BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brP-0055 (700 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 25 1.7 AF510719-1|AAP47148.1| 591|Anopheles gambiae ammonium transport... 23 7.0 AF515734-1|AAO14865.1| 1325|Anopheles gambiae xanthine dehydroge... 23 9.2 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 25.4 bits (53), Expect = 1.7 Identities = 13/35 (37%), Positives = 16/35 (45%) Frame = +2 Query: 413 DSXHGLSAGPVAYSTPSFAGFPGGHTAFTFXPAAN 517 D+ L G VA PS G+P HT + P N Sbjct: 1754 DNATQLLTGKVAELNPSCEGYPYTHTIYGNDPTEN 1788 >AF510719-1|AAP47148.1| 591|Anopheles gambiae ammonium transport-like protein protein. Length = 591 Score = 23.4 bits (48), Expect = 7.0 Identities = 11/37 (29%), Positives = 15/37 (40%) Frame = +2 Query: 53 YGKLQQYNLVGSLGGSPXHYASGVKGLSSYGSTGPVL 163 +G L+ +V G P H G +S GP L Sbjct: 183 HGFLKNLGVVDIAGSGPVHLIGGASAFASAAILGPRL 219 >AF515734-1|AAO14865.1| 1325|Anopheles gambiae xanthine dehydrogenase protein. Length = 1325 Score = 23.0 bits (47), Expect = 9.2 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = +2 Query: 431 SAGPVAYSTPSFAGFPG 481 S GP Y P FA PG Sbjct: 1212 SRGPGMYKLPGFADIPG 1228 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 553,902 Number of Sequences: 2352 Number of extensions: 8709 Number of successful extensions: 15 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 71086350 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -