SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30055
         (803 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CR457233-1|CAG33514.1|  238|Homo sapiens UBE2R2 protein.               79   1e-14
BC047584-1|AAH47584.1|  238|Homo sapiens ubiquitin-conjugating e...    79   1e-14
BC004862-1|AAH04862.1|  238|Homo sapiens ubiquitin-conjugating e...    79   1e-14
AL139113-4|CAI39656.1|  238|Homo sapiens ubiquitin-conjugating e...    79   1e-14
AJ240087-1|CAC80336.1|  238|Homo sapiens ubiquitin-coniugating e...    79   1e-14
AK000426-1|BAA91156.1|  238|Homo sapiens protein ( Homo sapiens ...    78   4e-14
L22005-1|AAC37534.1|  298|Homo sapiens ubiquitin conjugating enz...    75   2e-13
BT006659-1|AAP35305.1|  236|Homo sapiens cell division cycle 34 ...    75   2e-13
BC023979-1|AAH23979.1|  236|Homo sapiens cell division cycle 34 ...    75   2e-13
BC018143-1|AAH18143.1|  236|Homo sapiens cell division cycle 34 ...    75   2e-13
BC009850-1|AAH09850.1|  236|Homo sapiens cell division cycle 34 ...    75   2e-13
AY650399-1|AAT46688.1|  236|Homo sapiens cell division cycle 34 ...    75   2e-13
D78514-1|BAA11410.1|  170|Homo sapiens ubiquitin-conjugating enz...    54   5e-07
BT007416-1|AAP36084.1|  170|Homo sapiens ubiquitin-conjugating e...    54   5e-07
BC026288-1|AAH26288.2|  225|Homo sapiens UBE2G1 protein protein.       54   5e-07
BC002775-1|AAH02775.1|  170|Homo sapiens ubiquitin-conjugating e...    54   5e-07
BT006914-1|AAP35560.1|  165|Homo sapiens ubiquitin-conjugating e...    48   4e-05
BC011569-1|AAH11569.1|  165|Homo sapiens ubiquitin-conjugating e...    48   4e-05
BC008351-1|AAH08351.1|  165|Homo sapiens ubiquitin-conjugating e...    48   4e-05
BC001738-1|AAH01738.1|  165|Homo sapiens ubiquitin-conjugating e...    48   4e-05
AL163300-1|CAB90551.1|  165|Homo sapiens human ubiquitin conjuga...    48   4e-05
AF032456-1|AAC32312.1|  165|Homo sapiens ubiquitin conjugating e...    45   3e-04
X78140-1|CAA55019.1|  147|Homo sapiens ubiquitin conjugating enz...    41   0.006
BT007041-1|AAP35690.1|  147|Homo sapiens ubiquitin-conjugating e...    41   0.006
BC015997-1|AAH15997.1|  147|Homo sapiens ubiquitin-conjugating e...    41   0.006
BC005980-1|AAH05980.1|  147|Homo sapiens ubiquitin-conjugating e...    41   0.006
AJ293565-1|CAC82097.1|  147|Homo sapiens ubiquitin-conjugating e...    41   0.006
AJ272367-1|CAC82177.1|  147|Homo sapiens ubiquitin-conjugating e...    41   0.006
AF257220-1|AAM81086.1|  147|Homo sapiens ubiquitin-conjugating e...    41   0.006
U93243-1|AAF21505.1|  318|Homo sapiens Ubc6p homolog protein.          40   0.014
X53251-1|CAA37339.1|  152|Homo sapiens E2 protein protein.             36   0.17 
M74525-1|AAA35982.1|  152|Homo sapiens protein ( Human HHR6B (ye...    36   0.17 
DQ090910-1|AAY68224.1|  152|Homo sapiens ubiquitin-conjugating e...    36   0.17 
CR407634-1|CAG28562.1|  152|Homo sapiens UBE2B protein.                36   0.17 
BT007071-1|AAP35734.1|  152|Homo sapiens ubiquitin-conjugating e...    36   0.17 
BC008470-1|AAH08470.1|  152|Homo sapiens ubiquitin-conjugating e...    36   0.17 
BC008404-1|AAH08404.1|  152|Homo sapiens ubiquitin-conjugating e...    36   0.17 
BC005979-1|AAH05979.1|  152|Homo sapiens ubiquitin-conjugating e...    36   0.17 
DQ068065-1|AAY46159.1|  152|Homo sapiens ubiquitin-conjugating e...    36   0.23 
BC013973-1|AAH13973.1|  318|Homo sapiens ubiquitin-conjugating e...    36   0.23 
BC010175-1|AAH10175.1|  152|Homo sapiens ubiquitin-conjugating e...    36   0.23 
BC004104-1|AAH04104.1|  147|Homo sapiens ubiquitin-conjugating e...    36   0.23 
AL139804-1|CAI19635.1|  318|Homo sapiens NCUBE1 protein.               36   0.23 
AL138717-1|CAH70228.1|  318|Homo sapiens NCUBE1 protein.               36   0.23 
AK223464-1|BAD97184.1|  318|Homo sapiens ubiquitin-conjugating e...    36   0.23 
AK223064-1|BAD96784.1|  152|Homo sapiens ubiquitin-conjugating e...    36   0.23 
AK223045-1|BAD96765.1|  152|Homo sapiens ubiquitin-conjugating e...    36   0.23 
AK001446-1|BAA91697.1|  147|Homo sapiens protein ( Homo sapiens ...    36   0.23 
AJ245898-1|CAB83212.1|  318|Homo sapiens Non-Canonical UBiquitin...    36   0.23 
AF151834-1|AAD34071.1|  325|Homo sapiens CGI-76 protein protein.       36   0.23 
AF125044-1|AAD31180.1|  147|Homo sapiens ubiquitin-conjugating e...    36   0.23 
BT019345-1|AAV38152.1|  207|Homo sapiens ubiquitin-conjugating e...    35   0.40 
BC092407-1|AAH92407.1|  207|Homo sapiens ubiquitin-conjugating e...    35   0.40 
BC003554-1|AAH03554.1|  207|Homo sapiens ubiquitin-conjugating e...    35   0.40 
AC104076-1|AAY14882.1|  207|Homo sapiens unknown protein.              35   0.40 
AB017644-1|BAA76544.1|  207|Homo sapiens ubiquitin-conjugating e...    35   0.40 
M74524-1|AAA35981.1|  152|Homo sapiens protein ( Human HHR6A (ye...    34   0.69 
AB058743-1|BAB47469.2| 2443|Homo sapiens KIAA1840 protein protein.     34   0.69 
U39318-1|AAA91461.1|  147|Homo sapiens UbcH5C protein.                 31   4.9  
U39317-1|AAA91460.1|  147|Homo sapiens UbcH5B protein.                 31   4.9  
L40146-1|AAC41750.1|  147|Homo sapiens ubiquitin conjugating enz...    31   4.9  
CR456916-1|CAG33197.1|  147|Homo sapiens UBE2D3 protein.               31   4.9  
BC066917-1|AAH66917.1|  147|Homo sapiens ubiquitin-conjugating e...    31   4.9  
BC037894-1|AAH37894.1|  147|Homo sapiens ubiquitin-conjugating e...    31   4.9  
BC033349-1|AAH33349.1|  147|Homo sapiens ubiquitin-conjugating e...    31   4.9  
BC003395-1|AAH03395.1|  147|Homo sapiens ubiquitin-conjugating e...    31   4.9  
AY651263-1|AAX35690.1|  147|Homo sapiens ubiquitin-conjugating e...    31   4.9  
AK095822-1|BAC04632.1|  148|Homo sapiens protein ( Homo sapiens ...    31   4.9  
AF213884-3|AAF35234.1|  147|Homo sapiens ubiquitin-conjugating e...    31   4.9  
AL391240-1|CAM28242.1| 2106|Homo sapiens novel protein protein.        31   6.4  
AL031433-2|CAI19661.2| 2106|Homo sapiens novel protein protein.        31   6.4  
AL031003-5|CAM28244.1| 2106|Homo sapiens novel protein protein.        31   6.4  
AF413080-1|AAL04174.1| 1770|Homo sapiens BIG3 protein.                 31   6.4  
AB033070-1|BAA86558.2| 1872|Homo sapiens KIAA1244 protein protein.     31   6.4  
X92963-1|CAA63539.1|  193|Homo sapiens ubiquitin-conjugating enz...    30   8.5  
BC022332-1|AAH22332.1|  201|Homo sapiens ubiquitin-conjugating e...    30   8.5  
BC009139-1|AAH09139.1|  193|Homo sapiens ubiquitin-conjugating e...    30   8.5  
AK057886-1|BAB71605.1|  201|Homo sapiens protein ( Homo sapiens ...    30   8.5  

>CR457233-1|CAG33514.1|  238|Homo sapiens UBE2R2 protein.
          Length = 238

 Score = 79.4 bits (187), Expect = 1e-14
 Identities = 46/112 (41%), Positives = 59/112 (52%), Gaps = 1/112 (0%)
 Frame = +2

Query: 365 SSALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQVDTSRHT*NSPL 544
           +S+ +AL LE KSLQEEPVEGFR+ L+ E +L+ WEVAIFGPP+TLY+    +     P+
Sbjct: 7   TSSQKALMLELKSLQEEPVEGFRITLVDESDLYNWEVAIFGPPNTLYEGGYFKAHIKFPI 66

Query: 545 TTRIHHHPLGFLTKVWASKCI*KRR-SLHIDSPPARGMILSLANCPCERWEP 697
                     FLTK+W           + I  PP           P ERW P
Sbjct: 67  DYPYSPPTFRFLTKMWHPNIYENGDVCISILHPPVDDP--QSGELPSERWNP 116


>BC047584-1|AAH47584.1|  238|Homo sapiens ubiquitin-conjugating
           enzyme E2R 2 protein.
          Length = 238

 Score = 79.4 bits (187), Expect = 1e-14
 Identities = 46/112 (41%), Positives = 59/112 (52%), Gaps = 1/112 (0%)
 Frame = +2

Query: 365 SSALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQVDTSRHT*NSPL 544
           +S+ +AL LE KSLQEEPVEGFR+ L+ E +L+ WEVAIFGPP+TLY+    +     P+
Sbjct: 7   TSSQKALMLELKSLQEEPVEGFRITLVDESDLYNWEVAIFGPPNTLYEGGYFKAHIKFPI 66

Query: 545 TTRIHHHPLGFLTKVWASKCI*KRR-SLHIDSPPARGMILSLANCPCERWEP 697
                     FLTK+W           + I  PP           P ERW P
Sbjct: 67  DYPYSPPTFRFLTKMWHPNIYENGDVCISILHPPVDDP--QSGELPSERWNP 116


>BC004862-1|AAH04862.1|  238|Homo sapiens ubiquitin-conjugating
           enzyme E2R 2 protein.
          Length = 238

 Score = 79.4 bits (187), Expect = 1e-14
 Identities = 46/112 (41%), Positives = 59/112 (52%), Gaps = 1/112 (0%)
 Frame = +2

Query: 365 SSALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQVDTSRHT*NSPL 544
           +S+ +AL LE KSLQEEPVEGFR+ L+ E +L+ WEVAIFGPP+TLY+    +     P+
Sbjct: 7   TSSQKALMLELKSLQEEPVEGFRITLVDESDLYNWEVAIFGPPNTLYEGGYFKAHIKFPI 66

Query: 545 TTRIHHHPLGFLTKVWASKCI*KRR-SLHIDSPPARGMILSLANCPCERWEP 697
                     FLTK+W           + I  PP           P ERW P
Sbjct: 67  DYPYSPPTFRFLTKMWHPNIYENGDVCISILHPPVDDP--QSGELPSERWNP 116


>AL139113-4|CAI39656.1|  238|Homo sapiens ubiquitin-conjugating
           enzyme E2R 2 protein.
          Length = 238

 Score = 79.4 bits (187), Expect = 1e-14
 Identities = 46/112 (41%), Positives = 59/112 (52%), Gaps = 1/112 (0%)
 Frame = +2

Query: 365 SSALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQVDTSRHT*NSPL 544
           +S+ +AL LE KSLQEEPVEGFR+ L+ E +L+ WEVAIFGPP+TLY+    +     P+
Sbjct: 7   TSSQKALMLELKSLQEEPVEGFRITLVDESDLYNWEVAIFGPPNTLYEGGYFKAHIKFPI 66

Query: 545 TTRIHHHPLGFLTKVWASKCI*KRR-SLHIDSPPARGMILSLANCPCERWEP 697
                     FLTK+W           + I  PP           P ERW P
Sbjct: 67  DYPYSPPTFRFLTKMWHPNIYENGDVCISILHPPVDDP--QSGELPSERWNP 116


>AJ240087-1|CAC80336.1|  238|Homo sapiens ubiquitin-coniugating
           enzyme protein.
          Length = 238

 Score = 79.4 bits (187), Expect = 1e-14
 Identities = 46/112 (41%), Positives = 59/112 (52%), Gaps = 1/112 (0%)
 Frame = +2

Query: 365 SSALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQVDTSRHT*NSPL 544
           +S+ +AL LE KSLQEEPVEGFR+ L+ E +L+ WEVAIFGPP+TLY+    +     P+
Sbjct: 7   TSSQKALMLELKSLQEEPVEGFRITLVDESDLYNWEVAIFGPPNTLYEGGYFKAHIKFPI 66

Query: 545 TTRIHHHPLGFLTKVWASKCI*KRR-SLHIDSPPARGMILSLANCPCERWEP 697
                     FLTK+W           + I  PP           P ERW P
Sbjct: 67  DYPYSPPTFRFLTKMWHPNIYENGDVCISILHPPVDDP--QSGELPSERWNP 116


>AK000426-1|BAA91156.1|  238|Homo sapiens protein ( Homo sapiens
           cDNA FLJ20419 fis, clone KAT02435. ).
          Length = 238

 Score = 77.8 bits (183), Expect = 4e-14
 Identities = 46/112 (41%), Positives = 58/112 (51%), Gaps = 1/112 (0%)
 Frame = +2

Query: 365 SSALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQVDTSRHT*NSPL 544
           +S+ +AL LE KSLQEEPVEGFR+ L+ E +L  WEVAIFGPP+TLY+    +     P+
Sbjct: 7   TSSQKALMLELKSLQEEPVEGFRITLVDESDLHNWEVAIFGPPNTLYEGGYFKAHIKFPI 66

Query: 545 TTRIHHHPLGFLTKVWASKCI*KRR-SLHIDSPPARGMILSLANCPCERWEP 697
                     FLTK+W           + I  PP           P ERW P
Sbjct: 67  DYPYSPPTFRFLTKMWHPNIYENGDVCISILHPPVDDP--QSGELPSERWNP 116


>L22005-1|AAC37534.1|  298|Homo sapiens ubiquitin conjugating enzyme
           protein.
          Length = 298

 Score = 75.4 bits (177), Expect = 2e-13
 Identities = 45/111 (40%), Positives = 56/111 (50%), Gaps = 1/111 (0%)
 Frame = +2

Query: 368 SALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQVDTSRHT*NSPLT 547
           S+ +AL LE K LQEEPVEGFRV L+ E +L+ WEVAIFGPP+T Y+    +     P+ 
Sbjct: 70  SSQKALLLELKGLQEEPVEGFRVTLVDEGDLYNWEVAIFGPPNTYYEGGYFKARLKFPID 129

Query: 548 TRIHHHPLGFLTKVWASKCI*KRR-SLHIDSPPARGMILSLANCPCERWEP 697
                    FLTK+W           + I  PP           P ERW P
Sbjct: 130 YPYSPPAFRFLTKMWHPNIYETGDVCISILHPPVDDP--QSGELPSERWNP 178


>BT006659-1|AAP35305.1|  236|Homo sapiens cell division cycle 34
           protein.
          Length = 236

 Score = 75.4 bits (177), Expect = 2e-13
 Identities = 45/111 (40%), Positives = 56/111 (50%), Gaps = 1/111 (0%)
 Frame = +2

Query: 368 SALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQVDTSRHT*NSPLT 547
           S+ +AL LE K LQEEPVEGFRV L+ E +L+ WEVAIFGPP+T Y+    +     P+ 
Sbjct: 8   SSQKALLLELKGLQEEPVEGFRVTLVDEGDLYNWEVAIFGPPNTYYEGGYFKARLKFPID 67

Query: 548 TRIHHHPLGFLTKVWASKCI*KRR-SLHIDSPPARGMILSLANCPCERWEP 697
                    FLTK+W           + I  PP           P ERW P
Sbjct: 68  YPYSPPAFRFLTKMWHPNIYETGDVCISILHPPVDDP--QSGELPSERWNP 116


>BC023979-1|AAH23979.1|  236|Homo sapiens cell division cycle 34
           homolog (S. cerevisiae) protein.
          Length = 236

 Score = 75.4 bits (177), Expect = 2e-13
 Identities = 45/111 (40%), Positives = 56/111 (50%), Gaps = 1/111 (0%)
 Frame = +2

Query: 368 SALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQVDTSRHT*NSPLT 547
           S+ +AL LE K LQEEPVEGFRV L+ E +L+ WEVAIFGPP+T Y+    +     P+ 
Sbjct: 8   SSQKALLLELKGLQEEPVEGFRVTLVDEGDLYNWEVAIFGPPNTYYEGGYFKARLKFPID 67

Query: 548 TRIHHHPLGFLTKVWASKCI*KRR-SLHIDSPPARGMILSLANCPCERWEP 697
                    FLTK+W           + I  PP           P ERW P
Sbjct: 68  YPYSPPAFRFLTKMWHPNIYETGDVCISILHPPVDDP--QSGELPSERWNP 116


>BC018143-1|AAH18143.1|  236|Homo sapiens cell division cycle 34
           homolog (S. cerevisiae) protein.
          Length = 236

 Score = 75.4 bits (177), Expect = 2e-13
 Identities = 45/111 (40%), Positives = 56/111 (50%), Gaps = 1/111 (0%)
 Frame = +2

Query: 368 SALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQVDTSRHT*NSPLT 547
           S+ +AL LE K LQEEPVEGFRV L+ E +L+ WEVAIFGPP+T Y+    +     P+ 
Sbjct: 8   SSQKALLLELKGLQEEPVEGFRVTLVDEGDLYNWEVAIFGPPNTYYEGGYFKARLKFPID 67

Query: 548 TRIHHHPLGFLTKVWASKCI*KRR-SLHIDSPPARGMILSLANCPCERWEP 697
                    FLTK+W           + I  PP           P ERW P
Sbjct: 68  YPYSPPAFRFLTKMWHPNIYETGDVCISILHPPVDDP--QSGELPSERWNP 116


>BC009850-1|AAH09850.1|  236|Homo sapiens cell division cycle 34
           homolog (S. cerevisiae) protein.
          Length = 236

 Score = 75.4 bits (177), Expect = 2e-13
 Identities = 45/111 (40%), Positives = 56/111 (50%), Gaps = 1/111 (0%)
 Frame = +2

Query: 368 SALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQVDTSRHT*NSPLT 547
           S+ +AL LE K LQEEPVEGFRV L+ E +L+ WEVAIFGPP+T Y+    +     P+ 
Sbjct: 8   SSQKALLLELKGLQEEPVEGFRVTLVDEGDLYNWEVAIFGPPNTYYEGGYFKARLKFPID 67

Query: 548 TRIHHHPLGFLTKVWASKCI*KRR-SLHIDSPPARGMILSLANCPCERWEP 697
                    FLTK+W           + I  PP           P ERW P
Sbjct: 68  YPYSPPAFRFLTKMWHPNIYETGDVCISILHPPVDDP--QSGELPSERWNP 116


>AY650399-1|AAT46688.1|  236|Homo sapiens cell division cycle 34
           protein.
          Length = 236

 Score = 75.4 bits (177), Expect = 2e-13
 Identities = 45/111 (40%), Positives = 56/111 (50%), Gaps = 1/111 (0%)
 Frame = +2

Query: 368 SALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQVDTSRHT*NSPLT 547
           S+ +AL LE K LQEEPVEGFRV L+ E +L+ WEVAIFGPP+T Y+    +     P+ 
Sbjct: 8   SSQKALLLELKGLQEEPVEGFRVTLVDEGDLYNWEVAIFGPPNTYYEGGYFKARLKFPID 67

Query: 548 TRIHHHPLGFLTKVWASKCI*KRR-SLHIDSPPARGMILSLANCPCERWEP 697
                    FLTK+W           + I  PP           P ERW P
Sbjct: 68  YPYSPPAFRFLTKMWHPNIYETGDVCISILHPPVDDP--QSGELPSERWNP 116


>D78514-1|BAA11410.1|  170|Homo sapiens ubiquitin-conjugating enzyme
           protein.
          Length = 170

 Score = 54.4 bits (125), Expect = 5e-07
 Identities = 24/70 (34%), Positives = 38/70 (54%)
 Frame = +2

Query: 383 LALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQVDTSRHT*NSPLTTRIHH 562
           L  +   L + PVEGF   L+ +++L+ WEV I GPPDTLY+    +     P    +  
Sbjct: 10  LRRQLAELNKNPVEGFSAGLIDDNDLYRWEVLIIGPPDTLYEGGVFKAHLTFPKDYPLRP 69

Query: 563 HPLGFLTKVW 592
             + F+T++W
Sbjct: 70  PKMKFITEIW 79



 Score = 36.7 bits (81), Expect = 0.098
 Identities = 14/18 (77%), Positives = 16/18 (88%)
 Frame = +3

Query: 594 HPNVYENGDLCISILHPP 647
           HPNV +NGD+CISILH P
Sbjct: 80  HPNVDKNGDVCISILHEP 97


>BT007416-1|AAP36084.1|  170|Homo sapiens ubiquitin-conjugating
           enzyme E2G 1 (UBC7 homolog, C. elegans) protein.
          Length = 170

 Score = 54.4 bits (125), Expect = 5e-07
 Identities = 24/70 (34%), Positives = 38/70 (54%)
 Frame = +2

Query: 383 LALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQVDTSRHT*NSPLTTRIHH 562
           L  +   L + PVEGF   L+ +++L+ WEV I GPPDTLY+    +     P    +  
Sbjct: 10  LRRQLAELNKNPVEGFSAGLIDDNDLYRWEVLIIGPPDTLYEGGVFKAHLTFPKDYPLRP 69

Query: 563 HPLGFLTKVW 592
             + F+T++W
Sbjct: 70  PKMKFITEIW 79



 Score = 36.7 bits (81), Expect = 0.098
 Identities = 14/18 (77%), Positives = 16/18 (88%)
 Frame = +3

Query: 594 HPNVYENGDLCISILHPP 647
           HPNV +NGD+CISILH P
Sbjct: 80  HPNVDKNGDVCISILHEP 97


>BC026288-1|AAH26288.2|  225|Homo sapiens UBE2G1 protein protein.
          Length = 225

 Score = 54.4 bits (125), Expect = 5e-07
 Identities = 24/70 (34%), Positives = 38/70 (54%)
 Frame = +2

Query: 383 LALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQVDTSRHT*NSPLTTRIHH 562
           L  +   L + PVEGF   L+ +++L+ WEV I GPPDTLY+    +     P    +  
Sbjct: 65  LRRQLAELNKNPVEGFSAGLIDDNDLYRWEVLIIGPPDTLYEGGVFKAHLTFPKDYPLRP 124

Query: 563 HPLGFLTKVW 592
             + F+T++W
Sbjct: 125 PKMKFITEIW 134



 Score = 36.7 bits (81), Expect = 0.098
 Identities = 14/18 (77%), Positives = 16/18 (88%)
 Frame = +3

Query: 594 HPNVYENGDLCISILHPP 647
           HPNV +NGD+CISILH P
Sbjct: 135 HPNVDKNGDVCISILHEP 152


>BC002775-1|AAH02775.1|  170|Homo sapiens ubiquitin-conjugating
           enzyme E2G 1 (UBC7 homolog, yeast) protein.
          Length = 170

 Score = 54.4 bits (125), Expect = 5e-07
 Identities = 24/70 (34%), Positives = 38/70 (54%)
 Frame = +2

Query: 383 LALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQVDTSRHT*NSPLTTRIHH 562
           L  +   L + PVEGF   L+ +++L+ WEV I GPPDTLY+    +     P    +  
Sbjct: 10  LRRQLAELNKNPVEGFSAGLIDDNDLYRWEVLIIGPPDTLYEGGVFKAHLTFPKDYPLRP 69

Query: 563 HPLGFLTKVW 592
             + F+T++W
Sbjct: 70  PKMKFITEIW 79



 Score = 36.7 bits (81), Expect = 0.098
 Identities = 14/18 (77%), Positives = 16/18 (88%)
 Frame = +3

Query: 594 HPNVYENGDLCISILHPP 647
           HPNV +NGD+CISILH P
Sbjct: 80  HPNVDKNGDVCISILHEP 97


>BT006914-1|AAP35560.1|  165|Homo sapiens ubiquitin-conjugating
           enzyme E2G 2 (UBC7 homolog, yeast) protein.
          Length = 165

 Score = 48.0 bits (109), Expect = 4e-05
 Identities = 21/47 (44%), Positives = 27/47 (57%)
 Frame = +2

Query: 368 SALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQ 508
           +AL+ L  EYK L   P EG     + E+N FEWE  I GP DT ++
Sbjct: 4   TALKRLMAEYKQLTLNPPEGIVAGPMNEENFFEWEALIMGPEDTCFE 50



 Score = 36.7 bits (81), Expect = 0.098
 Identities = 18/39 (46%), Positives = 24/39 (61%)
 Frame = +3

Query: 594 HPNVYENGDLCISILHPPVG*SSVWRTAPANVGNPTQSV 710
           HPN+Y +G +CISILH P G   +   + A   +P QSV
Sbjct: 79  HPNIYPDGRVCISILHAP-GDDPMGYESSAERWSPVQSV 116



 Score = 30.7 bits (66), Expect = 6.4
 Identities = 12/21 (57%), Positives = 14/21 (66%)
 Frame = +1

Query: 511 GYFKAHMKFPPDYPYSPPSIR 573
           G F A + FP DYP SPP +R
Sbjct: 52  GVFPAILSFPLDYPLSPPKMR 72


>BC011569-1|AAH11569.1|  165|Homo sapiens ubiquitin-conjugating
           enzyme E2G 2 (UBC7 homolog, yeast) protein.
          Length = 165

 Score = 48.0 bits (109), Expect = 4e-05
 Identities = 21/47 (44%), Positives = 27/47 (57%)
 Frame = +2

Query: 368 SALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQ 508
           +AL+ L  EYK L   P EG     + E+N FEWE  I GP DT ++
Sbjct: 4   TALKRLMAEYKQLTLNPPEGIVAGPMNEENFFEWEALIMGPEDTCFE 50



 Score = 36.7 bits (81), Expect = 0.098
 Identities = 18/39 (46%), Positives = 24/39 (61%)
 Frame = +3

Query: 594 HPNVYENGDLCISILHPPVG*SSVWRTAPANVGNPTQSV 710
           HPN+Y +G +CISILH P G   +   + A   +P QSV
Sbjct: 79  HPNIYPDGRVCISILHAP-GDDPMGYESSAERWSPVQSV 116



 Score = 30.7 bits (66), Expect = 6.4
 Identities = 12/21 (57%), Positives = 14/21 (66%)
 Frame = +1

Query: 511 GYFKAHMKFPPDYPYSPPSIR 573
           G F A + FP DYP SPP +R
Sbjct: 52  GVFPAILSFPLDYPLSPPKMR 72


>BC008351-1|AAH08351.1|  165|Homo sapiens ubiquitin-conjugating
           enzyme E2G 2 (UBC7 homolog, yeast) protein.
          Length = 165

 Score = 48.0 bits (109), Expect = 4e-05
 Identities = 21/47 (44%), Positives = 27/47 (57%)
 Frame = +2

Query: 368 SALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQ 508
           +AL+ L  EYK L   P EG     + E+N FEWE  I GP DT ++
Sbjct: 4   TALKRLMAEYKQLTLNPPEGIVAGPMNEENFFEWEALIMGPEDTCFE 50



 Score = 36.7 bits (81), Expect = 0.098
 Identities = 18/39 (46%), Positives = 24/39 (61%)
 Frame = +3

Query: 594 HPNVYENGDLCISILHPPVG*SSVWRTAPANVGNPTQSV 710
           HPN+Y +G +CISILH P G   +   + A   +P QSV
Sbjct: 79  HPNIYPDGRVCISILHAP-GDDPMGYESSAERWSPVQSV 116



 Score = 30.7 bits (66), Expect = 6.4
 Identities = 12/21 (57%), Positives = 14/21 (66%)
 Frame = +1

Query: 511 GYFKAHMKFPPDYPYSPPSIR 573
           G F A + FP DYP SPP +R
Sbjct: 52  GVFPAILSFPLDYPLSPPKMR 72


>BC001738-1|AAH01738.1|  165|Homo sapiens ubiquitin-conjugating
           enzyme E2G 2 (UBC7 homolog, yeast) protein.
          Length = 165

 Score = 48.0 bits (109), Expect = 4e-05
 Identities = 21/47 (44%), Positives = 27/47 (57%)
 Frame = +2

Query: 368 SALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQ 508
           +AL+ L  EYK L   P EG     + E+N FEWE  I GP DT ++
Sbjct: 4   TALKRLMAEYKQLTLNPPEGIVAGPMNEENFFEWEALIMGPEDTCFE 50



 Score = 36.7 bits (81), Expect = 0.098
 Identities = 18/39 (46%), Positives = 24/39 (61%)
 Frame = +3

Query: 594 HPNVYENGDLCISILHPPVG*SSVWRTAPANVGNPTQSV 710
           HPN+Y +G +CISILH P G   +   + A   +P QSV
Sbjct: 79  HPNIYPDGRVCISILHAP-GDDPMGYESSAERWSPVQSV 116



 Score = 30.7 bits (66), Expect = 6.4
 Identities = 12/21 (57%), Positives = 14/21 (66%)
 Frame = +1

Query: 511 GYFKAHMKFPPDYPYSPPSIR 573
           G F A + FP DYP SPP +R
Sbjct: 52  GVFPAILSFPLDYPLSPPKMR 72


>AL163300-1|CAB90551.1|  165|Homo sapiens human ubiquitin
           conjugating enzyme G2 EC 6.3.2.19. protein.
          Length = 165

 Score = 48.0 bits (109), Expect = 4e-05
 Identities = 21/47 (44%), Positives = 27/47 (57%)
 Frame = +2

Query: 368 SALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQ 508
           +AL+ L  EYK L   P EG     + E+N FEWE  I GP DT ++
Sbjct: 4   TALKRLMAEYKQLTLNPPEGIVAGPMNEENFFEWEALIMGPEDTCFE 50



 Score = 36.7 bits (81), Expect = 0.098
 Identities = 18/39 (46%), Positives = 24/39 (61%)
 Frame = +3

Query: 594 HPNVYENGDLCISILHPPVG*SSVWRTAPANVGNPTQSV 710
           HPN+Y +G +CISILH P G   +   + A   +P QSV
Sbjct: 79  HPNIYPDGRVCISILHAP-GDDPMGYESSAERWSPVQSV 116



 Score = 30.7 bits (66), Expect = 6.4
 Identities = 12/21 (57%), Positives = 14/21 (66%)
 Frame = +1

Query: 511 GYFKAHMKFPPDYPYSPPSIR 573
           G F A + FP DYP SPP +R
Sbjct: 52  GVFPAILSFPLDYPLSPPKMR 72


>AF032456-1|AAC32312.1|  165|Homo sapiens ubiquitin conjugating
           enzyme G2 protein.
          Length = 165

 Score = 45.2 bits (102), Expect = 3e-04
 Identities = 20/47 (42%), Positives = 26/47 (55%)
 Frame = +2

Query: 368 SALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQ 508
           +AL+ L   YK L   P EG     + E+N FEWE  I GP DT ++
Sbjct: 4   TALKRLMAVYKQLTLNPPEGIVAGPMNEENFFEWEALIMGPEDTCFE 50



 Score = 35.1 bits (77), Expect = 0.30
 Identities = 18/39 (46%), Positives = 22/39 (56%)
 Frame = +3

Query: 594 HPNVYENGDLCISILHPPVG*SSVWRTAPANVGNPTQSV 710
           HPN+Y +G +CISILH P       R  P    +P QSV
Sbjct: 79  HPNIYPDGRVCISILHAPGDDPHGLREQPER-WSPVQSV 116



 Score = 30.7 bits (66), Expect = 6.4
 Identities = 12/21 (57%), Positives = 14/21 (66%)
 Frame = +1

Query: 511 GYFKAHMKFPPDYPYSPPSIR 573
           G F A + FP DYP SPP +R
Sbjct: 52  GVFPAILSFPLDYPLSPPKMR 72


>X78140-1|CAA55019.1|  147|Homo sapiens ubiquitin conjugating enzyme
           protein.
          Length = 147

 Score = 40.7 bits (91), Expect = 0.006
 Identities = 23/74 (31%), Positives = 34/74 (45%)
 Frame = +2

Query: 371 ALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQVDTSRHT*NSPLTT 550
           AL+ +  E   LQ +P        +G+D LF W+  I GPPD+ YQ      T + P   
Sbjct: 2   ALKRIQKELSDLQRDPPAHCSAGPVGDD-LFHWQATIMGPPDSAYQGGVFFLTVHFPTDY 60

Query: 551 RIHHHPLGFLTKVW 592
                 + F TK++
Sbjct: 61  PFKPPKIAFTTKIY 74


>BT007041-1|AAP35690.1|  147|Homo sapiens ubiquitin-conjugating
           enzyme E2D 1 (UBC4/5 homolog, yeast) protein.
          Length = 147

 Score = 40.7 bits (91), Expect = 0.006
 Identities = 23/74 (31%), Positives = 34/74 (45%)
 Frame = +2

Query: 371 ALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQVDTSRHT*NSPLTT 550
           AL+ +  E   LQ +P        +G+D LF W+  I GPPD+ YQ      T + P   
Sbjct: 2   ALKRIQKELSDLQRDPPAHCSAGPVGDD-LFHWQATIMGPPDSAYQGGVFFLTVHFPTDY 60

Query: 551 RIHHHPLGFLTKVW 592
                 + F TK++
Sbjct: 61  PFKPPKIAFTTKIY 74


>BC015997-1|AAH15997.1|  147|Homo sapiens ubiquitin-conjugating
           enzyme E2D 1 (UBC4/5 homolog, yeast) protein.
          Length = 147

 Score = 40.7 bits (91), Expect = 0.006
 Identities = 23/74 (31%), Positives = 34/74 (45%)
 Frame = +2

Query: 371 ALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQVDTSRHT*NSPLTT 550
           AL+ +  E   LQ +P        +G+D LF W+  I GPPD+ YQ      T + P   
Sbjct: 2   ALKRIQKELSDLQRDPPAHCSAGPVGDD-LFHWQATIMGPPDSAYQGGVFFLTVHFPTDY 60

Query: 551 RIHHHPLGFLTKVW 592
                 + F TK++
Sbjct: 61  PFKPPKIAFTTKIY 74


>BC005980-1|AAH05980.1|  147|Homo sapiens ubiquitin-conjugating
           enzyme E2D 1 (UBC4/5 homolog, yeast) protein.
          Length = 147

 Score = 40.7 bits (91), Expect = 0.006
 Identities = 23/74 (31%), Positives = 34/74 (45%)
 Frame = +2

Query: 371 ALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQVDTSRHT*NSPLTT 550
           AL+ +  E   LQ +P        +G+D LF W+  I GPPD+ YQ      T + P   
Sbjct: 2   ALKRIQKELSDLQRDPPAHCSAGPVGDD-LFHWQATIMGPPDSAYQGGVFFLTVHFPTDY 60

Query: 551 RIHHHPLGFLTKVW 592
                 + F TK++
Sbjct: 61  PFKPPKIAFTTKIY 74


>AJ293565-1|CAC82097.1|  147|Homo sapiens ubiquitin-conjugating
           enzyme protein.
          Length = 147

 Score = 40.7 bits (91), Expect = 0.006
 Identities = 23/74 (31%), Positives = 34/74 (45%)
 Frame = +2

Query: 371 ALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQVDTSRHT*NSPLTT 550
           AL+ +  E   LQ +P        +G+D LF W+  I GPPD+ YQ      T + P   
Sbjct: 2   ALKRIQKELSDLQRDPPAHCSAGPVGDD-LFHWQATIMGPPDSAYQGGVFFLTVHFPTDY 60

Query: 551 RIHHHPLGFLTKVW 592
                 + F TK++
Sbjct: 61  PFKPPKIAFTTKIY 74


>AJ272367-1|CAC82177.1|  147|Homo sapiens ubiquitin-conjugating
           enzyme protein.
          Length = 147

 Score = 40.7 bits (91), Expect = 0.006
 Identities = 23/74 (31%), Positives = 34/74 (45%)
 Frame = +2

Query: 371 ALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQVDTSRHT*NSPLTT 550
           AL+ +  E   LQ +P        +G+D LF W+  I GPPD+ YQ      T + P   
Sbjct: 2   ALKRIQKELSDLQRDPPAHCSAGPVGDD-LFHWQATIMGPPDSAYQGGVFFLTVHFPTDY 60

Query: 551 RIHHHPLGFLTKVW 592
                 + F TK++
Sbjct: 61  PFKPPKIAFTTKIY 74


>AF257220-1|AAM81086.1|  147|Homo sapiens ubiquitin-conjugating
           enzyme protein.
          Length = 147

 Score = 40.7 bits (91), Expect = 0.006
 Identities = 23/74 (31%), Positives = 34/74 (45%)
 Frame = +2

Query: 371 ALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQVDTSRHT*NSPLTT 550
           AL+ +  E   LQ +P        +G+D LF W+  I GPPD+ YQ      T + P   
Sbjct: 2   ALKRIQKELSDLQRDPPAHCSAGPVGDD-LFHWQATIMGPPDSAYQGGVFFLTVHFPTDY 60

Query: 551 RIHHHPLGFLTKVW 592
                 + F TK++
Sbjct: 61  PFKPPKIAFTTKIY 74


>U93243-1|AAF21505.1|  318|Homo sapiens Ubc6p homolog protein.
          Length = 318

 Score = 39.5 bits (88), Expect = 0.014
 Identities = 20/49 (40%), Positives = 30/49 (61%)
 Frame = +2

Query: 365 SSALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQV 511
           S A++ L  E   L++ P + +  +LL EDNLFEW   + GPPD+ + V
Sbjct: 9   SPAVKRLMKEAAELKD-PTDHYHAQLL-EDNLFEWHFTVRGPPDSDFDV 55


>X53251-1|CAA37339.1|  152|Homo sapiens E2 protein protein.
          Length = 152

 Score = 35.9 bits (79), Expect = 0.17
 Identities = 18/52 (34%), Positives = 28/52 (53%)
 Frame = +2

Query: 362 TSSALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQVDT 517
           ++ A R L  ++K LQE+P  G       E+N+ +W   IFGP  T ++  T
Sbjct: 2   STPARRRLMRDFKRLQEDPPVGVS-GAPSENNIMQWNAVIFGPEGTPFEDGT 52


>M74525-1|AAA35982.1|  152|Homo sapiens protein ( Human HHR6B (yeast
           RAD 6 homologue) mRNA, complete cds. ).
          Length = 152

 Score = 35.9 bits (79), Expect = 0.17
 Identities = 18/52 (34%), Positives = 28/52 (53%)
 Frame = +2

Query: 362 TSSALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQVDT 517
           ++ A R L  ++K LQE+P  G       E+N+ +W   IFGP  T ++  T
Sbjct: 2   STPARRRLMRDFKRLQEDPPVGVS-GAPSENNIMQWNAVIFGPEGTPFEDGT 52


>DQ090910-1|AAY68224.1|  152|Homo sapiens ubiquitin-conjugating
           enzyme E2B (RAD6 homolog) protein.
          Length = 152

 Score = 35.9 bits (79), Expect = 0.17
 Identities = 18/52 (34%), Positives = 28/52 (53%)
 Frame = +2

Query: 362 TSSALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQVDT 517
           ++ A R L  ++K LQE+P  G       E+N+ +W   IFGP  T ++  T
Sbjct: 2   STPARRRLMRDFKRLQEDPPVGVS-GAPSENNIMQWNAVIFGPEGTPFEDGT 52


>CR407634-1|CAG28562.1|  152|Homo sapiens UBE2B protein.
          Length = 152

 Score = 35.9 bits (79), Expect = 0.17
 Identities = 18/52 (34%), Positives = 28/52 (53%)
 Frame = +2

Query: 362 TSSALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQVDT 517
           ++ A R L  ++K LQE+P  G       E+N+ +W   IFGP  T ++  T
Sbjct: 2   STPARRRLMRDFKRLQEDPPVGVS-GAPSENNIMQWNAVIFGPEGTPFEDGT 52


>BT007071-1|AAP35734.1|  152|Homo sapiens ubiquitin-conjugating
           enzyme E2B (RAD6 homolog) protein.
          Length = 152

 Score = 35.9 bits (79), Expect = 0.17
 Identities = 18/52 (34%), Positives = 28/52 (53%)
 Frame = +2

Query: 362 TSSALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQVDT 517
           ++ A R L  ++K LQE+P  G       E+N+ +W   IFGP  T ++  T
Sbjct: 2   STPARRRLMRDFKRLQEDPPVGVS-GAPSENNIMQWNAVIFGPEGTPFEDGT 52


>BC008470-1|AAH08470.1|  152|Homo sapiens ubiquitin-conjugating
           enzyme E2B (RAD6 homolog) protein.
          Length = 152

 Score = 35.9 bits (79), Expect = 0.17
 Identities = 18/52 (34%), Positives = 28/52 (53%)
 Frame = +2

Query: 362 TSSALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQVDT 517
           ++ A R L  ++K LQE+P  G       E+N+ +W   IFGP  T ++  T
Sbjct: 2   STPARRRLMRDFKRLQEDPPVGVS-GAPSENNIMQWNAVIFGPEGTPFEDGT 52


>BC008404-1|AAH08404.1|  152|Homo sapiens ubiquitin-conjugating
           enzyme E2B (RAD6 homolog) protein.
          Length = 152

 Score = 35.9 bits (79), Expect = 0.17
 Identities = 18/52 (34%), Positives = 28/52 (53%)
 Frame = +2

Query: 362 TSSALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQVDT 517
           ++ A R L  ++K LQE+P  G       E+N+ +W   IFGP  T ++  T
Sbjct: 2   STPARRRLMRDFKRLQEDPPVGVS-GAPSENNIMQWNAVIFGPEGTPFEDGT 52


>BC005979-1|AAH05979.1|  152|Homo sapiens ubiquitin-conjugating
           enzyme E2B (RAD6 homolog) protein.
          Length = 152

 Score = 35.9 bits (79), Expect = 0.17
 Identities = 18/52 (34%), Positives = 28/52 (53%)
 Frame = +2

Query: 362 TSSALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQVDT 517
           ++ A R L  ++K LQE+P  G       E+N+ +W   IFGP  T ++  T
Sbjct: 2   STPARRRLMRDFKRLQEDPPVGVS-GAPSENNIMQWNAVIFGPEGTPFEDGT 52


>DQ068065-1|AAY46159.1|  152|Homo sapiens ubiquitin-conjugating
           enzyme E2A (RAD6 homolog) protein.
          Length = 152

 Score = 35.5 bits (78), Expect = 0.23
 Identities = 19/56 (33%), Positives = 29/56 (51%)
 Frame = +2

Query: 362 TSSALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQVDTSRHT 529
           ++ A R L  ++K LQE+P  G       E+N+  W   IFGP  T ++  T + T
Sbjct: 2   STPARRRLMRDFKRLQEDPPAGVS-GAPSENNIMVWNAVIFGPEGTPFEDGTFKLT 56


>BC013973-1|AAH13973.1|  318|Homo sapiens ubiquitin-conjugating
           enzyme E2, J1 (UBC6 homolog, yeast) protein.
          Length = 318

 Score = 35.5 bits (78), Expect = 0.23
 Identities = 18/45 (40%), Positives = 27/45 (60%)
 Frame = +2

Query: 365 SSALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDT 499
           S A++ L  E   L++ P + +  + L EDNLFEW   + GPPD+
Sbjct: 9   SPAVKRLMKEAAELKD-PTDHYHAQPL-EDNLFEWHFTVRGPPDS 51


>BC010175-1|AAH10175.1|  152|Homo sapiens ubiquitin-conjugating
           enzyme E2A (RAD6 homolog) protein.
          Length = 152

 Score = 35.5 bits (78), Expect = 0.23
 Identities = 19/56 (33%), Positives = 29/56 (51%)
 Frame = +2

Query: 362 TSSALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQVDTSRHT 529
           ++ A R L  ++K LQE+P  G       E+N+  W   IFGP  T ++  T + T
Sbjct: 2   STPARRRLMRDFKRLQEDPPAGVS-GAPSENNIMVWNAVIFGPEGTPFEDGTFKLT 56


>BC004104-1|AAH04104.1|  147|Homo sapiens ubiquitin-conjugating
           enzyme E2D 4 (putative) protein.
          Length = 147

 Score = 35.5 bits (78), Expect = 0.23
 Identities = 22/74 (29%), Positives = 33/74 (44%)
 Frame = +2

Query: 371 ALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQVDTSRHT*NSPLTT 550
           AL+ +  E   LQ +P        +G+D LF W+  I GP D+ YQ      T + P   
Sbjct: 2   ALKRIQKELTDLQRDPPAQCSAGPVGDD-LFHWQATIMGPNDSPYQGGVFFLTIHFPTDY 60

Query: 551 RIHHHPLGFLTKVW 592
                 + F TK++
Sbjct: 61  PFKPPKVAFTTKIY 74


>AL139804-1|CAI19635.1|  318|Homo sapiens NCUBE1 protein.
          Length = 318

 Score = 35.5 bits (78), Expect = 0.23
 Identities = 18/45 (40%), Positives = 27/45 (60%)
 Frame = +2

Query: 365 SSALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDT 499
           S A++ L  E   L++ P + +  + L EDNLFEW   + GPPD+
Sbjct: 9   SPAVKRLMKEAAELKD-PTDHYHAQPL-EDNLFEWHFTVRGPPDS 51


>AL138717-1|CAH70228.1|  318|Homo sapiens NCUBE1 protein.
          Length = 318

 Score = 35.5 bits (78), Expect = 0.23
 Identities = 18/45 (40%), Positives = 27/45 (60%)
 Frame = +2

Query: 365 SSALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDT 499
           S A++ L  E   L++ P + +  + L EDNLFEW   + GPPD+
Sbjct: 9   SPAVKRLMKEAAELKD-PTDHYHAQPL-EDNLFEWHFTVRGPPDS 51


>AK223464-1|BAD97184.1|  318|Homo sapiens ubiquitin-conjugating
           enzyme E2, J1 variant protein.
          Length = 318

 Score = 35.5 bits (78), Expect = 0.23
 Identities = 18/45 (40%), Positives = 27/45 (60%)
 Frame = +2

Query: 365 SSALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDT 499
           S A++ L  E   L++ P + +  + L EDNLFEW   + GPPD+
Sbjct: 9   SPAVKRLMKEAAELKD-PTDHYHAQPL-EDNLFEWHFTVRGPPDS 51


>AK223064-1|BAD96784.1|  152|Homo sapiens ubiquitin-conjugating
           enzyme E2A isoform 1 variant protein.
          Length = 152

 Score = 35.5 bits (78), Expect = 0.23
 Identities = 19/56 (33%), Positives = 29/56 (51%)
 Frame = +2

Query: 362 TSSALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQVDTSRHT 529
           ++ A R L  ++K LQE+P  G       E+N+  W   IFGP  T ++  T + T
Sbjct: 2   STPARRRLMRDFKRLQEDPPAGVS-GAPSENNIMVWNAVIFGPEGTPFEDGTFKLT 56


>AK223045-1|BAD96765.1|  152|Homo sapiens ubiquitin-conjugating
           enzyme E2A isoform 1 variant protein.
          Length = 152

 Score = 35.5 bits (78), Expect = 0.23
 Identities = 19/56 (33%), Positives = 29/56 (51%)
 Frame = +2

Query: 362 TSSALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQVDTSRHT 529
           ++ A R L  ++K LQE+P  G       E+N+  W   IFGP  T ++  T + T
Sbjct: 2   STPARRRLMRDFKRLQEDPPAGVS-GAPSENNIMVWNAVIFGPEGTPFEDGTFKLT 56


>AK001446-1|BAA91697.1|  147|Homo sapiens protein ( Homo sapiens
           cDNA FLJ10584 fis, clone NT2RP2003737, highly similar to
           UBIQUITIN-CONJUGATING ENZYME E2-17 KD 2 (EC 6.3.2.19).
           ).
          Length = 147

 Score = 35.5 bits (78), Expect = 0.23
 Identities = 22/74 (29%), Positives = 33/74 (44%)
 Frame = +2

Query: 371 ALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQVDTSRHT*NSPLTT 550
           AL+ +  E   LQ +P        +G+D LF W+  I GP D+ YQ      T + P   
Sbjct: 2   ALKRIQKELTDLQRDPPAQCSAGPVGDD-LFHWQATIMGPNDSPYQGGVFFLTIHFPTDY 60

Query: 551 RIHHHPLGFLTKVW 592
                 + F TK++
Sbjct: 61  PFKPPKVAFTTKIY 74


>AJ245898-1|CAB83212.1|  318|Homo sapiens Non-Canonical UBiquitin
           Conjugating Enzyme 1 (NCUBE1) protein.
          Length = 318

 Score = 35.5 bits (78), Expect = 0.23
 Identities = 18/45 (40%), Positives = 27/45 (60%)
 Frame = +2

Query: 365 SSALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDT 499
           S A++ L  E   L++ P + +  + L EDNLFEW   + GPPD+
Sbjct: 9   SPAVKRLMKEAAELKD-PTDHYHAQPL-EDNLFEWHFTVRGPPDS 51


>AF151834-1|AAD34071.1|  325|Homo sapiens CGI-76 protein protein.
          Length = 325

 Score = 35.5 bits (78), Expect = 0.23
 Identities = 18/45 (40%), Positives = 26/45 (57%)
 Frame = +2

Query: 365 SSALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDT 499
           S A++ L  E   L++ P + +    L EDNLFEW   + GPPD+
Sbjct: 16  SPAVKRLMKEAAELKD-PTDHYHAHAL-EDNLFEWHFTVRGPPDS 58


>AF125044-1|AAD31180.1|  147|Homo sapiens ubiquitin-conjugating
           enzyme HBUCE1 protein.
          Length = 147

 Score = 35.5 bits (78), Expect = 0.23
 Identities = 22/74 (29%), Positives = 33/74 (44%)
 Frame = +2

Query: 371 ALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQVDTSRHT*NSPLTT 550
           AL+ +  E   LQ +P        +G+D LF W+  I GP D+ YQ      T + P   
Sbjct: 2   ALKRIQKELTDLQRDPPAQCSAGPVGDD-LFHWQATIMGPNDSPYQGGVFFLTIHFPTDY 60

Query: 551 RIHHHPLGFLTKVW 592
                 + F TK++
Sbjct: 61  PFKPPKVAFTTKIY 74


>BT019345-1|AAV38152.1|  207|Homo sapiens ubiquitin-conjugating
           enzyme E2E 3 (UBC4/5 homolog, yeast) protein.
          Length = 207

 Score = 34.7 bits (76), Expect = 0.40
 Identities = 17/60 (28%), Positives = 29/60 (48%)
 Frame = +2

Query: 329 NT*LTMSNTVPTSSALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQ 508
           NT L+   T   S++ + +  E   +  +P         G DN++EW   I GPP ++Y+
Sbjct: 48  NTKLSSKTTAKLSTSAKRIQKELAEITLDPPPNCSAGPKG-DNIYEWRSTILGPPGSVYE 106


>BC092407-1|AAH92407.1|  207|Homo sapiens ubiquitin-conjugating
           enzyme E2E 3 (UBC4/5 homolog, yeast) protein.
          Length = 207

 Score = 34.7 bits (76), Expect = 0.40
 Identities = 17/60 (28%), Positives = 29/60 (48%)
 Frame = +2

Query: 329 NT*LTMSNTVPTSSALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQ 508
           NT L+   T   S++ + +  E   +  +P         G DN++EW   I GPP ++Y+
Sbjct: 48  NTKLSSKTTAKLSTSAKRIQKELAEITLDPPPNCSAGPKG-DNIYEWRSTILGPPGSVYE 106


>BC003554-1|AAH03554.1|  207|Homo sapiens ubiquitin-conjugating
           enzyme E2E 3 (UBC4/5 homolog, yeast) protein.
          Length = 207

 Score = 34.7 bits (76), Expect = 0.40
 Identities = 17/60 (28%), Positives = 29/60 (48%)
 Frame = +2

Query: 329 NT*LTMSNTVPTSSALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQ 508
           NT L+   T   S++ + +  E   +  +P         G DN++EW   I GPP ++Y+
Sbjct: 48  NTKLSSKTTAKLSTSAKRIQKELAEITLDPPPNCSAGPKG-DNIYEWRSTILGPPGSVYE 106


>AC104076-1|AAY14882.1|  207|Homo sapiens unknown protein.
          Length = 207

 Score = 34.7 bits (76), Expect = 0.40
 Identities = 17/60 (28%), Positives = 29/60 (48%)
 Frame = +2

Query: 329 NT*LTMSNTVPTSSALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQ 508
           NT L+   T   S++ + +  E   +  +P         G DN++EW   I GPP ++Y+
Sbjct: 48  NTKLSSKTTAKLSTSAKRIQKELAEITLDPPPNCSAGPKG-DNIYEWRSTILGPPGSVYE 106


>AB017644-1|BAA76544.1|  207|Homo sapiens ubiquitin-conjugating
           enzyme E2 protein.
          Length = 207

 Score = 34.7 bits (76), Expect = 0.40
 Identities = 17/60 (28%), Positives = 29/60 (48%)
 Frame = +2

Query: 329 NT*LTMSNTVPTSSALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQ 508
           NT L+   T   S++ + +  E   +  +P         G DN++EW   I GPP ++Y+
Sbjct: 48  NTKLSSKTTAKLSTSAKRIQKELAEITLDPPPNCSAGPKG-DNIYEWRSTILGPPGSVYE 106


>M74524-1|AAA35981.1|  152|Homo sapiens protein ( Human HHR6A (yeast
           RAD 6 homologue) mRNA, complete cds. ).
          Length = 152

 Score = 33.9 bits (74), Expect = 0.69
 Identities = 19/56 (33%), Positives = 28/56 (50%)
 Frame = +2

Query: 362 TSSALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQVDTSRHT 529
           ++ A R L  ++K LQE+P  G       E+N+  W   IFGP  T +   T + T
Sbjct: 2   STPARRRLMRDFKRLQEDPPAGVS-GAPSENNIMVWNAVIFGPEGTPFGDGTFKLT 56


>AB058743-1|BAB47469.2| 2443|Homo sapiens KIAA1840 protein protein.
          Length = 2443

 Score = 33.9 bits (74), Expect = 0.69
 Identities = 20/52 (38%), Positives = 28/52 (53%)
 Frame = +2

Query: 362 TSSALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQVDT 517
           TS   R+  + + S QEEP+E   V + G   LF WEV   G   TL+ ++T
Sbjct: 406 TSDPGRSWKIMHISEQEEPIELKCVSVTGFTALFTWEVERMGYTITLWDLET 457


>U39318-1|AAA91461.1|  147|Homo sapiens UbcH5C protein.
          Length = 147

 Score = 31.1 bits (67), Expect = 4.9
 Identities = 19/74 (25%), Positives = 32/74 (43%)
 Frame = +2

Query: 371 ALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQVDTSRHT*NSPLTT 550
           AL+ +  E   L  +P        +G+D +F W+  I GP D+ YQ      T + P   
Sbjct: 2   ALKRINKELSDLARDPPAQCSAGPVGDD-MFHWQATIMGPNDSPYQGGVFFLTIHFPTDY 60

Query: 551 RIHHHPLGFLTKVW 592
                 + F T+++
Sbjct: 61  PFKPPKVAFTTRIY 74


>U39317-1|AAA91460.1|  147|Homo sapiens UbcH5B protein.
          Length = 147

 Score = 31.1 bits (67), Expect = 4.9
 Identities = 19/74 (25%), Positives = 32/74 (43%)
 Frame = +2

Query: 371 ALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQVDTSRHT*NSPLTT 550
           AL+ +  E   L  +P        +G+D +F W+  I GP D+ YQ      T + P   
Sbjct: 2   ALKRIHKELNDLARDPPAQCSAGPVGDD-MFHWQATIMGPNDSPYQGGVFFLTIHFPTDY 60

Query: 551 RIHHHPLGFLTKVW 592
                 + F T+++
Sbjct: 61  PFKPPKVAFTTRIY 74


>L40146-1|AAC41750.1|  147|Homo sapiens ubiquitin conjugating enzyme
           protein.
          Length = 147

 Score = 31.1 bits (67), Expect = 4.9
 Identities = 19/74 (25%), Positives = 32/74 (43%)
 Frame = +2

Query: 371 ALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQVDTSRHT*NSPLTT 550
           AL+ +  E   L  +P        +G+D +F W+  I GP D+ YQ      T + P   
Sbjct: 2   ALKRIHKELNDLARDPPAQCSAGPVGDD-MFHWQATIMGPNDSPYQGGVFFLTIHFPTDY 60

Query: 551 RIHHHPLGFLTKVW 592
                 + F T+++
Sbjct: 61  PFKPPKVAFTTRIY 74


>CR456916-1|CAG33197.1|  147|Homo sapiens UBE2D3 protein.
          Length = 147

 Score = 31.1 bits (67), Expect = 4.9
 Identities = 19/74 (25%), Positives = 32/74 (43%)
 Frame = +2

Query: 371 ALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQVDTSRHT*NSPLTT 550
           AL+ +  E   L  +P        +G+D +F W+  I GP D+ YQ      T + P   
Sbjct: 2   ALKRINKELSDLARDPPAQCSAGPVGDD-MFHWQATIMGPNDSPYQGGVFFLTIHFPTDY 60

Query: 551 RIHHHPLGFLTKVW 592
                 + F T+++
Sbjct: 61  PFKPPKVAFTTRIY 74


>BC066917-1|AAH66917.1|  147|Homo sapiens ubiquitin-conjugating
           enzyme E2D 3 (UBC4/5 homolog, yeast) protein.
          Length = 147

 Score = 31.1 bits (67), Expect = 4.9
 Identities = 19/74 (25%), Positives = 32/74 (43%)
 Frame = +2

Query: 371 ALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQVDTSRHT*NSPLTT 550
           AL+ +  E   L  +P        +G+D +F W+  I GP D+ YQ      T + P   
Sbjct: 2   ALKRINKELSDLARDPPAQCSAGPVGDD-MFHWQATIMGPNDSPYQGGVFFLTIHFPTDY 60

Query: 551 RIHHHPLGFLTKVW 592
                 + F T+++
Sbjct: 61  PFKPPKVAFTTRIY 74


>BC037894-1|AAH37894.1|  147|Homo sapiens ubiquitin-conjugating
           enzyme E2D 3 (UBC4/5 homolog, yeast) protein.
          Length = 147

 Score = 31.1 bits (67), Expect = 4.9
 Identities = 19/74 (25%), Positives = 32/74 (43%)
 Frame = +2

Query: 371 ALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQVDTSRHT*NSPLTT 550
           AL+ +  E   L  +P        +G+D +F W+  I GP D+ YQ      T + P   
Sbjct: 2   ALKRINKELSDLARDPPAQCSAGPVGDD-MFHWQATIMGPNDSPYQGGVFFLTIHFPTDY 60

Query: 551 RIHHHPLGFLTKVW 592
                 + F T+++
Sbjct: 61  PFKPPKVAFTTRIY 74


>BC033349-1|AAH33349.1|  147|Homo sapiens ubiquitin-conjugating
           enzyme E2D 2 (UBC4/5 homolog, yeast) protein.
          Length = 147

 Score = 31.1 bits (67), Expect = 4.9
 Identities = 19/74 (25%), Positives = 32/74 (43%)
 Frame = +2

Query: 371 ALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQVDTSRHT*NSPLTT 550
           AL+ +  E   L  +P        +G+D +F W+  I GP D+ YQ      T + P   
Sbjct: 2   ALKRIHKELNDLARDPPAQCSAGPVGDD-MFHWQATIMGPNDSPYQGGVFFLTIHFPTDY 60

Query: 551 RIHHHPLGFLTKVW 592
                 + F T+++
Sbjct: 61  PFKPPKVAFTTRIY 74


>BC003395-1|AAH03395.1|  147|Homo sapiens ubiquitin-conjugating
           enzyme E2D 3 (UBC4/5 homolog, yeast) protein.
          Length = 147

 Score = 31.1 bits (67), Expect = 4.9
 Identities = 19/74 (25%), Positives = 32/74 (43%)
 Frame = +2

Query: 371 ALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQVDTSRHT*NSPLTT 550
           AL+ +  E   L  +P        +G+D +F W+  I GP D+ YQ      T + P   
Sbjct: 2   ALKRINKELSDLARDPPAQCSAGPVGDD-MFHWQATIMGPNDSPYQGGVFFLTIHFPTDY 60

Query: 551 RIHHHPLGFLTKVW 592
                 + F T+++
Sbjct: 61  PFKPPKVAFTTRIY 74


>AY651263-1|AAX35690.1|  147|Homo sapiens ubiquitin-conjugating
           enzyme E2 D2 transcript variant 1 protein.
          Length = 147

 Score = 31.1 bits (67), Expect = 4.9
 Identities = 19/74 (25%), Positives = 32/74 (43%)
 Frame = +2

Query: 371 ALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQVDTSRHT*NSPLTT 550
           AL+ +  E   L  +P        +G+D +F W+  I GP D+ YQ      T + P   
Sbjct: 2   ALKRIHKELNDLARDPPAQCSAGPVGDD-MFHWQATIMGPNDSPYQGGVFFLTIHFPTDY 60

Query: 551 RIHHHPLGFLTKVW 592
                 + F T+++
Sbjct: 61  PFKPPKVAFTTRIY 74


>AK095822-1|BAC04632.1|  148|Homo sapiens protein ( Homo sapiens
           cDNA FLJ38503 fis, clone HCHON2000056, highly similar to
           UBIQUITIN-CONJUGATING ENZYME E2-17 KDA 3 (EC 6.3.2.19).
           ).
          Length = 148

 Score = 31.1 bits (67), Expect = 4.9
 Identities = 19/74 (25%), Positives = 32/74 (43%)
 Frame = +2

Query: 371 ALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQVDTSRHT*NSPLTT 550
           AL+ +  E   L  +P        +G+D +F W+  I GP D+ YQ      T + P   
Sbjct: 2   ALKRINKELSDLARDPPAQCSAGPVGDD-MFHWQATIMGPNDSPYQGGVFFLTIHFPTDY 60

Query: 551 RIHHHPLGFLTKVW 592
                 + F T+++
Sbjct: 61  PFKPPKVAFTTRIY 74


>AF213884-3|AAF35234.1|  147|Homo sapiens ubiquitin-conjugating
           enzyme E2D 3 protein.
          Length = 147

 Score = 31.1 bits (67), Expect = 4.9
 Identities = 19/74 (25%), Positives = 32/74 (43%)
 Frame = +2

Query: 371 ALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQVDTSRHT*NSPLTT 550
           AL+ +  E   L  +P        +G+D +F W+  I GP D+ YQ      T + P   
Sbjct: 2   ALKRINKELSDLARDPPAQCSAGPVGDD-MFHWQATIMGPNDSPYQGGVFFLTIHFPTDY 60

Query: 551 RIHHHPLGFLTKVW 592
                 + F T+++
Sbjct: 61  PFKPPKVAFTTRIY 74


>AL391240-1|CAM28242.1| 2106|Homo sapiens novel protein protein.
          Length = 2106

 Score = 30.7 bits (66), Expect = 6.4
 Identities = 16/39 (41%), Positives = 23/39 (58%), Gaps = 3/39 (7%)
 Frame = +1

Query: 688  LGTL-HNRFATGT--PPLVISIPQRSPNTFQFRGNGRCQ 795
            +GTL HN F+ G   PPL IS PQ++  +    G+  C+
Sbjct: 950  VGTLEHNHFSDGASQPPLTISQPQKATGSAGLLGDPECE 988


>AL031433-2|CAI19661.2| 2106|Homo sapiens novel protein protein.
          Length = 2106

 Score = 30.7 bits (66), Expect = 6.4
 Identities = 16/39 (41%), Positives = 23/39 (58%), Gaps = 3/39 (7%)
 Frame = +1

Query: 688  LGTL-HNRFATGT--PPLVISIPQRSPNTFQFRGNGRCQ 795
            +GTL HN F+ G   PPL IS PQ++  +    G+  C+
Sbjct: 950  VGTLEHNHFSDGASQPPLTISQPQKATGSAGLLGDPECE 988


>AL031003-5|CAM28244.1| 2106|Homo sapiens novel protein protein.
          Length = 2106

 Score = 30.7 bits (66), Expect = 6.4
 Identities = 16/39 (41%), Positives = 23/39 (58%), Gaps = 3/39 (7%)
 Frame = +1

Query: 688  LGTL-HNRFATGT--PPLVISIPQRSPNTFQFRGNGRCQ 795
            +GTL HN F+ G   PPL IS PQ++  +    G+  C+
Sbjct: 950  VGTLEHNHFSDGASQPPLTISQPQKATGSAGLLGDPECE 988


>AF413080-1|AAL04174.1| 1770|Homo sapiens BIG3 protein.
          Length = 1770

 Score = 30.7 bits (66), Expect = 6.4
 Identities = 16/39 (41%), Positives = 23/39 (58%), Gaps = 3/39 (7%)
 Frame = +1

Query: 688 LGTL-HNRFATGT--PPLVISIPQRSPNTFQFRGNGRCQ 795
           +GTL HN F+ G   PPL IS PQ++  +    G+  C+
Sbjct: 614 VGTLEHNHFSDGASQPPLTISQPQKATGSAGLLGDPECE 652


>AB033070-1|BAA86558.2| 1872|Homo sapiens KIAA1244 protein protein.
          Length = 1872

 Score = 30.7 bits (66), Expect = 6.4
 Identities = 16/39 (41%), Positives = 23/39 (58%), Gaps = 3/39 (7%)
 Frame = +1

Query: 688 LGTL-HNRFATGT--PPLVISIPQRSPNTFQFRGNGRCQ 795
           +GTL HN F+ G   PPL IS PQ++  +    G+  C+
Sbjct: 716 VGTLEHNHFSDGASQPPLTISQPQKATGSAGLLGDPECE 754


>X92963-1|CAA63539.1|  193|Homo sapiens ubiquitin-conjugating enzyme
           UbcH6 protein.
          Length = 193

 Score = 30.3 bits (65), Expect = 8.5
 Identities = 9/19 (47%), Positives = 14/19 (73%)
 Frame = +2

Query: 452 DNLFEWEVAIFGPPDTLYQ 508
           DN++EW   I GPP ++Y+
Sbjct: 74  DNIYEWRSTILGPPGSVYE 92


>BC022332-1|AAH22332.1|  201|Homo sapiens ubiquitin-conjugating
           enzyme E2E 2 (UBC4/5 homolog, yeast) protein.
          Length = 201

 Score = 30.3 bits (65), Expect = 8.5
 Identities = 9/19 (47%), Positives = 14/19 (73%)
 Frame = +2

Query: 452 DNLFEWEVAIFGPPDTLYQ 508
           DN++EW   I GPP ++Y+
Sbjct: 82  DNIYEWRSTILGPPGSVYE 100


>BC009139-1|AAH09139.1|  193|Homo sapiens ubiquitin-conjugating
           enzyme E2E 1 (UBC4/5 homolog, yeast) protein.
          Length = 193

 Score = 30.3 bits (65), Expect = 8.5
 Identities = 9/19 (47%), Positives = 14/19 (73%)
 Frame = +2

Query: 452 DNLFEWEVAIFGPPDTLYQ 508
           DN++EW   I GPP ++Y+
Sbjct: 74  DNIYEWRSTILGPPGSVYE 92


>AK057886-1|BAB71605.1|  201|Homo sapiens protein ( Homo sapiens
           cDNA FLJ25157 fis, clone CBR08008, highly similar to
           UBIQUITIN-CONJUGATING ENZYME E2-23 KDA (EC 6.3.2.19). ).
          Length = 201

 Score = 30.3 bits (65), Expect = 8.5
 Identities = 9/19 (47%), Positives = 14/19 (73%)
 Frame = +2

Query: 452 DNLFEWEVAIFGPPDTLYQ 508
           DN++EW   I GPP ++Y+
Sbjct: 82  DNIYEWRSTILGPPGSVYE 100


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 131,801,704
Number of Sequences: 237096
Number of extensions: 3104698
Number of successful extensions: 6538
Number of sequences better than 10.0: 78
Number of HSP's better than 10.0 without gapping: 5955
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6477
length of database: 76,859,062
effective HSP length: 89
effective length of database: 55,757,518
effective search space used: 9924838204
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).