTSTALDGQRTRVCKCMH 309


>M93689-2|AAA29367.1|  975|Anopheles gambiae protein ( Anopheles
           gambiae T1 retroposon. ).
          Length = 975

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 10/19 (52%), Positives = 12/19 (63%)
 Frame = -1

Query: 276 LLNSALFFCSRTFGSTPDP 220
           LL SAL  C+  F S P+P
Sbjct: 315 LLTSALLSCTPIFRSPPNP 333


>AJ010299-1|CAA09070.1|  722|Anopheles gambiae stat protein.
          Length = 722

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 17/59 (28%), Positives = 28/59 (47%), Gaps = 2/59 (3%)
 Frame = +3

Query: 288 TQAVFPVRSTPSASTMVSSQ--PLIMAEGTASPNVTLTPQDLIYKKCLSELETLVMPDY 458
           T  +F   S  S+S+  +++  P   ++ T S    LT  D IYK  +   + L + DY
Sbjct: 660 TVLIFAPSSNQSSSSTPNAEQSPSASSKDTFSNEYVLTNLDEIYKFEIENDDMLSIQDY 718


>AY957503-1|AAY41942.1|  596|Anopheles gambiae vasa-like protein
           protein.
          Length = 596

 Score = 22.6 bits (46), Expect = 9.7
 Identities = 11/37 (29%), Positives = 22/37 (59%)
 Frame = +1

Query: 103 NNYLFAFILMSFTVCTTIEQSGNLLTLKKRTRRKIAE 213
           +NY+  F+ +    C  +EQ+ +L+  K + R+K+ E
Sbjct: 381 HNYICVFVGIVGGACADVEQTIHLVE-KFKKRKKLEE 416


>AY705398-1|AAU12507.1|  555|Anopheles gambiae nicotinic
           acetylcholine receptor subunitalpha 4 protein.
          Length = 555

 Score = 22.6 bits (46), Expect = 9.7
 Identities = 7/15 (46%), Positives = 12/15 (80%)
 Frame = +1

Query: 112 LFAFILMSFTVCTTI 156
           +FA IL+S ++C T+
Sbjct: 311 IFAMILVSISICVTV 325


>AY705397-1|AAU12506.1|  555|Anopheles gambiae nicotinic
           acetylcholine receptor subunitalpha 4 protein.
          Length = 555

 Score = 22.6 bits (46), Expect = 9.7
 Identities = 7/15 (46%), Positives = 12/15 (80%)
 Frame = +1

Query: 112 LFAFILMSFTVCTTI 156
           +FA IL+S ++C T+
Sbjct: 311 IFAMILVSISICVTV 325


>AJ001042-1|CAA04496.1|  395|Anopheles gambiae putative gram
           negative bacteria bindingprotein protein.
          Length = 395

 Score = 22.6 bits (46), Expect = 9.7
 Identities = 8/36 (22%), Positives = 17/36 (47%)
 Frame = -3

Query: 361 AIIKGWLETIVDALGVERTGNTACVAFVPSEFGIIL 254
           A +  W+E + ++     T  + CV  V +  G ++
Sbjct: 16  ATVGDWVEAVYESTSTASTAQSECVRSVTTASGSLI 51


>AF387862-2|AAL56548.1|  942|Anopheles gambiae pol polyprotein
           protein.
          Length = 942

 Score = 22.6 bits (46), Expect = 9.7
 Identities = 11/35 (31%), Positives = 20/35 (57%), Gaps = 7/35 (20%)
 Frame = -3

Query: 346 WLETIVDALGVERTG-------NTACVAFVPSEFG 263
           WL+ ++  +G + TG       N +C+A +P+E G
Sbjct: 844 WLQKLMKDVGEKTTGPIVIREDNQSCLAMLPAEGG 878


>AF081533-1|AAD29854.1|  395|Anopheles gambiae putative gram
           negative bacteria bindingprotein protein.
          Length = 395

 Score = 22.6 bits (46), Expect = 9.7
 Identities = 8/36 (22%), Positives = 17/36 (47%)
 Frame = -3

Query: 361 AIIKGWLETIVDALGVERTGNTACVAFVPSEFGIIL 254
           A +  W+E + ++     T  + CV  V +  G ++
Sbjct: 16  ATVGDWVEAVYESTSTASTAQSECVRSVTTASGSLI 51


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 596,169
Number of Sequences: 2352
Number of extensions: 12188
Number of successful extensions: 38
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 38
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 38
length of database: 563,979
effective HSP length: 61
effective length of database: 420,507
effective search space used: 56347938
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).