SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0007
         (555 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY604021-1|AAT38515.1|  118|Anopheles gambiae LZ9988P protein.         24   3.9  
AY146735-1|AAO12095.1|  149|Anopheles gambiae odorant-binding pr...    24   3.9  
AY705402-1|AAU12511.1|  509|Anopheles gambiae nicotinic acetylch...    23   8.9  
AJ237664-1|CAB40379.2|   81|Anopheles gambiae putative infection...    23   8.9  

>AY604021-1|AAT38515.1|  118|Anopheles gambiae LZ9988P protein.
          Length = 118

 Score = 23.8 bits (49), Expect = 3.9
 Identities = 14/48 (29%), Positives = 23/48 (47%), Gaps = 4/48 (8%)
 Frame = -1

Query: 501 SRIR*WAICFFELVAFLSKPFRNTEDMSGNAYDVFKP----ETFLKSC 370
           S+I+    CFFE   F++K  +  E+        F P    E+ +K+C
Sbjct: 45  SKIKCLVKCFFEKTGFMNKDGQLQEETITEQLSKFMPRERIESLVKNC 92


>AY146735-1|AAO12095.1|  149|Anopheles gambiae odorant-binding
           protein AgamOBP25 protein.
          Length = 149

 Score = 23.8 bits (49), Expect = 3.9
 Identities = 14/48 (29%), Positives = 23/48 (47%), Gaps = 4/48 (8%)
 Frame = -1

Query: 501 SRIR*WAICFFELVAFLSKPFRNTEDMSGNAYDVFKP----ETFLKSC 370
           S+I+    CFFE   F++K  +  E+        F P    E+ +K+C
Sbjct: 69  SKIKCLVKCFFEKTGFMNKDGQLQEETITEQLSKFMPRERIESLVKNC 116


>AY705402-1|AAU12511.1|  509|Anopheles gambiae nicotinic
           acetylcholine receptor subunitalpha 7 protein.
          Length = 509

 Score = 22.6 bits (46), Expect = 8.9
 Identities = 7/14 (50%), Positives = 11/14 (78%)
 Frame = -2

Query: 323 TLPYQPSFYPELYR 282
           TLP+ P++Y  +YR
Sbjct: 383 TLPHNPTYYRTVYR 396


>AJ237664-1|CAB40379.2|   81|Anopheles gambiae putative infection
           responsive shortpeptide protein.
          Length = 81

 Score = 22.6 bits (46), Expect = 8.9
 Identities = 10/27 (37%), Positives = 12/27 (44%)
 Frame = +3

Query: 108 VFKLNSGCITCKDIQNKYVLLNYVNNK 188
           VF     C  CK I  +Y    Y+N K
Sbjct: 22  VFAYAPTCARCKSIGARYCGYGYLNRK 48


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 544,630
Number of Sequences: 2352
Number of extensions: 11275
Number of successful extensions: 6
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6
length of database: 563,979
effective HSP length: 61
effective length of database: 420,507
effective search space used: 51722361
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).