SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0002
         (607 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ459959-1|CAD31058.1|  462|Anopheles gambiae dopachrome convers...    46   9e-07

>AJ459959-1|CAD31058.1|  462|Anopheles gambiae dopachrome conversion
           enzyme protein.
          Length = 462

 Score = 46.0 bits (104), Expect = 9e-07
 Identities = 26/79 (32%), Positives = 42/79 (53%)
 Frame = +1

Query: 16  LVFCGLDSLASATIKLQEIFSWNVVDWNYPDQFSKQQALRTGALIPENALPVGIERWRNK 195
           L+  GL  L S  +   E+  W  V+++ P +  +    R    IP   +P+G    +N+
Sbjct: 10  LLLAGLAVLVSGQV--DEVLKWQRVEYDVPAEVLQ----RENGYIPIGNIPMGAVHHKNR 63

Query: 196 LFVSVPRWRSGIPATLNYI 252
           +FV+V R R GIP+TLN +
Sbjct: 64  VFVAVARRRWGIPSTLNVV 82



 Score = 27.9 bits (59), Expect = 0.27
 Identities = 16/38 (42%), Positives = 20/38 (52%), Gaps = 3/38 (7%)
 Frame = +3

Query: 285 LTPYPSFEGNELGKLSKQD*LLYTGV---KADQCDRLW 389
           L PYP+F  NEL    + D      V   + D+CDRLW
Sbjct: 95  LKPYPNFALNELRADLQPDANRIVTVYRPRVDRCDRLW 132


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 686,151
Number of Sequences: 2352
Number of extensions: 14524
Number of successful extensions: 28
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 25
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 27
length of database: 563,979
effective HSP length: 61
effective length of database: 420,507
effective search space used: 58870980
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).