SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0023
         (531 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 pro...    25   1.2  
DQ182016-1|ABA56308.1|  353|Anopheles gambiae G(alpha)i protein.       24   2.8  
AY062207-1|AAL58568.1|  504|Anopheles gambiae cytochrome P450 CY...    23   6.4  

>AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 protein.
          Length = 2051

 Score = 25.4 bits (53), Expect = 1.2
 Identities = 11/37 (29%), Positives = 22/37 (59%), Gaps = 2/37 (5%)
 Frame = +1

Query: 115  SWSLLFLFVESEERHV--GYFYHLKTNSGNVTDGVTF 219
            S+ + F  + +++ +V  G+F+HL+ N G +    TF
Sbjct: 901  SYRMYFSQIAADDHYVPSGFFFHLRKNMGGLKRFSTF 937


>DQ182016-1|ABA56308.1|  353|Anopheles gambiae G(alpha)i protein.
          Length = 353

 Score = 24.2 bits (50), Expect = 2.8
 Identities = 13/42 (30%), Positives = 21/42 (50%)
 Frame = +3

Query: 207 RRDLYDRIPPLVLRRFFDVV*ATVTGDECGHFLSVLNELYTD 332
           R D  D     + R+FF    AT  G+     +S++ +L+TD
Sbjct: 91  RIDFADPSKTDIARQFFTYASATEEGELTPELVSLMKKLWTD 132


>AY062207-1|AAL58568.1|  504|Anopheles gambiae cytochrome P450
           CYP6S2 protein.
          Length = 504

 Score = 23.0 bits (47), Expect = 6.4
 Identities = 9/16 (56%), Positives = 12/16 (75%)
 Frame = -2

Query: 341 RKCVRVQLIKNGKKVT 294
           RKCVR  L K+G ++T
Sbjct: 330 RKCVRSTLAKHGNEMT 345


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 553,210
Number of Sequences: 2352
Number of extensions: 11169
Number of successful extensions: 18
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 18
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 18
length of database: 563,979
effective HSP length: 60
effective length of database: 422,859
effective search space used: 49051644
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).