SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0009
         (606 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ439060-7|CAD27758.1|  849|Anopheles gambiae putative V-ATPase ...    27   0.36 
AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein.            25   1.4  
X87411-1|CAA60858.1|  599|Anopheles gambiae maltase-like protein...    25   2.5  
AJ439060-8|CAD27759.1|  808|Anopheles gambiae putative V-ATPase ...    24   4.4  
AJ438610-1|CAD27473.1|  838|Anopheles gambiae putative microtubu...    24   4.4  

>AJ439060-7|CAD27758.1|  849|Anopheles gambiae putative V-ATPase
           protein.
          Length = 849

 Score = 27.5 bits (58), Expect = 0.36
 Identities = 12/44 (27%), Positives = 20/44 (45%)
 Frame = -1

Query: 552 KPEYTLSGPGCVENAFLFFVQFHLFENHKTHTRFYIFKFDSFND 421
           K +Y    PGC  +  + F+   LF+N +       F F+  N+
Sbjct: 597 KTDYQPRTPGCAPSVLIMFINMMLFKNSEPFHGCDEFMFEGQNE 640


>AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein.
          Length = 3398

 Score = 25.4 bits (53), Expect = 1.4
 Identities = 12/34 (35%), Positives = 17/34 (50%)
 Frame = +1

Query: 112  RQIDKWHGQLFRNIFIFFITDMLGRSQSPPAVKW 213
            RQI KW G++ R + IF    +  R+Q      W
Sbjct: 2939 RQISKWSGKVKRTVDIFVANMITFRAQLALGRDW 2972


>X87411-1|CAA60858.1|  599|Anopheles gambiae maltase-like protein
           Agm2 protein.
          Length = 599

 Score = 24.6 bits (51), Expect = 2.5
 Identities = 7/21 (33%), Positives = 9/21 (42%)
 Frame = +2

Query: 452 NRVCVLWFSNKWNWTKNRKAF 514
           N     W+ + W W   RK F
Sbjct: 158 NNWVAAWYGSAWEWNDERKQF 178


>AJ439060-8|CAD27759.1|  808|Anopheles gambiae putative V-ATPase
           protein.
          Length = 808

 Score = 23.8 bits (49), Expect = 4.4
 Identities = 7/21 (33%), Positives = 12/21 (57%)
 Frame = -1

Query: 528 PGCVENAFLFFVQFHLFENHK 466
           PGC  +  + F+   LF+N +
Sbjct: 594 PGCAPSVLIMFINMMLFKNQE 614


>AJ438610-1|CAD27473.1|  838|Anopheles gambiae putative microtubule
           binding protein protein.
          Length = 838

 Score = 23.8 bits (49), Expect = 4.4
 Identities = 9/19 (47%), Positives = 11/19 (57%)
 Frame = +3

Query: 24  GGGGSEMRADRKEWNKKIR 80
           GGGG   R   +EWN + R
Sbjct: 532 GGGGGGGREGSQEWNSRSR 550


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 665,458
Number of Sequences: 2352
Number of extensions: 12959
Number of successful extensions: 27
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 26
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 27
length of database: 563,979
effective HSP length: 61
effective length of database: 420,507
effective search space used: 58870980
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).