SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0017
         (477 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY146758-1|AAO12073.1|  289|Anopheles gambiae odorant-binding pr...    24   3.1  
AJ618930-1|CAF02010.2|  273|Anopheles gambiae odorant-binding pr...    24   3.1  
AF393485-1|AAL60410.1|  289|Anopheles gambiae odorant binding pr...    24   3.1  
AY391746-1|AAR28996.1|  502|Anopheles gambiae putative GPCR prot...    23   5.5  
AF007166-1|AAB62929.1|  360|Anopheles gambiae serine protease 14...    23   5.5  
AY146755-1|AAO12070.1|  320|Anopheles gambiae odorant-binding pr...    23   7.2  
AY146754-1|AAO12069.1|  334|Anopheles gambiae odorant-binding pr...    23   7.2  
AY928182-1|AAX22219.1|  335|Anopheles gambiae phenoloxidase inhi...    22   9.6  
AY324315-1|AAQ89700.1|  153|Anopheles gambiae insulin-like pepti...    22   9.6  
AY324314-1|AAQ89699.1|  153|Anopheles gambiae insulin-like pepti...    22   9.6  
AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein.         22   9.6  

>AY146758-1|AAO12073.1|  289|Anopheles gambiae odorant-binding
           protein AgamOBP30 protein.
          Length = 289

 Score = 23.8 bits (49), Expect = 3.1
 Identities = 9/16 (56%), Positives = 10/16 (62%)
 Frame = +2

Query: 308 FREKTIGCYSRHLTDC 355
           FRE T  CY R  +DC
Sbjct: 247 FRETTDACYQRLRSDC 262


>AJ618930-1|CAF02010.2|  273|Anopheles gambiae odorant-binding
           protein OBPjj83c protein.
          Length = 273

 Score = 23.8 bits (49), Expect = 3.1
 Identities = 9/16 (56%), Positives = 10/16 (62%)
 Frame = +2

Query: 308 FREKTIGCYSRHLTDC 355
           FRE T  CY R  +DC
Sbjct: 231 FRETTDACYQRLRSDC 246


>AF393485-1|AAL60410.1|  289|Anopheles gambiae odorant binding
           protein 1 protein.
          Length = 289

 Score = 23.8 bits (49), Expect = 3.1
 Identities = 9/16 (56%), Positives = 10/16 (62%)
 Frame = +2

Query: 308 FREKTIGCYSRHLTDC 355
           FRE T  CY R  +DC
Sbjct: 247 FRETTDACYQRLRSDC 262


>AY391746-1|AAR28996.1|  502|Anopheles gambiae putative GPCR
           protein.
          Length = 502

 Score = 23.0 bits (47), Expect = 5.5
 Identities = 12/36 (33%), Positives = 20/36 (55%), Gaps = 2/36 (5%)
 Frame = +3

Query: 327 AATAAILLIV--FWSQCRGVEAHRNSTKMSYVCPPS 428
           A T ++LL+   +    RG  A+RN + + Y  PP+
Sbjct: 56  APTVSVLLMTTSYGLLWRGATANRNDSSVHYQPPPT 91


>AF007166-1|AAB62929.1|  360|Anopheles gambiae serine protease 14D
           protein.
          Length = 360

 Score = 23.0 bits (47), Expect = 5.5
 Identities = 8/26 (30%), Positives = 13/26 (50%)
 Frame = -1

Query: 213 FSNQDILCCN*MNSTGKPELTGEKNC 136
           +  + ++CC  + S GK  L    NC
Sbjct: 75  YERKTLVCCAGVRSKGKTSLPESPNC 100


>AY146755-1|AAO12070.1|  320|Anopheles gambiae odorant-binding
           protein AgamOBP32 protein.
          Length = 320

 Score = 22.6 bits (46), Expect = 7.2
 Identities = 9/17 (52%), Positives = 11/17 (64%)
 Frame = +2

Query: 305 RFREKTIGCYSRHLTDC 355
           RFRE T  CY R  ++C
Sbjct: 226 RFRETTGTCYRRLKSEC 242


>AY146754-1|AAO12069.1|  334|Anopheles gambiae odorant-binding
           protein AgamOBP33 protein.
          Length = 334

 Score = 22.6 bits (46), Expect = 7.2
 Identities = 9/17 (52%), Positives = 11/17 (64%)
 Frame = +2

Query: 305 RFREKTIGCYSRHLTDC 355
           RFRE T  CY R  ++C
Sbjct: 226 RFRETTGTCYRRLKSEC 242


>AY928182-1|AAX22219.1|  335|Anopheles gambiae phenoloxidase
           inhibitor protein protein.
          Length = 335

 Score = 22.2 bits (45), Expect = 9.6
 Identities = 10/21 (47%), Positives = 12/21 (57%)
 Frame = +3

Query: 117 CCYVSCYSFSLQLTQVFQSSS 179
           CC  SC SFS +   V  S+S
Sbjct: 41  CCSGSCLSFSYKCVPVPASAS 61


>AY324315-1|AAQ89700.1|  153|Anopheles gambiae insulin-like peptide
           7 precursor protein.
          Length = 153

 Score = 22.2 bits (45), Expect = 9.6
 Identities = 8/17 (47%), Positives = 10/17 (58%)
 Frame = +3

Query: 84  FHENIRVNLLKCCYVSC 134
           FH   R  + +CCY SC
Sbjct: 126 FHRVRRQVVAECCYQSC 142


>AY324314-1|AAQ89699.1|  153|Anopheles gambiae insulin-like peptide
           7 precursor protein.
          Length = 153

 Score = 22.2 bits (45), Expect = 9.6
 Identities = 8/17 (47%), Positives = 10/17 (58%)
 Frame = +3

Query: 84  FHENIRVNLLKCCYVSC 134
           FH   R  + +CCY SC
Sbjct: 126 FHRVRRQVVAECCYQSC 142


>AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein.
          Length = 2259

 Score = 22.2 bits (45), Expect = 9.6
 Identities = 9/29 (31%), Positives = 15/29 (51%)
 Frame = -3

Query: 475 SVSLKENKQLCPSRIKEGGHTYDIFVLFL 389
           S  +K +  LCP R+K   H  ++   F+
Sbjct: 906 SGEVKVSLDLCPQRVKLSAHQLEMVNCFV 934


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 465,628
Number of Sequences: 2352
Number of extensions: 8244
Number of successful extensions: 29
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 25
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 29
length of database: 563,979
effective HSP length: 59
effective length of database: 425,211
effective search space used: 42095889
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).