SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0006
         (600 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U02964-1|AAA03444.1|  376|Anopheles gambiae actin 1D protein.         157   3e-40
U02933-1|AAA56882.1|  376|Anopheles gambiae actin 1D protein.         157   3e-40
U02930-1|AAA56881.1|  376|Anopheles gambiae actin 1D protein.         157   3e-40
CR954256-1|CAJ14142.1|  376|Anopheles gambiae actin protein.          148   2e-37
CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein.          26   1.1  
AY027891-1|AAK15783.1|  801|Anopheles gambiae collagen IV alpha ...    25   2.5  
AF002238-1|AAB97731.1|  327|Anopheles gambiae ribosomal protein ...    24   4.3  
AY330181-1|AAQ16287.1|  156|Anopheles gambiae odorant-binding pr...    23   5.7  
AJ250916-1|CAB91840.1|  435|Anopheles gambiae serine protease pr...    23   5.7  
EF519478-1|ABP73565.1|  165|Anopheles gambiae CTLMA2 protein.          23   7.5  
AY578798-1|AAT07303.1|  356|Anopheles gambiae baboon protein.          23   7.5  
AY062200-1|AAL58561.1|  151|Anopheles gambiae cytochrome P450 CY...    23   7.5  
AJ438610-1|CAD27473.1|  838|Anopheles gambiae putative microtubu...    23   7.5  

>U02964-1|AAA03444.1|  376|Anopheles gambiae actin 1D protein.
          Length = 376

 Score =  157 bits (381), Expect = 3e-40
 Identities = 83/134 (61%), Positives = 88/134 (65%)
 Frame = +2

Query: 86  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHR 265
           MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG   +
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 266 AKXXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKM 445
           +K                      +             PEEHPVLLTEAPLNPKA   KM
Sbjct: 61  SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 446 THIMFPKHFTRPAI 487
           T IMF + F  PA+
Sbjct: 121 TQIMF-ETFNTPAM 133



 Score =  104 bits (249), Expect = 3e-24
 Identities = 59/106 (55%), Positives = 65/106 (61%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGIVTNWDDMEKIWHHTFYNEL VAP   P         P+ +R
Sbjct: 58  EAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANR 117

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF TP    V IQ VL  +   R      DS  G+S
Sbjct: 118 EKMTQI-MFETFNTPA-MYVAIQAVLSLYASGRTTGIVLDSGDGVS 161


>U02933-1|AAA56882.1|  376|Anopheles gambiae actin 1D protein.
          Length = 376

 Score =  157 bits (381), Expect = 3e-40
 Identities = 83/134 (61%), Positives = 88/134 (65%)
 Frame = +2

Query: 86  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHR 265
           MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG   +
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 266 AKXXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKM 445
           +K                      +             PEEHPVLLTEAPLNPKA   KM
Sbjct: 61  SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 446 THIMFPKHFTRPAI 487
           T IMF + F  PA+
Sbjct: 121 TQIMF-ETFNTPAM 133



 Score =  104 bits (249), Expect = 3e-24
 Identities = 59/106 (55%), Positives = 65/106 (61%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGIVTNWDDMEKIWHHTFYNEL VAP   P         P+ +R
Sbjct: 58  EAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANR 117

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF TP    V IQ VL  +   R      DS  G+S
Sbjct: 118 EKMTQI-MFETFNTPA-MYVAIQAVLSLYASGRTTGIVLDSGDGVS 161


>U02930-1|AAA56881.1|  376|Anopheles gambiae actin 1D protein.
          Length = 376

 Score =  157 bits (381), Expect = 3e-40
 Identities = 83/134 (61%), Positives = 88/134 (65%)
 Frame = +2

Query: 86  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHR 265
           MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG   +
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 266 AKXXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKM 445
           +K                      +             PEEHPVLLTEAPLNPKA   KM
Sbjct: 61  SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 446 THIMFPKHFTRPAI 487
           T IMF + F  PA+
Sbjct: 121 TQIMF-ETFNTPAM 133



 Score =  104 bits (249), Expect = 3e-24
 Identities = 59/106 (55%), Positives = 65/106 (61%)
 Frame = +1

Query: 256 EAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH*GSPQPQGHR 435
           EAQSKRG LTLKYPIEHGIVTNWDDMEKIWHHTFYNEL VAP   P         P+ +R
Sbjct: 58  EAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANR 117

Query: 436 EKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
           EK     + +TF TP    V IQ VL  +   R      DS  G+S
Sbjct: 118 EKMTQI-MFETFNTPA-MYVAIQAVLSLYASGRTTGIVLDSGDGVS 161


>CR954256-1|CAJ14142.1|  376|Anopheles gambiae actin protein.
          Length = 376

 Score =  148 bits (358), Expect = 2e-37
 Identities = 76/134 (56%), Positives = 85/134 (63%)
 Frame = +2

Query: 86  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGVRHR 265
           MCD++  ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMG KD+YVG   +
Sbjct: 1   MCDDDAGALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGNKDAYVGDEAQ 60

Query: 266 AKXXXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSWVSPPEEHPVLLTEAPLNPKATERKM 445
           +K                      +             PEEHPVLLTEAPLNPK+   KM
Sbjct: 61  SKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKSNREKM 120

Query: 446 THIMFPKHFTRPAI 487
           T IMF + F  PA+
Sbjct: 121 TQIMF-ETFAAPAV 133



 Score =  102 bits (245), Expect = 8e-24
 Identities = 58/115 (50%), Positives = 66/115 (57%)
 Frame = +1

Query: 229 GTEGLLCRSEAQSKRGFLTLKYPIEHGIVTNWDDMEKIWHHTFYNELGVAPRGTPSPAH* 408
           G +      EAQSKRG LTLKYPIEHGI+TNWDDMEKIWHHTFYNEL VAP   P     
Sbjct: 49  GNKDAYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTE 108

Query: 409 GSPQPQGHREKDDPYHVSKTFYTPRHCSVGIQTVLLAFTPFRGRYPTRDSRLGLS 573
               P+ +REK     + +TF  P    V IQ VL  +   R      DS  G+S
Sbjct: 109 APLNPKSNREKMTQI-MFETFAAPA-VYVAIQAVLSLYASGRTTGVVLDSGDGVS 161


>CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein.
          Length = 1494

 Score = 25.8 bits (54), Expect = 1.1
 Identities = 13/25 (52%), Positives = 14/25 (56%)
 Frame = +1

Query: 373 VAPRGTPSPAH*GSPQPQGHREKDD 447
           V+P   PSP    SPQ   HRE DD
Sbjct: 595 VSPSSFPSPQ--ASPQDDRHRELDD 617


>AY027891-1|AAK15783.1|  801|Anopheles gambiae collagen IV alpha 1
           chain precursor protein.
          Length = 801

 Score = 24.6 bits (51), Expect = 2.5
 Identities = 12/33 (36%), Positives = 16/33 (48%)
 Frame = +1

Query: 193 GKAPPSGRDGRYGTEGLLCRSEAQSKRGFLTLK 291
           G+  P GRDG +G  GL  +   +   G   LK
Sbjct: 344 GQPGPRGRDGNFGPVGLPGQKGDRGSEGLHGLK 376


>AF002238-1|AAB97731.1|  327|Anopheles gambiae ribosomal protein L5
           protein.
          Length = 327

 Score = 23.8 bits (49), Expect = 4.3
 Identities = 8/25 (32%), Positives = 14/25 (56%)
 Frame = -2

Query: 311 IPCSMGYLRVRKPLLLCASLLHKSP 237
           I C + Y R+    ++CA+  H+ P
Sbjct: 60  ITCQIAYRRIEGDRIVCAAYSHELP 84


>AY330181-1|AAQ16287.1|  156|Anopheles gambiae odorant-binding
           protein AgamOBP55 protein.
          Length = 156

 Score = 23.4 bits (48), Expect = 5.7
 Identities = 8/20 (40%), Positives = 14/20 (70%)
 Frame = +2

Query: 80  FKMCDEEVAALVVDNGSGMC 139
           +++C E+ A   +DNG+ MC
Sbjct: 42  YRVCHEQHATPQMDNGTVMC 61


>AJ250916-1|CAB91840.1|  435|Anopheles gambiae serine protease
           protein.
          Length = 435

 Score = 23.4 bits (48), Expect = 5.7
 Identities = 10/29 (34%), Positives = 15/29 (51%)
 Frame = +1

Query: 184 LDRGKAPPSGRDGRYGTEGLLCRSEAQSK 270
           L+R +    G  G+  T+G  CR+ A  K
Sbjct: 81  LERKRRATEGNGGKSSTKGKECRTRAGEK 109


>EF519478-1|ABP73565.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 23.0 bits (47), Expect = 7.5
 Identities = 8/16 (50%), Positives = 10/16 (62%)
 Frame = -3

Query: 199 PSHDRGEHGARSIISC 152
           P+H RGEHG +    C
Sbjct: 121 PNHARGEHGQQPAERC 136


>AY578798-1|AAT07303.1|  356|Anopheles gambiae baboon protein.
          Length = 356

 Score = 23.0 bits (47), Expect = 7.5
 Identities = 17/48 (35%), Positives = 23/48 (47%)
 Frame = -3

Query: 157 SCETGLAHTGAIVYYQRGNFFVAHLELVFN*IVLL*INKLTCYCTASL 14
           S  TGLAH    +   RG   +AH +L    I++   + LTC C   L
Sbjct: 162 SIATGLAHLHMDIVGTRGKPAIAHRDLKSKNILVK--SNLTC-CIGDL 206


>AY062200-1|AAL58561.1|  151|Anopheles gambiae cytochrome P450
           CYP4G17 protein.
          Length = 151

 Score = 23.0 bits (47), Expect = 7.5
 Identities = 8/13 (61%), Positives = 10/13 (76%)
 Frame = +3

Query: 279 PDPQIPHRTRNRH 317
           PD  +P RT+NRH
Sbjct: 122 PDNFLPERTQNRH 134


>AJ438610-1|CAD27473.1|  838|Anopheles gambiae putative microtubule
           binding protein protein.
          Length = 838

 Score = 23.0 bits (47), Expect = 7.5
 Identities = 9/22 (40%), Positives = 12/22 (54%)
 Frame = -3

Query: 589 NPCSPRKVQASNPGLGNGPETV 524
           +P SP K  +  PGL   PE +
Sbjct: 592 SPASPLKSPSKIPGLARRPENI 613


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 768,504
Number of Sequences: 2352
Number of extensions: 18474
Number of successful extensions: 50
Number of sequences better than 10.0: 13
Number of HSP's better than 10.0 without gapping: 39
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 46
length of database: 563,979
effective HSP length: 61
effective length of database: 420,507
effective search space used: 58029966
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).