SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30060
         (824 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

X12447-1|CAA30979.1|  364|Homo sapiens aldolase A protein.            124   4e-28
X07292-1|CAA30270.1|  364|Homo sapiens fructose bisphosphate ald...   123   7e-28
X05236-1|CAA28861.1|  364|Homo sapiens protein ( Human fibroblas...   123   7e-28
X05196-1|CAA28825.1|  364|Homo sapiens aldolase C protein.            123   7e-28
M11560-1|AAA51690.1|  364|Homo sapiens ALDOA protein.                 123   7e-28
CR541881-1|CAG46679.1|  364|Homo sapiens ALDOC protein.               123   7e-28
CR541880-1|CAG46678.1|  364|Homo sapiens ALDOA protein.               123   7e-28
CR541862-1|CAG46660.1|  364|Homo sapiens ALDOC protein.               123   7e-28
CR536528-1|CAG38765.1|  364|Homo sapiens ALDOA protein.               123   7e-28
BT007006-1|AAP35652.1|  364|Homo sapiens aldolase C, fructose-bi...   123   7e-28
BC106926-1|AAI06927.1|  364|Homo sapiens aldolase C, fructose-bi...   123   7e-28
BC106925-1|AAI06926.1|  364|Homo sapiens aldolase C, fructose-bi...   123   7e-28
BC103760-1|AAI03761.1|  398|Homo sapiens ALDOC protein protein.       123   7e-28
BC065565-1|AAH65565.2|  364|Homo sapiens aldolase C, fructose-bi...   123   7e-28
BC016800-1|AAH16800.1|  364|Homo sapiens aldolase A, fructose-bi...   123   7e-28
BC015888-1|AAH15888.1|  364|Homo sapiens aldolase A, fructose-bi...   123   7e-28
BC013614-1|AAH13614.1|  364|Homo sapiens aldolase A, fructose-bi...   123   7e-28
BC012880-1|AAH12880.1|  364|Homo sapiens aldolase A, fructose-bi...   123   7e-28
BC010660-1|AAH10660.1|  364|Homo sapiens aldolase A, fructose-bi...   123   7e-28
BC004333-1|AAH04333.1|  364|Homo sapiens aldolase A, fructose-bi...   123   7e-28
BC003613-1|AAH03613.3|  364|Homo sapiens aldolase C, fructose-bi...   123   7e-28
AF054987-1|AAC09348.1|  364|Homo sapiens aldolase C protein.          123   7e-28
X02747-1|CAA26526.1|  364|Homo sapiens protein ( Human mRNA for ...   109   1e-23
X01098-1|CAA25572.1|  364|Homo sapiens aldolase B protein.            109   1e-23
M15656-1|AAA51691.1|  364|Homo sapiens protein ( Human aldolase ...   109   1e-23
AL353621-5|CAI14614.1|  364|Homo sapiens aldolase B, fructose-bi...   109   1e-23
BC029399-1|AAH29399.1|  316|Homo sapiens ALDOB protein protein.       108   2e-23
D00183-1|BAA00125.1|  364|Homo sapiens aldolase B protein.            108   3e-23
X06352-1|CAA29654.1|  108|Homo sapiens aldolase A protein protein.     88   3e-17
BC016170-1|AAH16170.1|  260|Homo sapiens Similar to aldolase A, ...    81   4e-15
BC000367-1|AAH00367.2|  260|Homo sapiens ALDOA protein protein.        81   4e-15
AL353621-6|CAI14615.1|  223|Homo sapiens aldolase B, fructose-bi...    81   5e-15
EF036496-1|ABO65082.1|  141|Homo sapiens aldolase A protein.           58   5e-08
M21190-1|AAA51697.1|  226|Homo sapiens ALDOA protein.                  35   0.31 
EF036497-1|ABO65083.1|  122|Homo sapiens aldolase A protein.           35   0.31 
AF361356-1|AAL50051.1|  192|Homo sapiens voltage-dependent calci...    32   2.2  
BC035596-1|AAH35596.1|  681|Homo sapiens PAK6 protein protein.         31   3.8  
AJ236915-1|CAC18720.1|  681|Homo sapiens pak5 protein protein.         31   3.8  
AF276893-1|AAF82800.1|  681|Homo sapiens p21-activated protein k...    31   3.8  
AK024452-1|BAB15742.1| 1051|Homo sapiens FLJ00044 protein protein.     31   5.1  
AF063612-1|AAD28542.1|  254|Homo sapiens 2'-5'oligoadenylate syn...    31   6.7  
AB002307-1|BAA20768.2| 3053|Homo sapiens KIAA0309 protein.             31   6.7  
BC107427-1|AAI07428.1|  389|Homo sapiens NARG2 protein protein.        30   8.8  
BC071685-1|AAH71685.1|  361|Homo sapiens NARG2 protein protein.        30   8.8  
AF502591-1|AAQ07460.1|  982|Homo sapiens BRCC1 protein.                30   8.8  

>X12447-1|CAA30979.1|  364|Homo sapiens aldolase A protein.
          Length = 364

 Score =  124 bits (299), Expect = 4e-28
 Identities = 60/107 (56%), Positives = 71/107 (66%)
 Frame = +2

Query: 257 DAVLSENISGVILFHETLYQKADDGTPLVSLLEKKGIIPGIKVDKGVVPLFGSEDECTTQ 436
           D  ++  I GVILFHETLYQKADDG P   +++ KG + GIKVDKGVVPL G+  E TTQ
Sbjct: 67  DDRVNPGIGGVILFHETLYQKADDGRPFPQVIKSKGGVVGIKVDKGVVPLAGTNGETTTQ 126

Query: 437 GLDDLAQRCAQYKKDGCHFAKWRCC*RSAATPPRTKLSRKTPMFLAR 577
           GLD L++RCAQYKKDG  FAKWRC  +     P      +    LAR
Sbjct: 127 GLDGLSERCAQYKKDGADFAKWRCVLKIGEHTPSALAIMENANVLAR 173



 Score = 88.2 bits (209), Expect = 3e-17
 Identities = 44/63 (69%), Positives = 50/63 (79%), Gaps = 2/63 (3%)
 Frame = +3

Query: 72  FQYP--TPELQEELKKIAQAIVAPAKGILAADESTGTMGKRLQDIGVENTEENRRRYRQL 245
           +QYP  TPE ++EL  IA  IVAP KGILAADESTG++ KRLQ IG ENTEENRR YRQL
Sbjct: 3   YQYPALTPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQL 62

Query: 246 LFS 254
           L +
Sbjct: 63  LLT 65


>X07292-1|CAA30270.1|  364|Homo sapiens fructose bisphosphate
           aldolase protein.
          Length = 364

 Score =  123 bits (297), Expect = 7e-28
 Identities = 58/100 (58%), Positives = 69/100 (69%)
 Frame = +2

Query: 278 ISGVILFHETLYQKADDGTPLVSLLEKKGIIPGIKVDKGVVPLFGSEDECTTQGLDDLAQ 457
           I GVI FHETLYQK D+G P V  ++ KGI+ GIKVDKGVVPL G++ E TTQGLD L++
Sbjct: 74  IGGVIFFHETLYQKDDNGVPFVRTIQDKGIVVGIKVDKGVVPLAGTDGETTTQGLDGLSE 133

Query: 458 RCAQYKKDGCHFAKWRCC*RSAATPPRTKLSRKTPMFLAR 577
           RCAQYKKDG  FAKWRC  + +   P      +    LAR
Sbjct: 134 RCAQYKKDGADFAKWRCVLKISERTPSALAILENANVLAR 173



 Score = 81.4 bits (192), Expect = 4e-15
 Identities = 42/61 (68%), Positives = 47/61 (77%), Gaps = 2/61 (3%)
 Frame = +3

Query: 78  YP--TPELQEELKKIAQAIVAPAKGILAADESTGTMGKRLQDIGVENTEENRRRYRQLLF 251
           YP  + E ++EL  IA  IVAP KGILAADES G+M KRL  IGVENTEENRR YRQ+LF
Sbjct: 5   YPALSAEQKKELSDIALRIVAPGKGILAADESVGSMAKRLSQIGVENTEENRRLYRQVLF 64

Query: 252 S 254
           S
Sbjct: 65  S 65


>X05236-1|CAA28861.1|  364|Homo sapiens protein ( Human fibroblast
           mRNA for aldolase A. ).
          Length = 364

 Score =  123 bits (297), Expect = 7e-28
 Identities = 59/100 (59%), Positives = 68/100 (68%)
 Frame = +2

Query: 278 ISGVILFHETLYQKADDGTPLVSLLEKKGIIPGIKVDKGVVPLFGSEDECTTQGLDDLAQ 457
           I GVILFHETLYQKADDG P   +++ KG + GIKVDKGVVPL G+  E TTQGLD L++
Sbjct: 74  IGGVILFHETLYQKADDGRPFPQVIKSKGGVVGIKVDKGVVPLAGTNGETTTQGLDGLSE 133

Query: 458 RCAQYKKDGCHFAKWRCC*RSAATPPRTKLSRKTPMFLAR 577
           RCAQYKKDG  FAKWRC  +     P      +    LAR
Sbjct: 134 RCAQYKKDGADFAKWRCVLKIGEHTPSALAIMENANVLAR 173



 Score = 88.2 bits (209), Expect = 3e-17
 Identities = 44/63 (69%), Positives = 50/63 (79%), Gaps = 2/63 (3%)
 Frame = +3

Query: 72  FQYP--TPELQEELKKIAQAIVAPAKGILAADESTGTMGKRLQDIGVENTEENRRRYRQL 245
           +QYP  TPE ++EL  IA  IVAP KGILAADESTG++ KRLQ IG ENTEENRR YRQL
Sbjct: 3   YQYPALTPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQL 62

Query: 246 LFS 254
           L +
Sbjct: 63  LLT 65


>X05196-1|CAA28825.1|  364|Homo sapiens aldolase C protein.
          Length = 364

 Score =  123 bits (297), Expect = 7e-28
 Identities = 58/100 (58%), Positives = 69/100 (69%)
 Frame = +2

Query: 278 ISGVILFHETLYQKADDGTPLVSLLEKKGIIPGIKVDKGVVPLFGSEDECTTQGLDDLAQ 457
           I GVI FHETLYQK D+G P V  ++ KGI+ GIKVDKGVVPL G++ E TTQGLD L++
Sbjct: 74  IGGVIFFHETLYQKDDNGVPFVRTIQDKGIVVGIKVDKGVVPLAGTDGETTTQGLDGLSE 133

Query: 458 RCAQYKKDGCHFAKWRCC*RSAATPPRTKLSRKTPMFLAR 577
           RCAQYKKDG  FAKWRC  + +   P      +    LAR
Sbjct: 134 RCAQYKKDGADFAKWRCVLKISERTPSALAILENANVLAR 173



 Score = 81.4 bits (192), Expect = 4e-15
 Identities = 42/61 (68%), Positives = 47/61 (77%), Gaps = 2/61 (3%)
 Frame = +3

Query: 78  YP--TPELQEELKKIAQAIVAPAKGILAADESTGTMGKRLQDIGVENTEENRRRYRQLLF 251
           YP  + E ++EL  IA  IVAP KGILAADES G+M KRL  IGVENTEENRR YRQ+LF
Sbjct: 5   YPALSAEQKKELSDIALRIVAPGKGILAADESVGSMAKRLSQIGVENTEENRRLYRQVLF 64

Query: 252 S 254
           S
Sbjct: 65  S 65


>M11560-1|AAA51690.1|  364|Homo sapiens ALDOA protein.
          Length = 364

 Score =  123 bits (297), Expect = 7e-28
 Identities = 59/100 (59%), Positives = 68/100 (68%)
 Frame = +2

Query: 278 ISGVILFHETLYQKADDGTPLVSLLEKKGIIPGIKVDKGVVPLFGSEDECTTQGLDDLAQ 457
           I GVILFHETLYQKADDG P   +++ KG + GIKVDKGVVPL G+  E TTQGLD L++
Sbjct: 74  IGGVILFHETLYQKADDGRPFPQVIKSKGGVVGIKVDKGVVPLAGTNGETTTQGLDGLSE 133

Query: 458 RCAQYKKDGCHFAKWRCC*RSAATPPRTKLSRKTPMFLAR 577
           RCAQYKKDG  FAKWRC  +     P      +    LAR
Sbjct: 134 RCAQYKKDGADFAKWRCVLKIGEHTPSALAIMENANVLAR 173



 Score = 88.2 bits (209), Expect = 3e-17
 Identities = 44/63 (69%), Positives = 50/63 (79%), Gaps = 2/63 (3%)
 Frame = +3

Query: 72  FQYP--TPELQEELKKIAQAIVAPAKGILAADESTGTMGKRLQDIGVENTEENRRRYRQL 245
           +QYP  TPE ++EL  IA  IVAP KGILAADESTG++ KRLQ IG ENTEENRR YRQL
Sbjct: 3   YQYPALTPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQL 62

Query: 246 LFS 254
           L +
Sbjct: 63  LLT 65


>CR541881-1|CAG46679.1|  364|Homo sapiens ALDOC protein.
          Length = 364

 Score =  123 bits (297), Expect = 7e-28
 Identities = 58/100 (58%), Positives = 69/100 (69%)
 Frame = +2

Query: 278 ISGVILFHETLYQKADDGTPLVSLLEKKGIIPGIKVDKGVVPLFGSEDECTTQGLDDLAQ 457
           I GVI FHETLYQK D+G P V  ++ KGI+ GIKVDKGVVPL G++ E TTQGLD L++
Sbjct: 74  IGGVIFFHETLYQKDDNGVPFVRTIQDKGIVVGIKVDKGVVPLAGTDGETTTQGLDGLSE 133

Query: 458 RCAQYKKDGCHFAKWRCC*RSAATPPRTKLSRKTPMFLAR 577
           RCAQYKKDG  FAKWRC  + +   P      +    LAR
Sbjct: 134 RCAQYKKDGADFAKWRCVLKISERTPSALAILENANVLAR 173



 Score = 81.4 bits (192), Expect = 4e-15
 Identities = 42/61 (68%), Positives = 47/61 (77%), Gaps = 2/61 (3%)
 Frame = +3

Query: 78  YP--TPELQEELKKIAQAIVAPAKGILAADESTGTMGKRLQDIGVENTEENRRRYRQLLF 251
           YP  + E ++EL  IA  IVAP KGILAADES G+M KRL  IGVENTEENRR YRQ+LF
Sbjct: 5   YPALSAEQKKELSDIALRIVAPGKGILAADESVGSMAKRLSQIGVENTEENRRLYRQVLF 64

Query: 252 S 254
           S
Sbjct: 65  S 65


>CR541880-1|CAG46678.1|  364|Homo sapiens ALDOA protein.
          Length = 364

 Score =  123 bits (297), Expect = 7e-28
 Identities = 59/100 (59%), Positives = 68/100 (68%)
 Frame = +2

Query: 278 ISGVILFHETLYQKADDGTPLVSLLEKKGIIPGIKVDKGVVPLFGSEDECTTQGLDDLAQ 457
           I GVILFHETLYQKADDG P   +++ KG + GIKVDKGVVPL G+  E TTQGLD L++
Sbjct: 74  IGGVILFHETLYQKADDGRPFPQVIKSKGGVVGIKVDKGVVPLAGTNGETTTQGLDGLSE 133

Query: 458 RCAQYKKDGCHFAKWRCC*RSAATPPRTKLSRKTPMFLAR 577
           RCAQYKKDG  FAKWRC  +     P      +    LAR
Sbjct: 134 RCAQYKKDGADFAKWRCVLKIGEHTPSALAIMENANVLAR 173



 Score = 88.2 bits (209), Expect = 3e-17
 Identities = 44/63 (69%), Positives = 50/63 (79%), Gaps = 2/63 (3%)
 Frame = +3

Query: 72  FQYP--TPELQEELKKIAQAIVAPAKGILAADESTGTMGKRLQDIGVENTEENRRRYRQL 245
           +QYP  TPE ++EL  IA  IVAP KGILAADESTG++ KRLQ IG ENTEENRR YRQL
Sbjct: 3   YQYPALTPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQL 62

Query: 246 LFS 254
           L +
Sbjct: 63  LLT 65


>CR541862-1|CAG46660.1|  364|Homo sapiens ALDOC protein.
          Length = 364

 Score =  123 bits (297), Expect = 7e-28
 Identities = 58/100 (58%), Positives = 69/100 (69%)
 Frame = +2

Query: 278 ISGVILFHETLYQKADDGTPLVSLLEKKGIIPGIKVDKGVVPLFGSEDECTTQGLDDLAQ 457
           I GVI FHETLYQK D+G P V  ++ KGI+ GIKVDKGVVPL G++ E TTQGLD L++
Sbjct: 74  IGGVIFFHETLYQKDDNGVPFVRTIQDKGIVVGIKVDKGVVPLAGTDGETTTQGLDGLSE 133

Query: 458 RCAQYKKDGCHFAKWRCC*RSAATPPRTKLSRKTPMFLAR 577
           RCAQYKKDG  FAKWRC  + +   P      +    LAR
Sbjct: 134 RCAQYKKDGADFAKWRCVLKISERTPSALAILENANVLAR 173



 Score = 81.4 bits (192), Expect = 4e-15
 Identities = 42/61 (68%), Positives = 47/61 (77%), Gaps = 2/61 (3%)
 Frame = +3

Query: 78  YP--TPELQEELKKIAQAIVAPAKGILAADESTGTMGKRLQDIGVENTEENRRRYRQLLF 251
           YP  + E ++EL  IA  IVAP KGILAADES G+M KRL  IGVENTEENRR YRQ+LF
Sbjct: 5   YPALSAEQKKELSDIALRIVAPGKGILAADESVGSMAKRLSQIGVENTEENRRLYRQVLF 64

Query: 252 S 254
           S
Sbjct: 65  S 65


>CR536528-1|CAG38765.1|  364|Homo sapiens ALDOA protein.
          Length = 364

 Score =  123 bits (297), Expect = 7e-28
 Identities = 59/100 (59%), Positives = 68/100 (68%)
 Frame = +2

Query: 278 ISGVILFHETLYQKADDGTPLVSLLEKKGIIPGIKVDKGVVPLFGSEDECTTQGLDDLAQ 457
           I GVILFHETLYQKADDG P   +++ KG + GIKVDKGVVPL G+  E TTQGLD L++
Sbjct: 74  IGGVILFHETLYQKADDGRPFPQVIKSKGGVVGIKVDKGVVPLAGTNGETTTQGLDGLSE 133

Query: 458 RCAQYKKDGCHFAKWRCC*RSAATPPRTKLSRKTPMFLAR 577
           RCAQYKKDG  FAKWRC  +     P      +    LAR
Sbjct: 134 RCAQYKKDGADFAKWRCVLKIGEHTPSALAIMENANVLAR 173



 Score = 88.2 bits (209), Expect = 3e-17
 Identities = 44/63 (69%), Positives = 50/63 (79%), Gaps = 2/63 (3%)
 Frame = +3

Query: 72  FQYP--TPELQEELKKIAQAIVAPAKGILAADESTGTMGKRLQDIGVENTEENRRRYRQL 245
           +QYP  TPE ++EL  IA  IVAP KGILAADESTG++ KRLQ IG ENTEENRR YRQL
Sbjct: 3   YQYPALTPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQL 62

Query: 246 LFS 254
           L +
Sbjct: 63  LLT 65


>BT007006-1|AAP35652.1|  364|Homo sapiens aldolase C,
           fructose-bisphosphate protein.
          Length = 364

 Score =  123 bits (297), Expect = 7e-28
 Identities = 58/100 (58%), Positives = 69/100 (69%)
 Frame = +2

Query: 278 ISGVILFHETLYQKADDGTPLVSLLEKKGIIPGIKVDKGVVPLFGSEDECTTQGLDDLAQ 457
           I GVI FHETLYQK D+G P V  ++ KGI+ GIKVDKGVVPL G++ E TTQGLD L++
Sbjct: 74  IGGVIFFHETLYQKDDNGVPFVRTIQDKGIVVGIKVDKGVVPLAGTDGETTTQGLDGLSE 133

Query: 458 RCAQYKKDGCHFAKWRCC*RSAATPPRTKLSRKTPMFLAR 577
           RCAQYKKDG  FAKWRC  + +   P      +    LAR
Sbjct: 134 RCAQYKKDGADFAKWRCVLKISERTPSALAILENANVLAR 173



 Score = 81.4 bits (192), Expect = 4e-15
 Identities = 42/61 (68%), Positives = 47/61 (77%), Gaps = 2/61 (3%)
 Frame = +3

Query: 78  YP--TPELQEELKKIAQAIVAPAKGILAADESTGTMGKRLQDIGVENTEENRRRYRQLLF 251
           YP  + E ++EL  IA  IVAP KGILAADES G+M KRL  IGVENTEENRR YRQ+LF
Sbjct: 5   YPALSAEQKKELSDIALRIVAPGKGILAADESVGSMAKRLSQIGVENTEENRRLYRQVLF 64

Query: 252 S 254
           S
Sbjct: 65  S 65


>BC106926-1|AAI06927.1|  364|Homo sapiens aldolase C,
           fructose-bisphosphate protein.
          Length = 364

 Score =  123 bits (297), Expect = 7e-28
 Identities = 58/100 (58%), Positives = 69/100 (69%)
 Frame = +2

Query: 278 ISGVILFHETLYQKADDGTPLVSLLEKKGIIPGIKVDKGVVPLFGSEDECTTQGLDDLAQ 457
           I GVI FHETLYQK D+G P V  ++ KGI+ GIKVDKGVVPL G++ E TTQGLD L++
Sbjct: 74  IGGVIFFHETLYQKDDNGVPFVRTIQDKGIVVGIKVDKGVVPLAGTDGETTTQGLDGLSE 133

Query: 458 RCAQYKKDGCHFAKWRCC*RSAATPPRTKLSRKTPMFLAR 577
           RCAQYKKDG  FAKWRC  + +   P      +    LAR
Sbjct: 134 RCAQYKKDGADFAKWRCVLKISERTPSALAILENANVLAR 173



 Score = 81.4 bits (192), Expect = 4e-15
 Identities = 42/61 (68%), Positives = 47/61 (77%), Gaps = 2/61 (3%)
 Frame = +3

Query: 78  YP--TPELQEELKKIAQAIVAPAKGILAADESTGTMGKRLQDIGVENTEENRRRYRQLLF 251
           YP  + E ++EL  IA  IVAP KGILAADES G+M KRL  IGVENTEENRR YRQ+LF
Sbjct: 5   YPALSAEQKKELSDIALRIVAPGKGILAADESVGSMAKRLSQIGVENTEENRRLYRQVLF 64

Query: 252 S 254
           S
Sbjct: 65  S 65


>BC106925-1|AAI06926.1|  364|Homo sapiens aldolase C,
           fructose-bisphosphate protein.
          Length = 364

 Score =  123 bits (297), Expect = 7e-28
 Identities = 58/100 (58%), Positives = 69/100 (69%)
 Frame = +2

Query: 278 ISGVILFHETLYQKADDGTPLVSLLEKKGIIPGIKVDKGVVPLFGSEDECTTQGLDDLAQ 457
           I GVI FHETLYQK D+G P V  ++ KGI+ GIKVDKGVVPL G++ E TTQGLD L++
Sbjct: 74  IGGVIFFHETLYQKDDNGVPFVRTIQDKGIVVGIKVDKGVVPLAGTDGETTTQGLDGLSE 133

Query: 458 RCAQYKKDGCHFAKWRCC*RSAATPPRTKLSRKTPMFLAR 577
           RCAQYKKDG  FAKWRC  + +   P      +    LAR
Sbjct: 134 RCAQYKKDGADFAKWRCVLKISERTPSALAILENANVLAR 173



 Score = 81.4 bits (192), Expect = 4e-15
 Identities = 42/61 (68%), Positives = 47/61 (77%), Gaps = 2/61 (3%)
 Frame = +3

Query: 78  YP--TPELQEELKKIAQAIVAPAKGILAADESTGTMGKRLQDIGVENTEENRRRYRQLLF 251
           YP  + E ++EL  IA  IVAP KGILAADES G+M KRL  IGVENTEENRR YRQ+LF
Sbjct: 5   YPALSAEQKKELSDIALRIVAPGKGILAADESVGSMAKRLSQIGVENTEENRRLYRQVLF 64

Query: 252 S 254
           S
Sbjct: 65  S 65


>BC103760-1|AAI03761.1|  398|Homo sapiens ALDOC protein protein.
          Length = 398

 Score =  123 bits (297), Expect = 7e-28
 Identities = 58/100 (58%), Positives = 69/100 (69%)
 Frame = +2

Query: 278 ISGVILFHETLYQKADDGTPLVSLLEKKGIIPGIKVDKGVVPLFGSEDECTTQGLDDLAQ 457
           I GVI FHETLYQK D+G P V  ++ KGI+ GIKVDKGVVPL G++ E TTQGLD L++
Sbjct: 108 IGGVIFFHETLYQKDDNGVPFVRTIQDKGIVVGIKVDKGVVPLAGTDGETTTQGLDGLSE 167

Query: 458 RCAQYKKDGCHFAKWRCC*RSAATPPRTKLSRKTPMFLAR 577
           RCAQYKKDG  FAKWRC  + +   P      +    LAR
Sbjct: 168 RCAQYKKDGADFAKWRCVLKISERTPSALAILENANVLAR 207



 Score = 81.8 bits (193), Expect = 3e-15
 Identities = 42/66 (63%), Positives = 48/66 (72%)
 Frame = +3

Query: 57  TMSTYFQYPTPELQEELKKIAQAIVAPAKGILAADESTGTMGKRLQDIGVENTEENRRRY 236
           TM   +   + E ++EL  IA  IVAP KGILAADES G+M KRL  IGVENTEENRR Y
Sbjct: 34  TMPHSYPALSAEQKKELSDIALRIVAPGKGILAADESVGSMAKRLSQIGVENTEENRRLY 93

Query: 237 RQLLFS 254
           RQ+LFS
Sbjct: 94  RQVLFS 99


>BC065565-1|AAH65565.2|  364|Homo sapiens aldolase C,
           fructose-bisphosphate protein.
          Length = 364

 Score =  123 bits (297), Expect = 7e-28
 Identities = 58/100 (58%), Positives = 69/100 (69%)
 Frame = +2

Query: 278 ISGVILFHETLYQKADDGTPLVSLLEKKGIIPGIKVDKGVVPLFGSEDECTTQGLDDLAQ 457
           I GVI FHETLYQK D+G P V  ++ KGI+ GIKVDKGVVPL G++ E TTQGLD L++
Sbjct: 74  IGGVIFFHETLYQKDDNGVPFVRTIQDKGIVVGIKVDKGVVPLAGTDGETTTQGLDGLSE 133

Query: 458 RCAQYKKDGCHFAKWRCC*RSAATPPRTKLSRKTPMFLAR 577
           RCAQYKKDG  FAKWRC  + +   P      +    LAR
Sbjct: 134 RCAQYKKDGADFAKWRCVLKISERTPSALAILENANVLAR 173



 Score = 81.4 bits (192), Expect = 4e-15
 Identities = 42/61 (68%), Positives = 47/61 (77%), Gaps = 2/61 (3%)
 Frame = +3

Query: 78  YP--TPELQEELKKIAQAIVAPAKGILAADESTGTMGKRLQDIGVENTEENRRRYRQLLF 251
           YP  + E ++EL  IA  IVAP KGILAADES G+M KRL  IGVENTEENRR YRQ+LF
Sbjct: 5   YPALSAEQKKELSDIALRIVAPGKGILAADESVGSMAKRLSQIGVENTEENRRLYRQVLF 64

Query: 252 S 254
           S
Sbjct: 65  S 65


>BC016800-1|AAH16800.1|  364|Homo sapiens aldolase A,
           fructose-bisphosphate protein.
          Length = 364

 Score =  123 bits (297), Expect = 7e-28
 Identities = 59/100 (59%), Positives = 68/100 (68%)
 Frame = +2

Query: 278 ISGVILFHETLYQKADDGTPLVSLLEKKGIIPGIKVDKGVVPLFGSEDECTTQGLDDLAQ 457
           I GVILFHETLYQKADDG P   +++ KG + GIKVDKGVVPL G+  E TTQGLD L++
Sbjct: 74  IGGVILFHETLYQKADDGRPFPQVIKSKGGVVGIKVDKGVVPLAGTNGETTTQGLDGLSE 133

Query: 458 RCAQYKKDGCHFAKWRCC*RSAATPPRTKLSRKTPMFLAR 577
           RCAQYKKDG  FAKWRC  +     P      +    LAR
Sbjct: 134 RCAQYKKDGADFAKWRCVLKIGEHTPSALAIMENANVLAR 173



 Score = 88.2 bits (209), Expect = 3e-17
 Identities = 44/63 (69%), Positives = 50/63 (79%), Gaps = 2/63 (3%)
 Frame = +3

Query: 72  FQYP--TPELQEELKKIAQAIVAPAKGILAADESTGTMGKRLQDIGVENTEENRRRYRQL 245
           +QYP  TPE ++EL  IA  IVAP KGILAADESTG++ KRLQ IG ENTEENRR YRQL
Sbjct: 3   YQYPALTPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQL 62

Query: 246 LFS 254
           L +
Sbjct: 63  LLT 65


>BC015888-1|AAH15888.1|  364|Homo sapiens aldolase A,
           fructose-bisphosphate protein.
          Length = 364

 Score =  123 bits (297), Expect = 7e-28
 Identities = 59/100 (59%), Positives = 68/100 (68%)
 Frame = +2

Query: 278 ISGVILFHETLYQKADDGTPLVSLLEKKGIIPGIKVDKGVVPLFGSEDECTTQGLDDLAQ 457
           I GVILFHETLYQKADDG P   +++ KG + GIKVDKGVVPL G+  E TTQGLD L++
Sbjct: 74  IGGVILFHETLYQKADDGRPFPQVIKSKGGVVGIKVDKGVVPLAGTNGETTTQGLDGLSE 133

Query: 458 RCAQYKKDGCHFAKWRCC*RSAATPPRTKLSRKTPMFLAR 577
           RCAQYKKDG  FAKWRC  +     P      +    LAR
Sbjct: 134 RCAQYKKDGADFAKWRCVLKIGEHTPSALAIMENANVLAR 173



 Score = 88.2 bits (209), Expect = 3e-17
 Identities = 44/63 (69%), Positives = 50/63 (79%), Gaps = 2/63 (3%)
 Frame = +3

Query: 72  FQYP--TPELQEELKKIAQAIVAPAKGILAADESTGTMGKRLQDIGVENTEENRRRYRQL 245
           +QYP  TPE ++EL  IA  IVAP KGILAADESTG++ KRLQ IG ENTEENRR YRQL
Sbjct: 3   YQYPALTPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQL 62

Query: 246 LFS 254
           L +
Sbjct: 63  LLT 65


>BC013614-1|AAH13614.1|  364|Homo sapiens aldolase A,
           fructose-bisphosphate protein.
          Length = 364

 Score =  123 bits (297), Expect = 7e-28
 Identities = 59/100 (59%), Positives = 68/100 (68%)
 Frame = +2

Query: 278 ISGVILFHETLYQKADDGTPLVSLLEKKGIIPGIKVDKGVVPLFGSEDECTTQGLDDLAQ 457
           I GVILFHETLYQKADDG P   +++ KG + GIKVDKGVVPL G+  E TTQGLD L++
Sbjct: 74  IGGVILFHETLYQKADDGRPFPQVIKSKGGVVGIKVDKGVVPLAGTNGETTTQGLDGLSE 133

Query: 458 RCAQYKKDGCHFAKWRCC*RSAATPPRTKLSRKTPMFLAR 577
           RCAQYKKDG  FAKWRC  +     P      +    LAR
Sbjct: 134 RCAQYKKDGADFAKWRCVLKIGEHTPSALAIMENANVLAR 173



 Score = 88.2 bits (209), Expect = 3e-17
 Identities = 44/63 (69%), Positives = 50/63 (79%), Gaps = 2/63 (3%)
 Frame = +3

Query: 72  FQYP--TPELQEELKKIAQAIVAPAKGILAADESTGTMGKRLQDIGVENTEENRRRYRQL 245
           +QYP  TPE ++EL  IA  IVAP KGILAADESTG++ KRLQ IG ENTEENRR YRQL
Sbjct: 3   YQYPALTPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQL 62

Query: 246 LFS 254
           L +
Sbjct: 63  LLT 65


>BC012880-1|AAH12880.1|  364|Homo sapiens aldolase A,
           fructose-bisphosphate protein.
          Length = 364

 Score =  123 bits (297), Expect = 7e-28
 Identities = 59/100 (59%), Positives = 68/100 (68%)
 Frame = +2

Query: 278 ISGVILFHETLYQKADDGTPLVSLLEKKGIIPGIKVDKGVVPLFGSEDECTTQGLDDLAQ 457
           I GVILFHETLYQKADDG P   +++ KG + GIKVDKGVVPL G+  E TTQGLD L++
Sbjct: 74  IGGVILFHETLYQKADDGRPFPQVIKSKGGVVGIKVDKGVVPLAGTNGETTTQGLDGLSE 133

Query: 458 RCAQYKKDGCHFAKWRCC*RSAATPPRTKLSRKTPMFLAR 577
           RCAQYKKDG  FAKWRC  +     P      +    LAR
Sbjct: 134 RCAQYKKDGADFAKWRCVLKIGEHTPSALAIMENANVLAR 173



 Score = 88.2 bits (209), Expect = 3e-17
 Identities = 44/63 (69%), Positives = 50/63 (79%), Gaps = 2/63 (3%)
 Frame = +3

Query: 72  FQYP--TPELQEELKKIAQAIVAPAKGILAADESTGTMGKRLQDIGVENTEENRRRYRQL 245
           +QYP  TPE ++EL  IA  IVAP KGILAADESTG++ KRLQ IG ENTEENRR YRQL
Sbjct: 3   YQYPALTPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQL 62

Query: 246 LFS 254
           L +
Sbjct: 63  LLT 65


>BC010660-1|AAH10660.1|  364|Homo sapiens aldolase A,
           fructose-bisphosphate protein.
          Length = 364

 Score =  123 bits (297), Expect = 7e-28
 Identities = 59/100 (59%), Positives = 68/100 (68%)
 Frame = +2

Query: 278 ISGVILFHETLYQKADDGTPLVSLLEKKGIIPGIKVDKGVVPLFGSEDECTTQGLDDLAQ 457
           I GVILFHETLYQKADDG P   +++ KG + GIKVDKGVVPL G+  E TTQGLD L++
Sbjct: 74  IGGVILFHETLYQKADDGRPFPQVIKSKGGVVGIKVDKGVVPLAGTNGETTTQGLDGLSE 133

Query: 458 RCAQYKKDGCHFAKWRCC*RSAATPPRTKLSRKTPMFLAR 577
           RCAQYKKDG  FAKWRC  +     P      +    LAR
Sbjct: 134 RCAQYKKDGADFAKWRCVLKIGEHTPSALAIMENANVLAR 173



 Score = 88.2 bits (209), Expect = 3e-17
 Identities = 44/63 (69%), Positives = 50/63 (79%), Gaps = 2/63 (3%)
 Frame = +3

Query: 72  FQYP--TPELQEELKKIAQAIVAPAKGILAADESTGTMGKRLQDIGVENTEENRRRYRQL 245
           +QYP  TPE ++EL  IA  IVAP KGILAADESTG++ KRLQ IG ENTEENRR YRQL
Sbjct: 3   YQYPALTPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQL 62

Query: 246 LFS 254
           L +
Sbjct: 63  LLT 65


>BC004333-1|AAH04333.1|  364|Homo sapiens aldolase A,
           fructose-bisphosphate protein.
          Length = 364

 Score =  123 bits (297), Expect = 7e-28
 Identities = 59/100 (59%), Positives = 68/100 (68%)
 Frame = +2

Query: 278 ISGVILFHETLYQKADDGTPLVSLLEKKGIIPGIKVDKGVVPLFGSEDECTTQGLDDLAQ 457
           I GVILFHETLYQKADDG P   +++ KG + GIKVDKGVVPL G+  E TTQGLD L++
Sbjct: 74  IGGVILFHETLYQKADDGRPFPQVIKSKGGVVGIKVDKGVVPLAGTNGETTTQGLDGLSE 133

Query: 458 RCAQYKKDGCHFAKWRCC*RSAATPPRTKLSRKTPMFLAR 577
           RCAQYKKDG  FAKWRC  +     P      +    LAR
Sbjct: 134 RCAQYKKDGADFAKWRCVLKIGEHTPSALAIMENANVLAR 173



 Score = 88.2 bits (209), Expect = 3e-17
 Identities = 44/63 (69%), Positives = 50/63 (79%), Gaps = 2/63 (3%)
 Frame = +3

Query: 72  FQYP--TPELQEELKKIAQAIVAPAKGILAADESTGTMGKRLQDIGVENTEENRRRYRQL 245
           +QYP  TPE ++EL  IA  IVAP KGILAADESTG++ KRLQ IG ENTEENRR YRQL
Sbjct: 3   YQYPALTPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQL 62

Query: 246 LFS 254
           L +
Sbjct: 63  LLT 65


>BC003613-1|AAH03613.3|  364|Homo sapiens aldolase C,
           fructose-bisphosphate protein.
          Length = 364

 Score =  123 bits (297), Expect = 7e-28
 Identities = 58/100 (58%), Positives = 69/100 (69%)
 Frame = +2

Query: 278 ISGVILFHETLYQKADDGTPLVSLLEKKGIIPGIKVDKGVVPLFGSEDECTTQGLDDLAQ 457
           I GVI FHETLYQK D+G P V  ++ KGI+ GIKVDKGVVPL G++ E TTQGLD L++
Sbjct: 74  IGGVIFFHETLYQKDDNGVPFVRTIQDKGIVVGIKVDKGVVPLAGTDGETTTQGLDGLSE 133

Query: 458 RCAQYKKDGCHFAKWRCC*RSAATPPRTKLSRKTPMFLAR 577
           RCAQYKKDG  FAKWRC  + +   P      +    LAR
Sbjct: 134 RCAQYKKDGADFAKWRCVLKISERTPSALAILENANVLAR 173



 Score = 81.4 bits (192), Expect = 4e-15
 Identities = 42/61 (68%), Positives = 47/61 (77%), Gaps = 2/61 (3%)
 Frame = +3

Query: 78  YP--TPELQEELKKIAQAIVAPAKGILAADESTGTMGKRLQDIGVENTEENRRRYRQLLF 251
           YP  + E ++EL  IA  IVAP KGILAADES G+M KRL  IGVENTEENRR YRQ+LF
Sbjct: 5   YPALSAEQKKELSDIALRIVAPGKGILAADESVGSMAKRLSQIGVENTEENRRLYRQVLF 64

Query: 252 S 254
           S
Sbjct: 65  S 65


>AF054987-1|AAC09348.1|  364|Homo sapiens aldolase C protein.
          Length = 364

 Score =  123 bits (297), Expect = 7e-28
 Identities = 58/100 (58%), Positives = 69/100 (69%)
 Frame = +2

Query: 278 ISGVILFHETLYQKADDGTPLVSLLEKKGIIPGIKVDKGVVPLFGSEDECTTQGLDDLAQ 457
           I GVI FHETLYQK D+G P V  ++ KGI+ GIKVDKGVVPL G++ E TTQGLD L++
Sbjct: 74  IGGVIFFHETLYQKDDNGVPFVRTIQDKGIVVGIKVDKGVVPLAGTDGETTTQGLDGLSE 133

Query: 458 RCAQYKKDGCHFAKWRCC*RSAATPPRTKLSRKTPMFLAR 577
           RCAQYKKDG  FAKWRC  + +   P      +    LAR
Sbjct: 134 RCAQYKKDGADFAKWRCVLKISERTPSALAILENANVLAR 173



 Score = 81.4 bits (192), Expect = 4e-15
 Identities = 42/61 (68%), Positives = 47/61 (77%), Gaps = 2/61 (3%)
 Frame = +3

Query: 78  YP--TPELQEELKKIAQAIVAPAKGILAADESTGTMGKRLQDIGVENTEENRRRYRQLLF 251
           YP  + E ++EL  IA  IVAP KGILAADES G+M KRL  IGVENTEENRR YRQ+LF
Sbjct: 5   YPALSAEQKKELSDIALRIVAPGKGILAADESVGSMAKRLSQIGVENTEENRRLYRQVLF 64

Query: 252 S 254
           S
Sbjct: 65  S 65


>X02747-1|CAA26526.1|  364|Homo sapiens protein ( Human mRNA for
           aldolase B. ).
          Length = 364

 Score =  109 bits (262), Expect = 1e-23
 Identities = 56/126 (44%), Positives = 79/126 (62%)
 Frame = +2

Query: 257 DAVLSENISGVILFHETLYQKADDGTPLVSLLEKKGIIPGIKVDKGVVPLFGSEDECTTQ 436
           D+ ++++I GVILFHETLYQK   G    ++L++KGI+ GIK+D+G  PL G+  E T Q
Sbjct: 67  DSSINQSIGGVILFHETLYQKDSQGKLFRNILKEKGIVVGIKLDQGGAPLAGTNKETTIQ 126

Query: 437 GLDDLAQRCAQYKKDGCHFAKWRCC*RSAATPPRTKLSRKTPMFLARLRFHLSEPTHSCR 616
           GLD L++RCAQYKKDG  F KWR   R A   P +   ++    LAR    + +      
Sbjct: 127 GLDGLSERCAQYKKDGVDFGKWRAVLRIADQCPSSLAIQENANALARYA-SICQQNGLVP 185

Query: 617 LLKPEV 634
           +++PEV
Sbjct: 186 IVEPEV 191



 Score = 83.4 bits (197), Expect = 9e-16
 Identities = 42/66 (63%), Positives = 52/66 (78%)
 Frame = +3

Query: 60  MSTYFQYPTPELQEELKKIAQAIVAPAKGILAADESTGTMGKRLQDIGVENTEENRRRYR 239
           M+  F   T E ++EL +IAQ+IVA  KGILAADES GTMG RLQ I VENTEENRR++R
Sbjct: 1   MAHRFPALTQEQKKELSEIAQSIVANGKGILAADESVGTMGNRLQRIKVENTEENRRQFR 60

Query: 240 QLLFSL 257
           ++LFS+
Sbjct: 61  EILFSV 66


>X01098-1|CAA25572.1|  364|Homo sapiens aldolase B protein.
          Length = 364

 Score =  109 bits (262), Expect = 1e-23
 Identities = 56/126 (44%), Positives = 79/126 (62%)
 Frame = +2

Query: 257 DAVLSENISGVILFHETLYQKADDGTPLVSLLEKKGIIPGIKVDKGVVPLFGSEDECTTQ 436
           D+ ++++I GVILFHETLYQK   G    ++L++KGI+ GIK+D+G  PL G+  E T Q
Sbjct: 67  DSSINQSIGGVILFHETLYQKDSQGKLFRNILKEKGIVVGIKLDQGGAPLAGTNKETTIQ 126

Query: 437 GLDDLAQRCAQYKKDGCHFAKWRCC*RSAATPPRTKLSRKTPMFLARLRFHLSEPTHSCR 616
           GLD L++RCAQYKKDG  F KWR   R A   P +   ++    LAR    + +      
Sbjct: 127 GLDGLSERCAQYKKDGVDFGKWRAVLRIADQCPSSLAIQENANALARYA-SICQQNGLVP 185

Query: 617 LLKPEV 634
           +++PEV
Sbjct: 186 IVEPEV 191



 Score = 83.4 bits (197), Expect = 9e-16
 Identities = 42/66 (63%), Positives = 52/66 (78%)
 Frame = +3

Query: 60  MSTYFQYPTPELQEELKKIAQAIVAPAKGILAADESTGTMGKRLQDIGVENTEENRRRYR 239
           M+  F   T E ++EL +IAQ+IVA  KGILAADES GTMG RLQ I VENTEENRR++R
Sbjct: 1   MAHRFPALTQEQKKELSEIAQSIVANGKGILAADESVGTMGNRLQRIKVENTEENRRQFR 60

Query: 240 QLLFSL 257
           ++LFS+
Sbjct: 61  EILFSV 66


>M15656-1|AAA51691.1|  364|Homo sapiens protein ( Human aldolase B
           (ALDOB) gene, exons 7 through 9. ).
          Length = 364

 Score =  109 bits (262), Expect = 1e-23
 Identities = 56/126 (44%), Positives = 79/126 (62%)
 Frame = +2

Query: 257 DAVLSENISGVILFHETLYQKADDGTPLVSLLEKKGIIPGIKVDKGVVPLFGSEDECTTQ 436
           D+ ++++I GVILFHETLYQK   G    ++L++KGI+ GIK+D+G  PL G+  E T Q
Sbjct: 67  DSSINQSIGGVILFHETLYQKDSQGKLFRNILKEKGIVVGIKLDQGGAPLAGTNKETTIQ 126

Query: 437 GLDDLAQRCAQYKKDGCHFAKWRCC*RSAATPPRTKLSRKTPMFLARLRFHLSEPTHSCR 616
           GLD L++RCAQYKKDG  F KWR   R A   P +   ++    LAR    + +      
Sbjct: 127 GLDGLSERCAQYKKDGVDFGKWRAVLRIADQCPSSLAIQENANALARYA-SICQQNGLVP 185

Query: 617 LLKPEV 634
           +++PEV
Sbjct: 186 IVEPEV 191



 Score = 82.2 bits (194), Expect = 2e-15
 Identities = 41/66 (62%), Positives = 52/66 (78%)
 Frame = +3

Query: 60  MSTYFQYPTPELQEELKKIAQAIVAPAKGILAADESTGTMGKRLQDIGVENTEENRRRYR 239
           M+  F   T E ++EL +IAQ+IVA  KGILAADES GTMG RLQ I VENTE+NRR++R
Sbjct: 1   MAHRFPALTQEQKKELSEIAQSIVANGKGILAADESVGTMGNRLQRIKVENTEDNRRQFR 60

Query: 240 QLLFSL 257
           ++LFS+
Sbjct: 61  EILFSV 66


>AL353621-5|CAI14614.1|  364|Homo sapiens aldolase B,
           fructose-bisphosphate protein.
          Length = 364

 Score =  109 bits (262), Expect = 1e-23
 Identities = 56/126 (44%), Positives = 79/126 (62%)
 Frame = +2

Query: 257 DAVLSENISGVILFHETLYQKADDGTPLVSLLEKKGIIPGIKVDKGVVPLFGSEDECTTQ 436
           D+ ++++I GVILFHETLYQK   G    ++L++KGI+ GIK+D+G  PL G+  E T Q
Sbjct: 67  DSSINQSIGGVILFHETLYQKDSQGKLFRNILKEKGIVVGIKLDQGGAPLAGTNKETTIQ 126

Query: 437 GLDDLAQRCAQYKKDGCHFAKWRCC*RSAATPPRTKLSRKTPMFLARLRFHLSEPTHSCR 616
           GLD L++RCAQYKKDG  F KWR   R A   P +   ++    LAR    + +      
Sbjct: 127 GLDGLSERCAQYKKDGVDFGKWRAVLRIADQCPSSLAIQENANALARYA-SICQQNGLVP 185

Query: 617 LLKPEV 634
           +++PEV
Sbjct: 186 IVEPEV 191



 Score = 83.4 bits (197), Expect = 9e-16
 Identities = 42/66 (63%), Positives = 52/66 (78%)
 Frame = +3

Query: 60  MSTYFQYPTPELQEELKKIAQAIVAPAKGILAADESTGTMGKRLQDIGVENTEENRRRYR 239
           M+  F   T E ++EL +IAQ+IVA  KGILAADES GTMG RLQ I VENTEENRR++R
Sbjct: 1   MAHRFPALTQEQKKELSEIAQSIVANGKGILAADESVGTMGNRLQRIKVENTEENRRQFR 60

Query: 240 QLLFSL 257
           ++LFS+
Sbjct: 61  EILFSV 66


>BC029399-1|AAH29399.1|  316|Homo sapiens ALDOB protein protein.
          Length = 316

 Score =  108 bits (260), Expect = 2e-23
 Identities = 56/126 (44%), Positives = 79/126 (62%)
 Frame = +2

Query: 257 DAVLSENISGVILFHETLYQKADDGTPLVSLLEKKGIIPGIKVDKGVVPLFGSEDECTTQ 436
           D+ ++++I GVILFHETLYQK   G    ++L++KGI+ GIK+D+G  PL G+  E T Q
Sbjct: 67  DSSINQSIGGVILFHETLYQKDSQGKLFRNILKEKGIVVGIKLDQGGAPLAGTNKETTIQ 126

Query: 437 GLDDLAQRCAQYKKDGCHFAKWRCC*RSAATPPRTKLSRKTPMFLARLRFHLSEPTHSCR 616
           GLD L++RCAQYKKDG  F KWR   R A   P +   ++    LAR    + +      
Sbjct: 127 GLDGLSERCAQYKKDGVDFGKWRAVLRIADQCPSSLPIQENANALARYA-SICQQNGLVP 185

Query: 617 LLKPEV 634
           +++PEV
Sbjct: 186 IVEPEV 191



 Score = 83.4 bits (197), Expect = 9e-16
 Identities = 42/66 (63%), Positives = 52/66 (78%)
 Frame = +3

Query: 60  MSTYFQYPTPELQEELKKIAQAIVAPAKGILAADESTGTMGKRLQDIGVENTEENRRRYR 239
           M+  F   T E ++EL +IAQ+IVA  KGILAADES GTMG RLQ I VENTEENRR++R
Sbjct: 1   MAHRFPALTQEQKKELSEIAQSIVANGKGILAADESVGTMGNRLQRIKVENTEENRRQFR 60

Query: 240 QLLFSL 257
           ++LFS+
Sbjct: 61  EILFSV 66


>D00183-1|BAA00125.1|  364|Homo sapiens aldolase B protein.
          Length = 364

 Score =  108 bits (259), Expect = 3e-23
 Identities = 56/126 (44%), Positives = 79/126 (62%)
 Frame = +2

Query: 257 DAVLSENISGVILFHETLYQKADDGTPLVSLLEKKGIIPGIKVDKGVVPLFGSEDECTTQ 436
           D+ ++++I GVILFHETLYQK   G    ++L++KGI+ GIK+D+G  PL G+  E T Q
Sbjct: 67  DSSINQSIGGVILFHETLYQKDSQGKLFRNILKEKGIVVGIKLDQGGAPLAGTNKETTIQ 126

Query: 437 GLDDLAQRCAQYKKDGCHFAKWRCC*RSAATPPRTKLSRKTPMFLARLRFHLSEPTHSCR 616
           GLD L++RCAQYKKDG  F KWR   R A   P +   ++    LAR    + +      
Sbjct: 127 GLDGLSERCAQYKKDGVDFGKWRPVLRIADQCPSSLAIQENANALARYA-SICQQNGLVP 185

Query: 617 LLKPEV 634
           +++PEV
Sbjct: 186 IVEPEV 191



 Score = 83.4 bits (197), Expect = 9e-16
 Identities = 42/66 (63%), Positives = 52/66 (78%)
 Frame = +3

Query: 60  MSTYFQYPTPELQEELKKIAQAIVAPAKGILAADESTGTMGKRLQDIGVENTEENRRRYR 239
           M+  F   T E ++EL +IAQ+IVA  KGILAADES GTMG RLQ I VENTEENRR++R
Sbjct: 1   MAHRFPALTQEQKKELSEIAQSIVANGKGILAADESVGTMGNRLQRIKVENTEENRRQFR 60

Query: 240 QLLFSL 257
           ++LFS+
Sbjct: 61  EILFSV 66


>X06352-1|CAA29654.1|  108|Homo sapiens aldolase A protein protein.
          Length = 108

 Score = 88.2 bits (209), Expect = 3e-17
 Identities = 44/63 (69%), Positives = 50/63 (79%), Gaps = 2/63 (3%)
 Frame = +3

Query: 72  FQYP--TPELQEELKKIAQAIVAPAKGILAADESTGTMGKRLQDIGVENTEENRRRYRQL 245
           +QYP  TPE ++EL  IA  IVAP KGILAADESTG++ KRLQ IG ENTEENRR YRQL
Sbjct: 3   YQYPALTPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQL 62

Query: 246 LFS 254
           L +
Sbjct: 63  LLT 65



 Score = 52.4 bits (120), Expect = 2e-06
 Identities = 23/35 (65%), Positives = 27/35 (77%)
 Frame = +2

Query: 278 ISGVILFHETLYQKADDGTPLVSLLEKKGIIPGIK 382
           I GVILFHETLYQKADDG P   +++ KG + GIK
Sbjct: 74  IGGVILFHETLYQKADDGRPFPQVIKSKGGVVGIK 108


>BC016170-1|AAH16170.1|  260|Homo sapiens Similar to aldolase A,
           fructose-bisphosphate protein.
          Length = 260

 Score = 81.4 bits (192), Expect = 4e-15
 Identities = 39/68 (57%), Positives = 44/68 (64%)
 Frame = +2

Query: 374 GIKVDKGVVPLFGSEDECTTQGLDDLAQRCAQYKKDGCHFAKWRCC*RSAATPPRTKLSR 553
           GIKVDKGVVPL G+  E TTQGLD L++RCAQYKKDG  FAKWRC  +     P      
Sbjct: 2   GIKVDKGVVPLAGTNGETTTQGLDGLSERCAQYKKDGADFAKWRCVLKIGEHTPSALAIM 61

Query: 554 KTPMFLAR 577
           +    LAR
Sbjct: 62  ENANVLAR 69


>BC000367-1|AAH00367.2|  260|Homo sapiens ALDOA protein protein.
          Length = 260

 Score = 81.4 bits (192), Expect = 4e-15
 Identities = 39/68 (57%), Positives = 44/68 (64%)
 Frame = +2

Query: 374 GIKVDKGVVPLFGSEDECTTQGLDDLAQRCAQYKKDGCHFAKWRCC*RSAATPPRTKLSR 553
           GIKVDKGVVPL G+  E TTQGLD L++RCAQYKKDG  FAKWRC  +     P      
Sbjct: 2   GIKVDKGVVPLAGTNGETTTQGLDGLSERCAQYKKDGADFAKWRCVLKIGEHTPSALAIM 61

Query: 554 KTPMFLAR 577
           +    LAR
Sbjct: 62  ENANVLAR 69


>AL353621-6|CAI14615.1|  223|Homo sapiens aldolase B,
           fructose-bisphosphate protein.
          Length = 223

 Score = 81.0 bits (191), Expect = 5e-15
 Identities = 46/111 (41%), Positives = 64/111 (57%), Gaps = 1/111 (0%)
 Frame = +2

Query: 305 TLYQKADD-GTPLVSLLEKKGIIPGIKVDKGVVPLFGSEDECTTQGLDDLAQRCAQYKKD 481
           T  QK D  G    ++L++KGI+ GIK+D+G  PL G+  E T QGLD L++RCAQYKKD
Sbjct: 9   TQEQKKDSQGKLFRNILKEKGIVVGIKLDQGGAPLAGTNKETTIQGLDGLSERCAQYKKD 68

Query: 482 GCHFAKWRCC*RSAATPPRTKLSRKTPMFLARLRFHLSEPTHSCRLLKPEV 634
           G  F KWR   R A   P +   ++    LAR    + +      +++PEV
Sbjct: 69  GVDFGKWRAVLRIADQCPSSLAIQENANALARYA-SICQQNGLVPIVEPEV 118


>EF036496-1|ABO65082.1|  141|Homo sapiens aldolase A protein.
          Length = 141

 Score = 57.6 bits (133), Expect = 5e-08
 Identities = 27/52 (51%), Positives = 31/52 (59%)
 Frame = +2

Query: 422 ECTTQGLDDLAQRCAQYKKDGCHFAKWRCC*RSAATPPRTKLSRKTPMFLAR 577
           E TTQGLD L++RCAQYKKDG  FAKWRC  +     P      +    LAR
Sbjct: 4   ETTTQGLDGLSERCAQYKKDGADFAKWRCVLKIGEHTPSALAIMENANVLAR 55


>M21190-1|AAA51697.1|  226|Homo sapiens ALDOA protein.
          Length = 226

 Score = 35.1 bits (77), Expect = 0.31
 Identities = 22/44 (50%), Positives = 28/44 (63%), Gaps = 1/44 (2%)
 Frame = +1

Query: 508 LLKIGRNTPSYQAIQENANV-SRPLTLPSVRANAFVPIVEARSL 636
           +LKIG +TPS  AI ENANV +R  ++   + N  VPIVE   L
Sbjct: 13  VLKIGEHTPSALAIMENANVLARYASI--CQQNGIVPIVEPEIL 54


>EF036497-1|ABO65083.1|  122|Homo sapiens aldolase A protein.
          Length = 122

 Score = 35.1 bits (77), Expect = 0.31
 Identities = 22/44 (50%), Positives = 28/44 (63%), Gaps = 1/44 (2%)
 Frame = +1

Query: 508 LLKIGRNTPSYQAIQENANV-SRPLTLPSVRANAFVPIVEARSL 636
           +LKIG +TPS  AI ENANV +R  ++   + N  VPIVE   L
Sbjct: 10  VLKIGEHTPSALAIMENANVLARYASI--CQQNGIVPIVEPEIL 51


>AF361356-1|AAL50051.1|  192|Homo sapiens voltage-dependent calcium
           channel gamma subunit-like protein protein.
          Length = 192

 Score = 32.3 bits (70), Expect = 2.2
 Identities = 18/55 (32%), Positives = 29/55 (52%)
 Frame = -1

Query: 299 GTGSHQRCSRRAQRQAE*ELAITTTVLLCVLHADVLQTLSHCTGGFVSGEDTLCG 135
           G  + +   +R  R++  E  I T ++ CV  A VL ++S C G ++  ED L G
Sbjct: 5   GVHAQRPLGQRQPRRSFFESFIRTLIITCVALAVVLSSVSICDGHWLLAEDRLFG 59


>BC035596-1|AAH35596.1|  681|Homo sapiens PAK6 protein protein.
          Length = 681

 Score = 31.5 bits (68), Expect = 3.8
 Identities = 25/59 (42%), Positives = 31/59 (52%), Gaps = 3/59 (5%)
 Frame = +3

Query: 624 SPKSLPDGRST--NLGTAPQKG*LKGRSGPAGFKKAP*TDH-QVFTSEGEIP*SPKLVK 791
           SP +  D  S   +L TAP  G L GRS PAG   +P T H Q+ TS   +P  P + K
Sbjct: 319 SPLTTSDTSSPQKSLRTAPATGQLPGRSSPAG---SPRTWHAQISTSNLYLPQDPTVAK 374


>AJ236915-1|CAC18720.1|  681|Homo sapiens pak5 protein protein.
          Length = 681

 Score = 31.5 bits (68), Expect = 3.8
 Identities = 25/59 (42%), Positives = 31/59 (52%), Gaps = 3/59 (5%)
 Frame = +3

Query: 624 SPKSLPDGRST--NLGTAPQKG*LKGRSGPAGFKKAP*TDH-QVFTSEGEIP*SPKLVK 791
           SP +  D  S   +L TAP  G L GRS PAG   +P T H Q+ TS   +P  P + K
Sbjct: 319 SPLTTSDTSSPQKSLRTAPATGQLPGRSSPAG---SPRTWHAQISTSNLYLPQDPTVAK 374


>AF276893-1|AAF82800.1|  681|Homo sapiens p21-activated protein
           kinase 6 protein.
          Length = 681

 Score = 31.5 bits (68), Expect = 3.8
 Identities = 25/59 (42%), Positives = 31/59 (52%), Gaps = 3/59 (5%)
 Frame = +3

Query: 624 SPKSLPDGRST--NLGTAPQKG*LKGRSGPAGFKKAP*TDH-QVFTSEGEIP*SPKLVK 791
           SP +  D  S   +L TAP  G L GRS PAG   +P T H Q+ TS   +P  P + K
Sbjct: 319 SPLTTSDTSSPQKSLRTAPATGQLPGRSSPAG---SPRTWHAQISTSNLYLPQDPTVAK 374


>AK024452-1|BAB15742.1| 1051|Homo sapiens FLJ00044 protein protein.
          Length = 1051

 Score = 31.1 bits (67), Expect = 5.1
 Identities = 19/44 (43%), Positives = 22/44 (50%), Gaps = 1/44 (2%)
 Frame = +1

Query: 340 GLPAGEEGHHPRHQGRQGCR-PAVRIGRRMHHPGSGRPRPALRP 468
           G P+ E+G     +G QG R PA R G R   P    PRP  RP
Sbjct: 21  GRPSAEDGR----EGGQGAREPAKRSGHRTEPPKEAPPRPWPRP 60


>AF063612-1|AAD28542.1|  254|Homo sapiens 2'-5'oligoadenylate
           synthetase-related protein p30 protein.
          Length = 254

 Score = 30.7 bits (66), Expect = 6.7
 Identities = 18/38 (47%), Positives = 22/38 (57%), Gaps = 6/38 (15%)
 Frame = +1

Query: 418 RRMHHPGSGRPRPAL-RPVQEGR-----LPLRQVALLL 513
           ++ HHPGSGRP P   R VQ G      LP+ +  LLL
Sbjct: 217 QQAHHPGSGRPHPQRGRRVQMGHRCSEGLPVPETGLLL 254


>AB002307-1|BAA20768.2| 3053|Homo sapiens KIAA0309 protein.
          Length = 3053

 Score = 30.7 bits (66), Expect = 6.7
 Identities = 32/109 (29%), Positives = 45/109 (41%), Gaps = 1/109 (0%)
 Frame = +1

Query: 433  PGSGRPRPALRP-VQEGRLPLRQVALLLKIGRNTPSYQAIQENANVSRPLTLPSVRANAF 609
            P S  P P L P +Q     L Q   ++ IG+     Q    NA  S+PLT         
Sbjct: 1043 PASRPPGPVLLPPLQPNSGSLPQAGEVVSIGQLASLAQRPVANAGGSKPLTFQIQGNKLT 1102

Query: 610  VPIVEARSLYLMGEARTLEPRPRKVNLKVVLGRPVLKRPLKRTTKFLPP 756
            +   + R L  +G+ R L+  P  VN   V+   V + P    T  +PP
Sbjct: 1103 LTGAQVRQL-AVGQPRPLQMPPTMVNNTGVVKIVVRQAPRDGLTP-VPP 1149


>BC107427-1|AAI07428.1|  389|Homo sapiens NARG2 protein protein.
          Length = 389

 Score = 30.3 bits (65), Expect = 8.8
 Identities = 14/31 (45%), Positives = 20/31 (64%)
 Frame = +1

Query: 712 VLKRPLKRTTKFLPPRGKFLKAQNWLNGPVN 804
           VLK+P+KR  K   P G+ LK Q+ L  P++
Sbjct: 37  VLKKPIKRVYKKFDPVGEILKMQDELLKPIS 67


>BC071685-1|AAH71685.1|  361|Homo sapiens NARG2 protein protein.
          Length = 361

 Score = 30.3 bits (65), Expect = 8.8
 Identities = 14/31 (45%), Positives = 20/31 (64%)
 Frame = +1

Query: 712 VLKRPLKRTTKFLPPRGKFLKAQNWLNGPVN 804
           VLK+P+KR  K   P G+ LK Q+ L  P++
Sbjct: 9   VLKKPIKRVYKKFDPVGEILKMQDELLKPIS 39


>AF502591-1|AAQ07460.1|  982|Homo sapiens BRCC1 protein.
          Length = 982

 Score = 30.3 bits (65), Expect = 8.8
 Identities = 14/31 (45%), Positives = 20/31 (64%)
 Frame = +1

Query: 712 VLKRPLKRTTKFLPPRGKFLKAQNWLNGPVN 804
           VLK+P+KR  K   P G+ LK Q+ L  P++
Sbjct: 630 VLKKPIKRVYKKFDPVGEILKMQDELLKPIS 660


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 137,567,231
Number of Sequences: 237096
Number of extensions: 3588872
Number of successful extensions: 10396
Number of sequences better than 10.0: 45
Number of HSP's better than 10.0 without gapping: 9539
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 10344
length of database: 76,859,062
effective HSP length: 89
effective length of database: 55,757,518
effective search space used: 10315140830
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).