SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0018
         (502 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U02964-1|AAA03444.1|  376|Anopheles gambiae actin 1D protein.         247   2e-67
U02933-1|AAA56882.1|  376|Anopheles gambiae actin 1D protein.         247   2e-67
U02930-1|AAA56881.1|  376|Anopheles gambiae actin 1D protein.         247   2e-67
CR954256-1|CAJ14142.1|  376|Anopheles gambiae actin protein.          236   3e-64
AY027891-1|AAK15783.1|  801|Anopheles gambiae collagen IV alpha ...    24   3.3  
AY330181-1|AAQ16287.1|  156|Anopheles gambiae odorant-binding pr...    23   4.4  
AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical prote...    23   4.4  
U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse tra...    23   5.8  
AY062204-1|AAL58565.1|  150|Anopheles gambiae cytochrome P450 CY...    23   5.8  
AY062200-1|AAL58561.1|  151|Anopheles gambiae cytochrome P450 CY...    23   5.8  
AJ438610-1|CAD27473.1|  838|Anopheles gambiae putative microtubu...    23   7.7  
AB097148-1|BAC82627.1|  357|Anopheles gambiae gag-like protein p...    23   7.7  

>U02964-1|AAA03444.1|  376|Anopheles gambiae actin 1D protein.
          Length = 376

 Score =  247 bits (604), Expect = 2e-67
 Identities = 112/115 (97%), Positives = 113/115 (98%)
 Frame = +2

Query: 83  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHK 262
           MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD  +
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 263 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 61  SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 115


>U02933-1|AAA56882.1|  376|Anopheles gambiae actin 1D protein.
          Length = 376

 Score =  247 bits (604), Expect = 2e-67
 Identities = 112/115 (97%), Positives = 113/115 (98%)
 Frame = +2

Query: 83  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHK 262
           MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD  +
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 263 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 61  SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 115


>U02930-1|AAA56881.1|  376|Anopheles gambiae actin 1D protein.
          Length = 376

 Score =  247 bits (604), Expect = 2e-67
 Identities = 112/115 (97%), Positives = 113/115 (98%)
 Frame = +2

Query: 83  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHK 262
           MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGD  +
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 263 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA
Sbjct: 61  SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 115


>CR954256-1|CAJ14142.1|  376|Anopheles gambiae actin protein.
          Length = 376

 Score =  236 bits (578), Expect = 3e-64
 Identities = 104/115 (90%), Positives = 110/115 (95%)
 Frame = +2

Query: 83  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDGHK 262
           MCD++  ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMG KD+YVGD  +
Sbjct: 1   MCDDDAGALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGNKDAYVGDEAQ 60

Query: 263 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKA 427
           SKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPK+
Sbjct: 61  SKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKS 115


>AY027891-1|AAK15783.1|  801|Anopheles gambiae collagen IV alpha 1
           chain precursor protein.
          Length = 801

 Score = 23.8 bits (49), Expect = 3.3
 Identities = 9/17 (52%), Positives = 11/17 (64%)
 Frame = +1

Query: 190 GKAPPSGRDGRYGTEGL 240
           G+  P GRDG +G  GL
Sbjct: 344 GQPGPRGRDGNFGPVGL 360


>AY330181-1|AAQ16287.1|  156|Anopheles gambiae odorant-binding
           protein AgamOBP55 protein.
          Length = 156

 Score = 23.4 bits (48), Expect = 4.4
 Identities = 8/20 (40%), Positives = 14/20 (70%)
 Frame = +2

Query: 77  FKMCDEEVAALVVDNGSGMC 136
           +++C E+ A   +DNG+ MC
Sbjct: 42  YRVCHEQHATPQMDNGTVMC 61


>AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical protein
           protein.
          Length = 1645

 Score = 23.4 bits (48), Expect = 4.4
 Identities = 11/34 (32%), Positives = 15/34 (44%)
 Frame = -3

Query: 188 RSRETLREEHHLLRSRPCTYRSHCLLPTRQLLRR 87
           + R TL E       +P  +R H LLP   +  R
Sbjct: 841 KRRPTLTESTSFELKKPKDFRKHSLLPLNNVFDR 874



 Score = 23.0 bits (47), Expect = 5.8
 Identities = 9/13 (69%), Positives = 10/13 (76%)
 Frame = -3

Query: 404  Q*AGRGVPRGRHA 366
            Q AG G PRGRH+
Sbjct: 1374 QPAGGGTPRGRHS 1386


>U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse
            transcriptase protein.
          Length = 1049

 Score = 23.0 bits (47), Expect = 5.8
 Identities = 12/26 (46%), Positives = 14/26 (53%)
 Frame = +3

Query: 402  LRLPSTPRPYRGEDDPRFMVRKQFNT 479
            LRL + PR   G  DP F +   FNT
Sbjct: 1000 LRL-AQPRSSAGRSDPMFRMSAVFNT 1024


>AY062204-1|AAL58565.1|  150|Anopheles gambiae cytochrome P450
           CYP4C28 protein.
          Length = 150

 Score = 23.0 bits (47), Expect = 5.8
 Identities = 8/17 (47%), Positives = 11/17 (64%)
 Frame = +1

Query: 265 QKRYPDPQIPHRTRNRH 315
           +K YPD  +P  + NRH
Sbjct: 117 EKFYPDRFLPENSTNRH 133


>AY062200-1|AAL58561.1|  151|Anopheles gambiae cytochrome P450
           CYP4G17 protein.
          Length = 151

 Score = 23.0 bits (47), Expect = 5.8
 Identities = 8/13 (61%), Positives = 10/13 (76%)
 Frame = +1

Query: 277 PDPQIPHRTRNRH 315
           PD  +P RT+NRH
Sbjct: 122 PDNFLPERTQNRH 134


>AJ438610-1|CAD27473.1|  838|Anopheles gambiae putative microtubule
           binding protein protein.
          Length = 838

 Score = 22.6 bits (46), Expect = 7.7
 Identities = 10/32 (31%), Positives = 17/32 (53%)
 Frame = +1

Query: 388 PRPAY*GSPQPQGPTEEKMTPDSWFENNSTRP 483
           PRP    +  P   +++ ++P +  EN S RP
Sbjct: 441 PRPGQSPTQSPSPGSQQSLSPANTDENFSYRP 472


>AB097148-1|BAC82627.1|  357|Anopheles gambiae gag-like protein
           protein.
          Length = 357

 Score = 22.6 bits (46), Expect = 7.7
 Identities = 9/17 (52%), Positives = 12/17 (70%)
 Frame = -3

Query: 368 AAHCRRYDAKSSPCHPS 318
           +AH RR+D  SSP  P+
Sbjct: 170 SAHDRRFDDASSPAVPA 186


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 602,348
Number of Sequences: 2352
Number of extensions: 13654
Number of successful extensions: 39
Number of sequences better than 10.0: 12
Number of HSP's better than 10.0 without gapping: 34
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 39
length of database: 563,979
effective HSP length: 60
effective length of database: 422,859
effective search space used: 44823054
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).