BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0105 (705 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF469165-1|AAL68692.1| 226|Anopheles gambiae amylase protein. 25 2.3 AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcript... 23 7.1 AY578800-1|AAT07305.1| 379|Anopheles gambiae decapentaplegic pr... 23 9.4 >AF469165-1|AAL68692.1| 226|Anopheles gambiae amylase protein. Length = 226 Score = 25.0 bits (52), Expect = 2.3 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = +2 Query: 233 EYGNIKISAMAIVDETKQSWADDDDFQILKPNIN 334 +YG +++ + +T Q DD IL P IN Sbjct: 73 DYGTVRLMSSYNFTDTDQGPPSDDRANILPPGIN 106 >AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcriptase protein. Length = 1022 Score = 23.4 bits (48), Expect = 7.1 Identities = 11/33 (33%), Positives = 18/33 (54%) Frame = +1 Query: 4 HRFSFHRQRLQGHNRHQECFGSGT*HKGIIERI 102 HR + H +R+QG + +Q F G IE++ Sbjct: 498 HRLNNHIERVQGLSENQYGFRKGRATTDAIEKV 530 >AY578800-1|AAT07305.1| 379|Anopheles gambiae decapentaplegic protein. Length = 379 Score = 23.0 bits (47), Expect = 9.4 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = +1 Query: 364 AAGNSGTVAFEPSEQYAEWVRVPR 435 A SGT +F+ W+R PR Sbjct: 159 AINESGTASFDVMPAVERWLRQPR 182 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 660,883 Number of Sequences: 2352 Number of extensions: 12533 Number of successful extensions: 17 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 71922660 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -