SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0010
         (539 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein.            24   3.7  
CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel...    23   8.7  
AY045760-4|AAK84945.1|  165|Anopheles gambiae D7-related 4 prote...    23   8.7  
AJ302659-1|CAC35524.1|  165|Anopheles gambiae D7r4 protein protein.    23   8.7  

>AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein.
          Length = 3318

 Score = 23.8 bits (49), Expect = 3.7
 Identities = 7/17 (41%), Positives = 14/17 (82%)
 Frame = -1

Query: 374  HNVIRSTYCLECSENCS 324
            ++V+R  YC++CS++ S
Sbjct: 3007 NSVMRLEYCIDCSQDAS 3023


>CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal
            structural protein protein.
          Length = 1645

 Score = 22.6 bits (46), Expect = 8.7
 Identities = 11/32 (34%), Positives = 17/32 (53%)
 Frame = +1

Query: 121  LTTQNIVDFKLLCSQGENILSQLLNYIFQSNQ 216
            LTT   V FKLL  +  +   + +N+I +  Q
Sbjct: 1386 LTTGGAVPFKLLTKKSRDQALKAINFIEREQQ 1417


>AY045760-4|AAK84945.1|  165|Anopheles gambiae D7-related 4 protein
           protein.
          Length = 165

 Score = 22.6 bits (46), Expect = 8.7
 Identities = 9/16 (56%), Positives = 12/16 (75%)
 Frame = +3

Query: 306 YKCLLE*TVLRTFQTI 353
           YKCLL+ T  RTF+ +
Sbjct: 115 YKCLLKSTTGRTFKKV 130


>AJ302659-1|CAC35524.1|  165|Anopheles gambiae D7r4 protein protein.
          Length = 165

 Score = 22.6 bits (46), Expect = 8.7
 Identities = 9/16 (56%), Positives = 12/16 (75%)
 Frame = +3

Query: 306 YKCLLE*TVLRTFQTI 353
           YKCLL+ T  RTF+ +
Sbjct: 115 YKCLLKSTTGRTFKKV 130


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 497,830
Number of Sequences: 2352
Number of extensions: 8525
Number of successful extensions: 8
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 8
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 8
length of database: 563,979
effective HSP length: 60
effective length of database: 422,859
effective search space used: 50320221
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).