SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0016
         (532 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein.            26   0.91 
AB090814-1|BAC57903.1|  499|Anopheles gambiae gag-like protein p...    26   0.91 
AY146744-1|AAO12104.1|  176|Anopheles gambiae odorant-binding pr...    25   1.6  
AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein.            25   2.1  
AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein.            25   2.1  
AY146723-1|AAO12083.1|  155|Anopheles gambiae odorant-binding pr...    25   2.1  
AY146721-1|AAO12081.1|  144|Anopheles gambiae odorant-binding pr...    25   2.1  
AF437884-1|AAL84179.1|  144|Anopheles gambiae odorant binding pr...    25   2.1  
AY146717-1|AAO12077.1|  188|Anopheles gambiae odorant-binding pr...    24   2.8  
AY146759-1|AAO12074.1|  356|Anopheles gambiae odorant-binding pr...    23   4.8  
AF515526-1|AAM61893.1|  229|Anopheles gambiae glutathione S-tran...    23   8.4  

>AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein.
          Length = 3361

 Score = 25.8 bits (54), Expect = 0.91
 Identities = 11/31 (35%), Positives = 19/31 (61%)
 Frame = -3

Query: 152 KIPVPTVFFKKRRLIVLEQRTTYDFTKYFEK 60
           KI   TVF +K R +++ Q +  D+T+ F +
Sbjct: 28  KIANNTVFVRKNRALLIYQLSNKDYTEVFHE 58


>AB090814-1|BAC57903.1|  499|Anopheles gambiae gag-like protein
           protein.
          Length = 499

 Score = 25.8 bits (54), Expect = 0.91
 Identities = 8/24 (33%), Positives = 17/24 (70%)
 Frame = +1

Query: 262 KVEELRREIAQQPPNTPLTPEQAQ 333
           + E+  RE+  +PP TP+T ++++
Sbjct: 164 RAEKALREVQSEPPETPMTGKRSR 187


>AY146744-1|AAO12104.1|  176|Anopheles gambiae odorant-binding
           protein AgamOBP8 protein.
          Length = 176

 Score = 25.0 bits (52), Expect = 1.6
 Identities = 9/21 (42%), Positives = 15/21 (71%)
 Frame = -2

Query: 159 VFQDSSPYSVFQKTTPYCIRT 97
           V ++S+P+S+FQ    Y +RT
Sbjct: 37  VLRNSTPFSIFQTHGAYVVRT 57


>AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein.
          Length = 3320

 Score = 24.6 bits (51), Expect = 2.1
 Identities = 9/21 (42%), Positives = 12/21 (57%)
 Frame = -3

Query: 365  CLMVEANSLTTWACSGVNGVF 303
            C  +E N L T AC+G N  +
Sbjct: 3118 CYPIEYNGLLTTACAGTNSSY 3138


>AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein.
          Length = 3318

 Score = 24.6 bits (51), Expect = 2.1
 Identities = 9/21 (42%), Positives = 12/21 (57%)
 Frame = -3

Query: 365  CLMVEANSLTTWACSGVNGVF 303
            C  +E N L T AC+G N  +
Sbjct: 3121 CYPIEYNGLLTTACAGTNSSY 3141


>AY146723-1|AAO12083.1|  155|Anopheles gambiae odorant-binding
           protein AgamOBP17 protein.
          Length = 155

 Score = 24.6 bits (51), Expect = 2.1
 Identities = 14/37 (37%), Positives = 22/37 (59%), Gaps = 1/37 (2%)
 Frame = +2

Query: 143 LES*KTM-DSCIGVEQDLDKAITKFTNLNEHTDEVLQ 250
           LE+ K + D C+G     ++AI KF++   H DE L+
Sbjct: 35  LEALKPLHDICLGKTGVTEEAIKKFSDEEIHEDEKLK 71


>AY146721-1|AAO12081.1|  144|Anopheles gambiae odorant-binding
           protein AgamOBP1 protein.
          Length = 144

 Score = 24.6 bits (51), Expect = 2.1
 Identities = 14/37 (37%), Positives = 22/37 (59%), Gaps = 1/37 (2%)
 Frame = +2

Query: 143 LES*KTM-DSCIGVEQDLDKAITKFTNLNEHTDEVLQ 250
           LE+ K + D C+G     ++AI KF++   H DE L+
Sbjct: 35  LEALKPLHDICLGKTGVTEEAIKKFSDEEIHEDEKLK 71


>AF437884-1|AAL84179.1|  144|Anopheles gambiae odorant binding
           protein protein.
          Length = 144

 Score = 24.6 bits (51), Expect = 2.1
 Identities = 14/37 (37%), Positives = 22/37 (59%), Gaps = 1/37 (2%)
 Frame = +2

Query: 143 LES*KTM-DSCIGVEQDLDKAITKFTNLNEHTDEVLQ 250
           LE+ K + D C+G     ++AI KF++   H DE L+
Sbjct: 35  LEALKPLHDICLGKTGVTEEAIKKFSDEEIHEDEKLK 71


>AY146717-1|AAO12077.1|  188|Anopheles gambiae odorant-binding
           protein AgamOBP14 protein.
          Length = 188

 Score = 24.2 bits (50), Expect = 2.8
 Identities = 10/32 (31%), Positives = 15/32 (46%)
 Frame = +2

Query: 356 PSNRMHFNCQQITENSMLQCQRVGKSIDRHFV 451
           P  +    C  ++ N  L C   G  IDRH++
Sbjct: 82  PETQCFVRC--LSANLNLYCDETGSDIDRHYL 111


>AY146759-1|AAO12074.1|  356|Anopheles gambiae odorant-binding
           protein AgamOBP45 protein.
          Length = 356

 Score = 23.4 bits (48), Expect = 4.8
 Identities = 9/21 (42%), Positives = 13/21 (61%)
 Frame = -2

Query: 489 HFPPLEQLLHNRATKCLSIDL 427
           H  PL++L  NR  +CL  +L
Sbjct: 103 HPDPLDELYENRTAECLRKEL 123


>AF515526-1|AAM61893.1|  229|Anopheles gambiae glutathione
           S-transferase protein.
          Length = 229

 Score = 22.6 bits (46), Expect = 8.4
 Identities = 8/17 (47%), Positives = 10/17 (58%)
 Frame = +3

Query: 357 HQTECISIVNRSQRTPC 407
           H TE    +NR Q+ PC
Sbjct: 42  HLTEEFKAINRFQKVPC 58


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 580,688
Number of Sequences: 2352
Number of extensions: 10862
Number of successful extensions: 27
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 27
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 27
length of database: 563,979
effective HSP length: 60
effective length of database: 422,859
effective search space used: 49051644
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).