SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0004
         (637 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U02964-1|AAA03444.1|  376|Anopheles gambiae actin 1D protein.         155   8e-40
U02933-1|AAA56882.1|  376|Anopheles gambiae actin 1D protein.         155   8e-40
U02930-1|AAA56881.1|  376|Anopheles gambiae actin 1D protein.         155   8e-40
CR954256-1|CAJ14142.1|  376|Anopheles gambiae actin protein.          141   1e-35
Z49813-1|CAA89967.1|  247|Anopheles gambiae serine proteinase pr...    26   1.1  
AJ278310-1|CAB93496.1|  219|Anopheles gambiae serine protease-li...    26   1.1  
AY659931-1|AAT51799.1|  167|Anopheles gambiae lysozyme i-1 protein.    25   2.0  
EU068741-1|ABU40241.1|  993|Anopheles gambiae anion exchanger pr...    25   2.7  
AY705398-1|AAU12507.1|  555|Anopheles gambiae nicotinic acetylch...    25   2.7  
AY705397-1|AAU12506.1|  555|Anopheles gambiae nicotinic acetylch...    25   2.7  
AY027891-1|AAK15783.1|  801|Anopheles gambiae collagen IV alpha ...    24   4.6  
AJ441131-3|CAD29632.1|  568|Anopheles gambiae putative apyrase/n...    24   4.6  
AJ250916-1|CAB91840.1|  435|Anopheles gambiae serine protease pr...    24   4.6  
AY330181-1|AAQ16287.1|  156|Anopheles gambiae odorant-binding pr...    23   6.1  
EF519478-1|ABP73565.1|  165|Anopheles gambiae CTLMA2 protein.          23   8.1  
AY062200-1|AAL58561.1|  151|Anopheles gambiae cytochrome P450 CY...    23   8.1  
AJ439398-2|CAD28125.1|  568|Anopheles gambiae putative 5' nucleo...    23   8.1  
AF487536-1|AAL93297.1|  504|Anopheles gambiae cytochrome P450 CY...    23   8.1  

>U02964-1|AAA03444.1|  376|Anopheles gambiae actin 1D protein.
          Length = 376

 Score =  155 bits (377), Expect = 8e-40
 Identities = 81/131 (61%), Positives = 83/131 (63%)
 Frame = +3

Query: 66  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 245
           MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 246 SKRVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKM 425
           SKR                     +             P      L   P  P+A   KM
Sbjct: 61  SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 426 TQIMFETFNTP 458
           TQIMFETFNTP
Sbjct: 121 TQIMFETFNTP 131



 Score =  123 bits (296), Expect = 5e-30
 Identities = 53/58 (91%), Positives = 55/58 (94%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 62  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 119


>U02933-1|AAA56882.1|  376|Anopheles gambiae actin 1D protein.
          Length = 376

 Score =  155 bits (377), Expect = 8e-40
 Identities = 81/131 (61%), Positives = 83/131 (63%)
 Frame = +3

Query: 66  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 245
           MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 246 SKRVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKM 425
           SKR                     +             P      L   P  P+A   KM
Sbjct: 61  SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 426 TQIMFETFNTP 458
           TQIMFETFNTP
Sbjct: 121 TQIMFETFNTP 131



 Score =  123 bits (296), Expect = 5e-30
 Identities = 53/58 (91%), Positives = 55/58 (94%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 62  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 119


>U02930-1|AAA56881.1|  376|Anopheles gambiae actin 1D protein.
          Length = 376

 Score =  155 bits (377), Expect = 8e-40
 Identities = 81/131 (61%), Positives = 83/131 (63%)
 Frame = +3

Query: 66  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 245
           MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 246 SKRVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKM 425
           SKR                     +             P      L   P  P+A   KM
Sbjct: 61  SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 426 TQIMFETFNTP 458
           TQIMFETFNTP
Sbjct: 121 TQIMFETFNTP 131



 Score =  123 bits (296), Expect = 5e-30
 Identities = 53/58 (91%), Positives = 55/58 (94%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 62  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK 119


>CR954256-1|CAJ14142.1|  376|Anopheles gambiae actin protein.
          Length = 376

 Score =  141 bits (342), Expect = 1e-35
 Identities = 76/142 (53%), Positives = 84/142 (59%)
 Frame = +3

Query: 66  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 245
           MCD++  ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMG KD+YVGDEAQ
Sbjct: 1   MCDDDAGALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGNKDAYVGDEAQ 60

Query: 246 SKRVXXXXXXXXXXXXXLTGMTWRRFGIIPSTMSCVSPPRNTQSCLLRLPSTPRATERKM 425
           SKR                     +             P      L   P  P++   KM
Sbjct: 61  SKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKSNREKM 120

Query: 426 TQIMFETFNTPRHVRLAFKPVL 491
           TQIMFETF  P  V +A + VL
Sbjct: 121 TQIMFETFAAPA-VYVAIQAVL 141



 Score =  122 bits (295), Expect = 7e-30
 Identities = 52/58 (89%), Positives = 55/58 (94%)
 Frame = +2

Query: 248 QKSILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEASLNPKGNREK 421
           ++ ILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHPVLLTEA LNPK NREK
Sbjct: 62  KRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKSNREK 119


>Z49813-1|CAA89967.1|  247|Anopheles gambiae serine proteinase
           protein.
          Length = 247

 Score = 25.8 bits (54), Expect = 1.1
 Identities = 8/14 (57%), Positives = 9/14 (64%)
 Frame = -2

Query: 582 VKWGTGCGKTPVPG 541
           V WG GCG+   PG
Sbjct: 210 VSWGVGCGRAGYPG 223


>AJ278310-1|CAB93496.1|  219|Anopheles gambiae serine protease-like
           protein protein.
          Length = 219

 Score = 25.8 bits (54), Expect = 1.1
 Identities = 8/14 (57%), Positives = 10/14 (71%)
 Frame = -2

Query: 582 VKWGTGCGKTPVPG 541
           V WG GCG+  +PG
Sbjct: 177 VAWGIGCGEDGIPG 190


>AY659931-1|AAT51799.1|  167|Anopheles gambiae lysozyme i-1 protein.
          Length = 167

 Score = 25.0 bits (52), Expect = 2.0
 Identities = 10/28 (35%), Positives = 15/28 (53%)
 Frame = -3

Query: 506 KAYSEKHGLECQTYMAGRVKCFEHDLGH 423
           + Y  K G +C     GR+ CF+H + H
Sbjct: 107 QGYMRKFGQDCNG--DGRIDCFDHAIVH 132


>EU068741-1|ABU40241.1|  993|Anopheles gambiae anion exchanger
           protein.
          Length = 993

 Score = 24.6 bits (51), Expect = 2.7
 Identities = 9/25 (36%), Positives = 14/25 (56%)
 Frame = -1

Query: 520 GGTDGRRTARSTGLNAKRTWRGVLN 446
           GG+DG++   +      R W GV+N
Sbjct: 402 GGSDGKKPPNNPLEKTNRLWGGVIN 426


>AY705398-1|AAU12507.1|  555|Anopheles gambiae nicotinic
           acetylcholine receptor subunitalpha 4 protein.
          Length = 555

 Score = 24.6 bits (51), Expect = 2.7
 Identities = 8/21 (38%), Positives = 14/21 (66%)
 Frame = +3

Query: 510 SVPPGIRAGTSREPVFFHNPC 572
           +VP GI++   ++P F H+ C
Sbjct: 446 AVPSGIKSPAFKQPAFSHSVC 466


>AY705397-1|AAU12506.1|  555|Anopheles gambiae nicotinic
           acetylcholine receptor subunitalpha 4 protein.
          Length = 555

 Score = 24.6 bits (51), Expect = 2.7
 Identities = 8/21 (38%), Positives = 14/21 (66%)
 Frame = +3

Query: 510 SVPPGIRAGTSREPVFFHNPC 572
           +VP GI++   ++P F H+ C
Sbjct: 446 AVPSGIKSPAFKQPAFSHSVC 466


>AY027891-1|AAK15783.1|  801|Anopheles gambiae collagen IV alpha 1
           chain precursor protein.
          Length = 801

 Score = 23.8 bits (49), Expect = 4.6
 Identities = 9/17 (52%), Positives = 11/17 (64%)
 Frame = +2

Query: 173 GKAPPSGRDGRYGTEGL 223
           G+  P GRDG +G  GL
Sbjct: 344 GQPGPRGRDGNFGPVGL 360


>AJ441131-3|CAD29632.1|  568|Anopheles gambiae putative
           apyrase/nucleotidase protein.
          Length = 568

 Score = 23.8 bits (49), Expect = 4.6
 Identities = 14/36 (38%), Positives = 18/36 (50%)
 Frame = -2

Query: 264 VRILFCSVPHLLHKSPSVPYRPSRPDGGAFPRSRGT 157
           +R  +CSVPH     P  P R  R   GA+ R  G+
Sbjct: 491 LRCRYCSVPHY---EPLDPERVYRVATGAYIRKGGS 523


>AJ250916-1|CAB91840.1|  435|Anopheles gambiae serine protease
           protein.
          Length = 435

 Score = 23.8 bits (49), Expect = 4.6
 Identities = 13/31 (41%), Positives = 15/31 (48%)
 Frame = -2

Query: 633 QKPPRKWAWGKSGVSLSVKWGTGCGKTPVPG 541
           Q P R+WA     V   V WG  CG+   PG
Sbjct: 392 QLPNRRWA-----VVGIVSWGIRCGEANHPG 417


>AY330181-1|AAQ16287.1|  156|Anopheles gambiae odorant-binding
           protein AgamOBP55 protein.
          Length = 156

 Score = 23.4 bits (48), Expect = 6.1
 Identities = 8/20 (40%), Positives = 14/20 (70%)
 Frame = +3

Query: 60  FKMCDEEVAALVVDNGSGMC 119
           +++C E+ A   +DNG+ MC
Sbjct: 42  YRVCHEQHATPQMDNGTVMC 61


>EF519478-1|ABP73565.1|  165|Anopheles gambiae CTLMA2 protein.
          Length = 165

 Score = 23.0 bits (47), Expect = 8.1
 Identities = 8/16 (50%), Positives = 10/16 (62%)
 Frame = -3

Query: 179 PSHDRGEHGARSIISC 132
           P+H RGEHG +    C
Sbjct: 121 PNHARGEHGQQPAERC 136


>AY062200-1|AAL58561.1|  151|Anopheles gambiae cytochrome P450
           CYP4G17 protein.
          Length = 151

 Score = 23.0 bits (47), Expect = 8.1
 Identities = 8/13 (61%), Positives = 10/13 (76%)
 Frame = +1

Query: 259 PDPQIPHRTRNRH 297
           PD  +P RT+NRH
Sbjct: 122 PDNFLPERTQNRH 134


>AJ439398-2|CAD28125.1|  568|Anopheles gambiae putative 5'
           nucleotidase protein.
          Length = 568

 Score = 23.0 bits (47), Expect = 8.1
 Identities = 13/36 (36%), Positives = 18/36 (50%)
 Frame = -2

Query: 264 VRILFCSVPHLLHKSPSVPYRPSRPDGGAFPRSRGT 157
           +R  +CSVPH     P   YR +    GA+ R  G+
Sbjct: 491 LRCRYCSVPHYEPLDPEHVYRVAT---GAYIRKGGS 523


>AF487536-1|AAL93297.1|  504|Anopheles gambiae cytochrome P450
           CYP6Y1 protein.
          Length = 504

 Score = 23.0 bits (47), Expect = 8.1
 Identities = 10/24 (41%), Positives = 12/24 (50%)
 Frame = +2

Query: 557 FPQPVPHFTERDTPLFPHAHFLGG 628
           FP    +F ERD PL  H   + G
Sbjct: 101 FPNRGVYFNERDDPLSAHMFAIEG 124


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 817,252
Number of Sequences: 2352
Number of extensions: 20109
Number of successful extensions: 74
Number of sequences better than 10.0: 18
Number of HSP's better than 10.0 without gapping: 62
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 74
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 62305095
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).