SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30049
         (727 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

D30655-1|BAA06336.1|  407|Homo sapiens eukaryotic initiation fac...   109   1e-23
BT009860-1|AAP88862.1|  407|Homo sapiens eukaryotic translation ...   109   1e-23
BC048105-1|AAH48105.1|  408|Homo sapiens eukaryotic translation ...   109   1e-23
BC013708-1|AAH13708.1|  407|Homo sapiens eukaryotic translation ...   109   1e-23
BC012547-1|AAH12547.1|  408|Homo sapiens eukaryotic translation ...   109   1e-23
BC015842-1|AAH15842.1|  407|Homo sapiens eukaryotic translation ...   109   1e-23
D13748-1|BAA02897.1|  406|Homo sapiens eukaryotic initiation fac...   108   2e-23
BT019881-1|AAV38684.1|  406|Homo sapiens eukaryotic translation ...   108   2e-23
BT019880-1|AAV38683.1|  406|Homo sapiens eukaryotic translation ...   108   2e-23
BC073752-1|AAH73752.1|  406|Homo sapiens eukaryotic translation ...   108   2e-23
BC009585-1|AAH09585.1|  406|Homo sapiens eukaryotic translation ...   108   2e-23
AB209593-1|BAD92830.1|  375|Homo sapiens CD68 antigen variant pr...   108   2e-23
AY207392-1|AAO66460.1|  101|Homo sapiens eukaryotic translation ...   106   7e-23
X79538-1|CAA56074.1|  411|Homo sapiens translation initiation fa...   106   9e-23
D21853-1|BAA04879.2|  412|Homo sapiens KIAA0111 protein.              106   9e-23
CR456750-1|CAG33031.1|  411|Homo sapiens DDX48 protein.               106   9e-23
BC011151-1|AAH11151.1|  411|Homo sapiens eukaryotic translation ...   106   9e-23
BC004386-1|AAH04386.1|  411|Homo sapiens eukaryotic translation ...   106   9e-23
BC003662-1|AAH03662.1|  411|Homo sapiens eukaryotic translation ...   106   9e-23
BC006380-1|AAH06380.1|  473|Homo sapiens Unknown (protein for IM...   105   2e-22
AB209021-1|BAD92258.1|   67|Homo sapiens BM-010 variant protein.       88   3e-17
AY735312-1|AAU84667.1|  483|Homo sapiens gonadotropin-regulated ...    61   3e-09
AF155140-1|AAF21371.2|  483|Homo sapiens gonadotropin-regulated ...    61   3e-09
D17532-1|BAA04482.1|  472|Homo sapiens RCK protein.                    59   1e-08
BC065007-1|AAH65007.1|  483|Homo sapiens DDX6 protein protein.         59   1e-08
BC039826-1|AAH39826.1|  187|Homo sapiens DDX6 protein protein.         59   1e-08
BC110805-1|AAI10806.1|  449|Homo sapiens DDX19B protein protein.       56   2e-07
BC006544-1|AAH06544.1|  478|Homo sapiens DEAD (Asp-Glu-Ala-As) b...    56   2e-07
BC005162-1|AAH05162.1|  478|Homo sapiens DEAD (Asp-Glu-Ala-As) b...    56   2e-07
BC003626-1|AAH03626.1|  479|Homo sapiens DEAD (Asp-Glu-Ala-As) b...    56   2e-07
AK223262-1|BAD96982.1|  478|Homo sapiens DDX19-like protein vari...    56   2e-07
AK223115-1|BAD96835.1|  479|Homo sapiens DEAD (Asp-Glu-Ala-As) b...    56   2e-07
AK001988-1|BAA92022.1|  478|Homo sapiens protein ( Homo sapiens ...    56   2e-07
AJ237946-1|CAB52189.1|  479|Homo sapiens DEAD Box Protein 5 prot...    56   2e-07
AF183422-1|AAG09691.1|  478|Homo sapiens RNA helicase protein.         56   2e-07
AF136175-1|AAP97265.1|  479|Homo sapiens RNA helicase protein.         56   2e-07
CR457215-1|CAG33496.1|  479|Homo sapiens DDX19 protein.                55   2e-07
BC034953-1|AAH34953.1|  824|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    51   4e-06
BC031062-1|AAH31062.1|  824|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    51   4e-06
BC011556-1|AAH11556.1|  824|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    51   4e-06
AL049557-7|CAB55686.2|  824|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    51   4e-06
AK001506-1|BAA91727.1|  824|Homo sapiens protein ( Homo sapiens ...    51   4e-06
AF171063-1|AAF14544.1|  824|Homo sapiens DEAD box RNA helicase G...    51   4e-06
AF155803-1|AAK56799.1|  824|Homo sapiens DEAD-box corepressor DP...    51   4e-06
AF106019-1|AAD42744.1|  824|Homo sapiens DEAD-box protein protein.     51   4e-06
Z37166-1|CAA85523.1|  428|Homo sapiens nuclear RNA helicase (DEA...    51   5e-06
Y14768-15|CAA75074.1|  144|Homo sapiens BAT1 protein.                  51   5e-06
BX248516-15|CAM25884.1|  187|Homo sapiens HLA-B associated trans...    51   5e-06
BX248516-14|CAM25883.1|  136|Homo sapiens HLA-B associated trans...    51   5e-06
BX248516-13|CAM25882.1|   96|Homo sapiens HLA-B associated trans...    51   5e-06
BX248516-12|CAM25881.1|  132|Homo sapiens HLA-B associated trans...    51   5e-06
BX248516-11|CAI41927.2|  125|Homo sapiens HLA-B associated trans...    51   5e-06
BX248516-10|CAI41923.2|  197|Homo sapiens HLA-B associated trans...    51   5e-06
BX248516-9|CAM25880.1|  236|Homo sapiens HLA-B associated transc...    51   5e-06
BX248516-8|CAM25879.1|  238|Homo sapiens HLA-B associated transc...    51   5e-06
BX248516-7|CAM25878.1|  231|Homo sapiens HLA-B associated transc...    51   5e-06
BX248516-6|CAM25877.1|  289|Homo sapiens HLA-B associated transc...    51   5e-06
BX248516-4|CAI41924.2|  425|Homo sapiens HLA-B associated transc...    51   5e-06
BX248516-3|CAI41922.1|  428|Homo sapiens HLA-B associated transc...    51   5e-06
BX001040-10|CAI18638.1|  187|Homo sapiens HLA-B associated trans...    51   5e-06
BX001040-9|CAI18636.1|  177|Homo sapiens HLA-B associated transc...    51   5e-06
BX001040-8|CAI18637.1|  205|Homo sapiens HLA-B associated transc...    51   5e-06
BX001040-7|CAI18635.1|  245|Homo sapiens HLA-B associated transc...    51   5e-06
BX001040-6|CAI18634.1|  428|Homo sapiens HLA-B associated transc...    51   5e-06
BT009909-1|AAP88911.1|  428|Homo sapiens HLA-B associated transc...    51   5e-06
BC032128-1|AAH32128.1|  322|Homo sapiens DDX39 protein protein.        51   5e-06
BC013006-1|AAH13006.1|  428|Homo sapiens HLA-B associated transc...    51   5e-06
BC010455-1|AAH10455.1|  316|Homo sapiens DDX39 protein protein.        51   5e-06
BC001009-1|AAH01009.1|  427|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    51   5e-06
BC000361-1|AAH00361.1|  428|Homo sapiens HLA-B associated transc...    51   5e-06
BA000025-40|BAB63306.1|  428|Homo sapiens putative ATP-dependent...    51   5e-06
AL662847-32|CAO72093.1|  187|Homo sapiens HLA-B associated trans...    51   5e-06
AL662847-31|CAO72092.1|  136|Homo sapiens HLA-B associated trans...    51   5e-06
AL662847-30|CAO72091.1|   96|Homo sapiens HLA-B associated trans...    51   5e-06
AL662847-29|CAI17665.2|  132|Homo sapiens HLA-B associated trans...    51   5e-06
AL662847-28|CAO72090.1|  125|Homo sapiens HLA-B associated trans...    51   5e-06
AL662847-27|CAO72089.1|  197|Homo sapiens HLA-B associated trans...    51   5e-06
AL662847-26|CAI17670.2|  238|Homo sapiens HLA-B associated trans...    51   5e-06
AL662847-25|CAO72088.1|  231|Homo sapiens HLA-B associated trans...    51   5e-06
AL662847-24|CAO72087.1|  236|Homo sapiens HLA-B associated trans...    51   5e-06
AL662847-23|CAO72086.1|  289|Homo sapiens HLA-B associated trans...    51   5e-06
AL662847-21|CAI17672.2|  425|Homo sapiens HLA-B associated trans...    51   5e-06
AL662847-20|CAI17664.2|  428|Homo sapiens HLA-B associated trans...    51   5e-06
AL662801-15|CAM25579.1|  187|Homo sapiens HLA-B associated trans...    51   5e-06
AL662801-14|CAI18286.2|  136|Homo sapiens HLA-B associated trans...    51   5e-06
AL662801-13|CAI18279.2|   96|Homo sapiens HLA-B associated trans...    51   5e-06
AL662801-12|CAM25578.1|  132|Homo sapiens HLA-B associated trans...    51   5e-06
AL662801-11|CAM25577.1|  125|Homo sapiens HLA-B associated trans...    51   5e-06
AL662801-10|CAI18285.2|  197|Homo sapiens HLA-B associated trans...    51   5e-06
AL662801-9|CAI18278.2|  238|Homo sapiens HLA-B associated transc...    51   5e-06
AL662801-8|CAI18281.2|  231|Homo sapiens HLA-B associated transc...    51   5e-06
AL662801-7|CAI18283.2|  236|Homo sapiens HLA-B associated transc...    51   5e-06
AL662801-6|CAI18282.2|  289|Homo sapiens HLA-B associated transc...    51   5e-06
AL662801-4|CAI18284.2|  425|Homo sapiens HLA-B associated transc...    51   5e-06
AL662801-3|CAI18280.1|  428|Homo sapiens HLA-B associated transc...    51   5e-06
AK222912-1|BAD96632.1|  428|Homo sapiens HLA-B associated transc...    51   5e-06
AK026614-1|BAB15509.1|  461|Homo sapiens protein ( Homo sapiens ...    51   5e-06
AB209217-1|BAD92454.1|  310|Homo sapiens HLA-B associated transc...    51   5e-06
AB202112-3|BAE78637.1|  428|Homo sapiens HLA-B associated transc...    51   5e-06
AB103621-3|BAF31287.1|  443|Homo sapiens BAT1 protein protein.         51   5e-06
AB088115-3|BAC54953.1|  428|Homo sapiens HLA-B associated transc...    51   5e-06
D26528-1|BAA05534.1|  439|Homo sapiens RNA helicase protein.           49   1e-05
BC130275-1|AAI30276.1|  796|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    49   1e-05
BC126287-1|AAI26288.1|  796|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    49   1e-05
BC016060-1|AAH16060.2|  767|Homo sapiens DDX27 protein protein.        49   1e-05
BC011927-1|AAH11927.2|  767|Homo sapiens DDX27 protein protein.        49   1e-05
BC009304-1|AAH09304.2|  769|Homo sapiens DDX27 protein protein.        49   1e-05
AY044431-1|AAK95821.1|  796|Homo sapiens RNA helicase-like prote...    49   1e-05
AL357560-1|CAH70236.1|  796|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    49   1e-05
AL049766-1|CAI22427.1|  796|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    49   1e-05
AK022979-1|BAB14343.1|  765|Homo sapiens protein ( Homo sapiens ...    49   1e-05
U90426-1|AAB50231.1|  427|Homo sapiens nuclear RNA helicase prot...    48   3e-05
BC001235-1|AAH01235.1|  547|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    46   2e-04
AK222662-1|BAD96382.1|  547|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    46   2e-04
AK022774-1|BAB14238.1|  547|Homo sapiens protein ( Homo sapiens ...    46   2e-04
AJ131712-1|CAB87992.1|  547|Homo sapiens nucleolar RNA-helicase ...    46   2e-04
AF247666-1|AAG36876.1|  547|Homo sapiens DEAD-box RNA helicase p...    46   2e-04
BC066938-1|AAH66938.1|  648|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    45   3e-04
AJ278110-1|CAB92442.1|  648|Homo sapiens DEAD-box protein protein.     45   3e-04
EF036507-1|ABO65093.1|  182|Homo sapiens DEAD box polypeptide 47...    44   6e-04
BC068009-1|AAH68009.1|  455|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    44   6e-04
BC009379-1|AAH09379.2|  450|Homo sapiens DDX47 protein protein.        44   6e-04
BC005848-1|AAH05848.2|  864|Homo sapiens DDX54 protein protein.        44   6e-04
AY148094-1|AAN59978.1|  865|Homo sapiens DEAD box RNA helicase D...    44   6e-04
AL136666-1|CAB66601.1|  455|Homo sapiens hypothetical protein pr...    44   6e-04
AK222940-1|BAD96660.1|  448|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    44   6e-04
AJ276704-1|CAC14786.1|  455|Homo sapiens DEAD box protein protein.     44   6e-04
AF478457-1|AAL85336.1|  882|Homo sapiens ATP-dependent RNA helic...    44   6e-04
AF193054-1|AAG22482.1|  312|Homo sapiens unknown protein.              44   6e-04
BC041785-1|AAH41785.1|  599|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    44   7e-04
BC002366-1|AAH02366.1|  820|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    44   7e-04
AK093661-1|BAC04214.1|  360|Homo sapiens protein ( Homo sapiens ...    44   7e-04
AK054574-1|BAB70762.1|  455|Homo sapiens protein ( Homo sapiens ...    44   7e-04
AK001652-1|BAA91812.1|  491|Homo sapiens protein ( Homo sapiens ...    44   7e-04
AJ010840-1|CAA09374.1|  420|Homo sapiens ATP-dependent RNA helic...    44   7e-04
AF026402-1|AAB87902.1|  820|Homo sapiens U5 snRNP 100 kD protein...    44   7e-04
AB208938-1|BAD92175.1|  512|Homo sapiens ATP-dependent RNA helic...    44   7e-04
X98743-1|CAA67295.1|  610|Homo sapiens RNA helicase protein.           43   0.001
CR457060-1|CAG33341.1|  610|Homo sapiens DDX18 protein.                43   0.001
BC024739-1|AAH24739.1|  670|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    43   0.001
BC003360-1|AAH03360.1|  670|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    43   0.001
BC001238-1|AAH01238.1|  670|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    43   0.001
AK001467-1|BAA91709.1|  670|Homo sapiens protein ( Homo sapiens ...    43   0.001
AC009404-1|AAX88947.1|  546|Homo sapiens unknown protein.              43   0.001
CR457213-1|CAG33494.1|  547|Homo sapiens DDX56 protein.                42   0.002
BC012304-1|AAH12304.1| 1031|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    42   0.002
AF106680-1|AAD43033.1| 1031|Homo sapiens RNA helicase protein.         42   0.002
AB018344-1|BAA34521.2| 1058|Homo sapiens KIAA0801 protein protein.     42   0.002
BX641072-1|CAE46035.1|  496|Homo sapiens hypothetical protein pr...    41   0.004
BC015476-1|AAH15476.1|  622|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    41   0.004
AK222598-1|BAD96318.1|  622|Homo sapiens DEAD-box protein abstra...    41   0.004
AK027768-1|BAB55355.1|  622|Homo sapiens protein ( Homo sapiens ...    41   0.004
AK001255-1|BAA91585.1|  622|Homo sapiens protein ( Homo sapiens ...    41   0.004
AF195417-1|AAF04150.1|  621|Homo sapiens DEAD-box protein abstra...    41   0.004
BC002674-1|AAH02674.1|  483|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    41   0.005
AK223294-1|BAD97014.1|  483|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    41   0.005
AC002985-2|AAB81544.1|  483|Homo sapiens R27090_2 protein.             41   0.005
AK001294-1|BAA91606.1|  257|Homo sapiens protein ( Homo sapiens ...    40   0.007
AF000985-1|AAC51832.1|  660|Homo sapiens dead box, Y isoform pro...    40   0.007
AF000984-1|AAC51831.1|  660|Homo sapiens dead box, Y isoform pro...    40   0.007
BC088362-1|AAH88362.1|  724|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    40   0.012
BC051703-1|AAH51703.1|  631|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    40   0.012
BC047455-1|AAH47455.1|  690|Homo sapiens DDX4 protein protein.         40   0.012
BC034942-1|AAH34942.1|  660|Homo sapiens DDX3Y protein protein.        40   0.012
AY039237-1|AAK72102.1|  630|Homo sapiens DEAD-box protein CAGE p...    40   0.012
AY004154-1|AAF86585.1|  724|Homo sapiens DEAD box RNA helicase p...    40   0.012
AL137462-1|CAB70750.1|  635|Homo sapiens hypothetical protein pr...    40   0.012
AF262962-1|AAF72705.1|  724|Homo sapiens VASA protein protein.         40   0.012
BC067878-1|AAH67878.1|  631|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    39   0.016
U28042-1|AAC50823.1|  875|Homo sapiens protein ( Human DEAD box ...    39   0.021
BC093656-1|AAH93656.1|  875|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    39   0.021
BC093654-1|AAH93654.1|  875|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    39   0.021
BC091521-1|AAH91521.1|  875|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    39   0.021
BC049217-1|AAH49217.1|  745|Homo sapiens DDX10 protein protein.        39   0.021
AB209884-1|BAD93121.1|  845|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    39   0.021
AB040537-1|BAB18536.1|  875|Homo sapiens RNA helicase protein.         39   0.021
BC041801-1|AAH41801.1|  619|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    38   0.028
BC014183-1|AAH14183.1|  434|Homo sapiens DDX59 protein protein.        38   0.028
AL445483-6|CAI17056.1|  619|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    38   0.028
AL445483-5|CAI17055.1|  580|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    38   0.028
Z97056-3|CAB09792.1|  650|Homo sapiens DEAD (Asp-Glu-Ala-Asp) bo...    38   0.037
U59321-1|AAC50787.1|  650|Homo sapiens DEAD-box protein p72 prot...    38   0.037
U50553-1|AAB95637.1|  662|Homo sapiens helicase like protein 2 p...    38   0.037
CR456432-1|CAG30318.1|  652|Homo sapiens DDX17 protein.                38   0.037
BC011819-1|AAH11819.1|  662|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    38   0.037
BC000595-1|AAH00595.2|  729|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    38   0.037
AL391647-2|CAI41416.1|  662|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    38   0.037
AF061337-1|AAC34298.1|  662|Homo sapiens DEAD box RNA helicase D...    38   0.037
AF000983-1|AAC51830.1|  662|Homo sapiens dead box, X isoform pro...    38   0.037
AF000982-1|AAC51829.1|  662|Homo sapiens dead box, X isoform pro...    38   0.037
AB209595-1|BAD92832.1|  737|Homo sapiens DEAD box polypeptide 17...    38   0.037
AB208983-1|BAD92220.1|  674|Homo sapiens DEAD/H (Asp-Glu-Ala-Asp...    38   0.037
AF336851-1|AAK21271.1|  561|Homo sapiens RNA helicase-like prote...    38   0.048
CR533509-1|CAG38540.1|  448|Homo sapiens DDX19 protein.                37   0.064
BC010008-1|AAH10008.1|  370|Homo sapiens DEAD (Asp-Glu-Ala-As) b...    37   0.064
AK097078-1|BAC04942.1|  666|Homo sapiens protein ( Homo sapiens ...    37   0.064
AF353720-1|AAK40102.1|  370|Homo sapiens testicular DEAD-box hel...    37   0.064
BC000272-1|AAH00272.1|  737|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    36   0.11 
AL359844-2|CAH72376.1|  737|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    36   0.11 
AK223297-1|BAD97017.1|  363|Homo sapiens nucleolar protein GU2 v...    36   0.11 
AK056044-1|BAB71082.1|  189|Homo sapiens protein ( Homo sapiens ...    36   0.11 
AF334103-1|AAK29402.1|  737|Homo sapiens nucleolar protein GU2 p...    36   0.11 
X52104-1|CAA36324.1|  614|Homo sapiens protein ( Human mRNA for ...    36   0.15 
X15729-1|CAA33751.1|  614|Homo sapiens protein ( Human mRNA for ...    36   0.15 
BX571764-1|CAE11890.1|  406|Homo sapiens hypothetical protein pr...    36   0.15 
BT006943-1|AAP35589.1|  614|Homo sapiens DEAD/H (Asp-Glu-Ala-Asp...    36   0.15 
BC016027-1|AAH16027.1|  614|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    36   0.15 
AF015812-1|AAB84094.1|  614|Homo sapiens RNA helicase p68 protein.     36   0.15 
AB209919-1|BAD93156.1|  457|Homo sapiens Hypothetical protein DK...    36   0.15 
AK131260-1|BAD18438.1|  528|Homo sapiens protein ( Homo sapiens ...    36   0.20 
BC050360-1|AAH50360.2|  369|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    35   0.26 
BC040185-1|AAH40185.1|  666|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    35   0.26 
BC035388-1|AAH35388.2|  369|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    35   0.26 
AJ010931-1|CAA09408.1|  111|Homo sapiens p68 RNA helicase protein.     35   0.34 
U41387-1|AAB02546.1|  801|Homo sapiens Gu protein protein.             34   0.45 
BC030020-1|AAH30020.1|  600|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    34   0.45 
BC008071-1|AAH08071.2|  783|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    34   0.45 
AL359844-3|CAH72377.1|  783|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    34   0.45 
AK074219-1|BAB85021.1|  353|Homo sapiens protein ( Homo sapiens ...    34   0.45 
BC093081-1|AAH93081.1|  938|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    33   1.0  
BC078667-1|AAH78667.1|  919|Homo sapiens DDX42 protein protein.        33   1.0  
BC015505-1|AAH15505.1|  819|Homo sapiens DDX42 protein protein.        33   1.0  
AF083255-1|AAC32396.1|  709|Homo sapiens RNA helicase-related pr...    33   1.0  
AB036090-1|BAC66466.1|  938|Homo sapiens RNA helicase-related pr...    33   1.0  
BC024273-1|AAH24273.1|  540|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    33   1.4  
AK002144-1|BAA92106.1|  540|Homo sapiens protein ( Homo sapiens ...    33   1.4  
AF329821-1|AAG59833.1|  540|Homo sapiens putative DEAD-box helic...    33   1.4  
AF261917-1|AAF78930.2|  715|Homo sapiens RNA helicase II/Gu prot...    33   1.4  
EF523384-1|ABP57734.1| 1075|Homo sapiens POTE-2 alpha-actin prot...    32   1.8  
BC096826-1|AAH96826.1|  804|Homo sapiens DDX24 protein protein.        32   1.8  
BC009406-1|AAH09406.1|  859|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    32   1.8  
BC008847-1|AAH08847.1|  859|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    32   1.8  
AY465172-1|AAS58871.1|  486|Homo sapiens POTE14C protein.              32   1.8  
AY462873-1|AAS58867.1|  376|Homo sapiens POTE2C protein.               32   1.8  
AY462872-1|AAS58866.1|  394|Homo sapiens POTE2B protein.               32   1.8  
AY462871-1|AAS58865.1|  712|Homo sapiens POTE2A protein.               32   1.8  
AY462868-1|AAS58862.1|  376|Homo sapiens POTE2D protein.               32   1.8  
AK025162-1|BAB15079.1|  859|Homo sapiens protein ( Homo sapiens ...    32   1.8  
AF214731-1|AAG02169.1|  859|Homo sapiens ATP-dependent RNA helic...    32   1.8  
AB209382-1|BAD92619.1|  676|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    32   1.8  
BC067092-1|AAH67092.1|  237|Homo sapiens IGKC protein protein.         31   5.6  
X70649-1|CAA49992.1|  740|Homo sapiens member of DEAD box protei...    30   7.3  
EF418571-1|ABN70941.1|  740|Homo sapiens DEAD box polypeptide 1 ...    30   7.3  
EF418570-1|ABN70940.1|  740|Homo sapiens DEAD box polypeptide 1 ...    30   7.3  
BC053673-1|AAH53673.1|  740|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    30   7.3  
BC012132-1|AAH12132.1|  740|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    30   7.3  
AF145022-1|AAP97274.1|  454|Homo sapiens ATP-dependent RNA helic...    30   7.3  
AF134475-1|AAP97252.1|  486|Homo sapiens ATP-dependent RNA helic...    30   7.3  
BC012726-1|AAH12726.2|  777|Homo sapiens DDX31 protein protein.        30   9.7  
AL354735-2|CAI16565.1|  775|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    30   9.7  
AL354735-1|CAI16564.1|  851|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    30   9.7  
AL160165-3|CAH70532.1|  775|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    30   9.7  
AL160165-2|CAH70531.1|  851|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    30   9.7  
AL160165-1|CAH70530.1|  585|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    30   9.7  
AK027484-1|BAB55146.1|  585|Homo sapiens protein ( Homo sapiens ...    30   9.7  
AK027002-1|BAB15620.1|  674|Homo sapiens protein ( Homo sapiens ...    30   9.7  
AF427339-1|AAL26549.1|  851|Homo sapiens DEAD/DEXH helicase DDX3...    30   9.7  
AF335569-1|AAQ14890.1|  758|Homo sapiens helicain C protein.           30   9.7  
AF335568-1|AAQ14889.1|  851|Homo sapiens helicain B protein.           30   9.7  
AF335567-1|AAQ14888.1|  319|Homo sapiens helicain A protein.           30   9.7  

>D30655-1|BAA06336.1|  407|Homo sapiens eukaryotic initiation factor
           4AII protein.
          Length = 407

 Score =  109 bits (262), Expect = 1e-23
 Identities = 48/62 (77%), Positives = 57/62 (91%)
 Frame = +3

Query: 72  GHLHTDWDQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGT 251
           G + ++W+++V+ FDDMNLKE LLRGIYAYGFEKPSAIQQRAI+PCI+G DVIAQAQSGT
Sbjct: 22  GVIESNWNEIVDNFDDMNLKESLLRGIYAYGFEKPSAIQQRAIIPCIKGYDVIAQAQSGT 81

Query: 252 GK 257
           GK
Sbjct: 82  GK 83



 Score =  107 bits (256), Expect = 5e-23
 Identities = 64/151 (42%), Positives = 92/151 (60%), Gaps = 5/151 (3%)
 Frame = +2

Query: 17  NGPSKDQG-SYDGPPGMDPGTLAHRLGSSCRNLR*HEPQRRIVERHIRLWF*KTFCNP-A 190
           +G S D    + GP GMDP  +   + S+   +  +     + E  +R  +   F  P A
Sbjct: 2   SGGSADYNREHGGPEGMDPDGV---IESNWNEIVDNFDDMNLKESLLRGIYAYGFEKPSA 58

Query: 191 TRNNALHPRTRCY---RSSPVRNWKTATFSISILQQIDTSIRECQALILAPTRELAQQIQ 361
            +  A+ P  + Y     +     KTATF+ISILQQ++   +E QAL+LAPTRELAQQIQ
Sbjct: 59  IQQRAIIPCIKGYDVIAQAQSGTGKTATFAISILQQLEIEFKETQALVLAPTRELAQQIQ 118

Query: 362 KVVIALGDHLNAKCHACIGGTNVREDIRQLE 454
           KV++ALGD++ A CHACIGGTNVR ++++L+
Sbjct: 119 KVILALGDYMGATCHACIGGTNVRNEMQKLQ 149



 Score = 31.1 bits (67), Expect = 4.2
 Identities = 15/27 (55%), Positives = 18/27 (66%)
 Frame = +1

Query: 487 GRVYDMIIVVRFHANTIKLFVLDEADE 567
           GRV+DM+         IK+FVLDEADE
Sbjct: 161 GRVFDMLNRRYLSPKWIKMFVLDEADE 187


>BT009860-1|AAP88862.1|  407|Homo sapiens eukaryotic translation
           initiation factor 4A, isoform 2 protein.
          Length = 407

 Score =  109 bits (262), Expect = 1e-23
 Identities = 48/62 (77%), Positives = 57/62 (91%)
 Frame = +3

Query: 72  GHLHTDWDQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGT 251
           G + ++W+++V+ FDDMNLKE LLRGIYAYGFEKPSAIQQRAI+PCI+G DVIAQAQSGT
Sbjct: 22  GVIESNWNEIVDNFDDMNLKESLLRGIYAYGFEKPSAIQQRAIIPCIKGYDVIAQAQSGT 81

Query: 252 GK 257
           GK
Sbjct: 82  GK 83



 Score =  107 bits (256), Expect = 5e-23
 Identities = 64/151 (42%), Positives = 92/151 (60%), Gaps = 5/151 (3%)
 Frame = +2

Query: 17  NGPSKDQG-SYDGPPGMDPGTLAHRLGSSCRNLR*HEPQRRIVERHIRLWF*KTFCNP-A 190
           +G S D    + GP GMDP  +   + S+   +  +     + E  +R  +   F  P A
Sbjct: 2   SGGSADYNREHGGPEGMDPDGV---IESNWNEIVDNFDDMNLKESLLRGIYAYGFEKPSA 58

Query: 191 TRNNALHPRTRCY---RSSPVRNWKTATFSISILQQIDTSIRECQALILAPTRELAQQIQ 361
            +  A+ P  + Y     +     KTATF+ISILQQ++   +E QAL+LAPTRELAQQIQ
Sbjct: 59  IQQRAIIPCIKGYDVIAQAQSGTGKTATFAISILQQLEIEFKETQALVLAPTRELAQQIQ 118

Query: 362 KVVIALGDHLNAKCHACIGGTNVREDIRQLE 454
           KV++ALGD++ A CHACIGGTNVR ++++L+
Sbjct: 119 KVILALGDYMGATCHACIGGTNVRNEMQKLQ 149



 Score = 31.1 bits (67), Expect = 4.2
 Identities = 15/27 (55%), Positives = 18/27 (66%)
 Frame = +1

Query: 487 GRVYDMIIVVRFHANTIKLFVLDEADE 567
           GRV+DM+         IK+FVLDEADE
Sbjct: 161 GRVFDMLNRRYLSPKWIKMFVLDEADE 187


>BC048105-1|AAH48105.1|  408|Homo sapiens eukaryotic translation
           initiation factor 4A, isoform 2 protein.
          Length = 408

 Score =  109 bits (262), Expect = 1e-23
 Identities = 48/62 (77%), Positives = 57/62 (91%)
 Frame = +3

Query: 72  GHLHTDWDQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGT 251
           G + ++W+++V+ FDDMNLKE LLRGIYAYGFEKPSAIQQRAI+PCI+G DVIAQAQSGT
Sbjct: 23  GVIESNWNEIVDNFDDMNLKESLLRGIYAYGFEKPSAIQQRAIIPCIKGYDVIAQAQSGT 82

Query: 252 GK 257
           GK
Sbjct: 83  GK 84



 Score =  107 bits (258), Expect = 3e-23
 Identities = 65/152 (42%), Positives = 93/152 (61%), Gaps = 6/152 (3%)
 Frame = +2

Query: 17  NGPSKDQGS--YDGPPGMDPGTLAHRLGSSCRNLR*HEPQRRIVERHIRLWF*KTFCNP- 187
           +G S D  S  + GP GMDP  +   + S+   +  +     + E  +R  +   F  P 
Sbjct: 2   SGGSADYNSREHGGPEGMDPDGV---IESNWNEIVDNFDDMNLKESLLRGIYAYGFEKPS 58

Query: 188 ATRNNALHPRTRCY---RSSPVRNWKTATFSISILQQIDTSIRECQALILAPTRELAQQI 358
           A +  A+ P  + Y     +     KTATF+ISILQQ++   +E QAL+LAPTRELAQQI
Sbjct: 59  AIQQRAIIPCIKGYDVIAQAQSGTGKTATFAISILQQLEIEFKETQALVLAPTRELAQQI 118

Query: 359 QKVVIALGDHLNAKCHACIGGTNVREDIRQLE 454
           QKV++ALGD++ A CHACIGGTNVR ++++L+
Sbjct: 119 QKVILALGDYMGATCHACIGGTNVRNEMQKLQ 150



 Score = 31.1 bits (67), Expect = 4.2
 Identities = 15/27 (55%), Positives = 18/27 (66%)
 Frame = +1

Query: 487 GRVYDMIIVVRFHANTIKLFVLDEADE 567
           GRV+DM+         IK+FVLDEADE
Sbjct: 162 GRVFDMLNRRYLSPKWIKMFVLDEADE 188


>BC013708-1|AAH13708.1|  407|Homo sapiens eukaryotic translation
           initiation factor 4A, isoform 2 protein.
          Length = 407

 Score =  109 bits (262), Expect = 1e-23
 Identities = 48/62 (77%), Positives = 57/62 (91%)
 Frame = +3

Query: 72  GHLHTDWDQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGT 251
           G + ++W+++V+ FDDMNLKE LLRGIYAYGFEKPSAIQQRAI+PCI+G DVIAQAQSGT
Sbjct: 22  GVIESNWNEIVDNFDDMNLKESLLRGIYAYGFEKPSAIQQRAIIPCIKGYDVIAQAQSGT 81

Query: 252 GK 257
           GK
Sbjct: 82  GK 83



 Score =  107 bits (256), Expect = 5e-23
 Identities = 64/151 (42%), Positives = 92/151 (60%), Gaps = 5/151 (3%)
 Frame = +2

Query: 17  NGPSKDQG-SYDGPPGMDPGTLAHRLGSSCRNLR*HEPQRRIVERHIRLWF*KTFCNP-A 190
           +G S D    + GP GMDP  +   + S+   +  +     + E  +R  +   F  P A
Sbjct: 2   SGGSADYNREHGGPEGMDPDGV---IESNWNEIVDNFDDMNLKESLLRGIYAYGFEKPSA 58

Query: 191 TRNNALHPRTRCY---RSSPVRNWKTATFSISILQQIDTSIRECQALILAPTRELAQQIQ 361
            +  A+ P  + Y     +     KTATF+ISILQQ++   +E QAL+LAPTRELAQQIQ
Sbjct: 59  IQQRAIIPCIKGYDVIAQAQSGTGKTATFAISILQQLEIEFKETQALVLAPTRELAQQIQ 118

Query: 362 KVVIALGDHLNAKCHACIGGTNVREDIRQLE 454
           KV++ALGD++ A CHACIGGTNVR ++++L+
Sbjct: 119 KVILALGDYMGATCHACIGGTNVRNEMQKLQ 149



 Score = 31.1 bits (67), Expect = 4.2
 Identities = 15/27 (55%), Positives = 18/27 (66%)
 Frame = +1

Query: 487 GRVYDMIIVVRFHANTIKLFVLDEADE 567
           GRV+DM+         IK+FVLDEADE
Sbjct: 161 GRVFDMLNRRYLSPKWIKMFVLDEADE 187


>BC012547-1|AAH12547.1|  408|Homo sapiens eukaryotic translation
           initiation factor 4A, isoform 2 protein.
          Length = 408

 Score =  109 bits (262), Expect = 1e-23
 Identities = 48/62 (77%), Positives = 57/62 (91%)
 Frame = +3

Query: 72  GHLHTDWDQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGT 251
           G + ++W+++V+ FDDMNLKE LLRGIYAYGFEKPSAIQQRAI+PCI+G DVIAQAQSGT
Sbjct: 23  GVIESNWNEIVDNFDDMNLKESLLRGIYAYGFEKPSAIQQRAIIPCIKGYDVIAQAQSGT 82

Query: 252 GK 257
           GK
Sbjct: 83  GK 84



 Score =  107 bits (258), Expect = 3e-23
 Identities = 65/152 (42%), Positives = 93/152 (61%), Gaps = 6/152 (3%)
 Frame = +2

Query: 17  NGPSKDQGS--YDGPPGMDPGTLAHRLGSSCRNLR*HEPQRRIVERHIRLWF*KTFCNP- 187
           +G S D  S  + GP GMDP  +   + S+   +  +     + E  +R  +   F  P 
Sbjct: 2   SGGSADYNSREHGGPEGMDPDGV---IESNWNEIVDNFDDMNLKESLLRGIYAYGFEKPS 58

Query: 188 ATRNNALHPRTRCY---RSSPVRNWKTATFSISILQQIDTSIRECQALILAPTRELAQQI 358
           A +  A+ P  + Y     +     KTATF+ISILQQ++   +E QAL+LAPTRELAQQI
Sbjct: 59  AIQQRAIIPCIKGYDVIAQAQSGTGKTATFAISILQQLEIEFKETQALVLAPTRELAQQI 118

Query: 359 QKVVIALGDHLNAKCHACIGGTNVREDIRQLE 454
           QKV++ALGD++ A CHACIGGTNVR ++++L+
Sbjct: 119 QKVILALGDYMGATCHACIGGTNVRNEMQKLQ 150



 Score = 31.1 bits (67), Expect = 4.2
 Identities = 15/27 (55%), Positives = 18/27 (66%)
 Frame = +1

Query: 487 GRVYDMIIVVRFHANTIKLFVLDEADE 567
           GRV+DM+         IK+FVLDEADE
Sbjct: 162 GRVFDMLNRRYLSPKWIKMFVLDEADE 188


>BC015842-1|AAH15842.1|  407|Homo sapiens eukaryotic translation
           initiation factor 4A, isoform 2 protein.
          Length = 407

 Score =  109 bits (261), Expect = 1e-23
 Identities = 48/62 (77%), Positives = 56/62 (90%)
 Frame = +3

Query: 72  GHLHTDWDQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGT 251
           G + + W+++V+ FDDMNLKE LLRGIYAYGFEKPSAIQQRAI+PCI+G DVIAQAQSGT
Sbjct: 22  GVIESSWNEIVDNFDDMNLKESLLRGIYAYGFEKPSAIQQRAIIPCIKGYDVIAQAQSGT 81

Query: 252 GK 257
           GK
Sbjct: 82  GK 83



 Score =  108 bits (259), Expect = 2e-23
 Identities = 65/151 (43%), Positives = 92/151 (60%), Gaps = 5/151 (3%)
 Frame = +2

Query: 17  NGPSKDQG-SYDGPPGMDPGTLAHRLGSSCRNLR*HEPQRRIVERHIRLWF*KTFCNP-A 190
           +G S D    + GP GMDP  +   + SS   +  +     + E  +R  +   F  P A
Sbjct: 2   SGGSADYNREHGGPEGMDPDGV---IESSWNEIVDNFDDMNLKESLLRGIYAYGFEKPSA 58

Query: 191 TRNNALHPRTRCY---RSSPVRNWKTATFSISILQQIDTSIRECQALILAPTRELAQQIQ 361
            +  A+ P  + Y     +     KTATF+ISILQQ++   +E QAL+LAPTRELAQQIQ
Sbjct: 59  IQQRAIIPCIKGYDVIAQAQSGTGKTATFAISILQQLEIEFKETQALVLAPTRELAQQIQ 118

Query: 362 KVVIALGDHLNAKCHACIGGTNVREDIRQLE 454
           KV++ALGD++ A CHACIGGTNVR ++++L+
Sbjct: 119 KVILALGDYMGATCHACIGGTNVRNEMQKLQ 149



 Score = 31.1 bits (67), Expect = 4.2
 Identities = 15/27 (55%), Positives = 18/27 (66%)
 Frame = +1

Query: 487 GRVYDMIIVVRFHANTIKLFVLDEADE 567
           GRV+DM+         IK+FVLDEADE
Sbjct: 161 GRVFDMLNRRYLSPKWIKMFVLDEADE 187


>D13748-1|BAA02897.1|  406|Homo sapiens eukaryotic initiation factor
           4AI protein.
          Length = 406

 Score =  108 bits (259), Expect = 2e-23
 Identities = 47/62 (75%), Positives = 57/62 (91%)
 Frame = +3

Query: 72  GHLHTDWDQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGT 251
           G + ++W+++V++FDDMNL E LLRGIYAYGFEKPSAIQQRAI+PCI+G DVIAQAQSGT
Sbjct: 21  GVIESNWNEIVDSFDDMNLSESLLRGIYAYGFEKPSAIQQRAILPCIKGYDVIAQAQSGT 80

Query: 252 GK 257
           GK
Sbjct: 81  GK 82



 Score =  105 bits (252), Expect = 2e-22
 Identities = 47/67 (70%), Positives = 60/67 (89%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVR 433
           KTATF+ISILQQI+  ++  QAL+LAPTRELAQQIQKVV+ALGD++ A CHACIGGTNVR
Sbjct: 82  KTATFAISILQQIELDLKATQALVLAPTRELAQQIQKVVMALGDYMGASCHACIGGTNVR 141

Query: 434 EDIRQLE 454
            ++++L+
Sbjct: 142 AEVQKLQ 148



 Score = 31.1 bits (67), Expect = 4.2
 Identities = 15/27 (55%), Positives = 18/27 (66%)
 Frame = +1

Query: 487 GRVYDMIIVVRFHANTIKLFVLDEADE 567
           GRV+DM+         IK+FVLDEADE
Sbjct: 160 GRVFDMLNRRYLSPKYIKMFVLDEADE 186


>BT019881-1|AAV38684.1|  406|Homo sapiens eukaryotic translation
           initiation factor 4A, isoform 1 protein.
          Length = 406

 Score =  108 bits (259), Expect = 2e-23
 Identities = 47/62 (75%), Positives = 57/62 (91%)
 Frame = +3

Query: 72  GHLHTDWDQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGT 251
           G + ++W+++V++FDDMNL E LLRGIYAYGFEKPSAIQQRAI+PCI+G DVIAQAQSGT
Sbjct: 21  GVIESNWNEIVDSFDDMNLSESLLRGIYAYGFEKPSAIQQRAILPCIKGYDVIAQAQSGT 80

Query: 252 GK 257
           GK
Sbjct: 81  GK 82



 Score =  105 bits (252), Expect = 2e-22
 Identities = 47/67 (70%), Positives = 60/67 (89%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVR 433
           KTATF+ISILQQI+  ++  QAL+LAPTRELAQQIQKVV+ALGD++ A CHACIGGTNVR
Sbjct: 82  KTATFAISILQQIELDLKATQALVLAPTRELAQQIQKVVMALGDYMGASCHACIGGTNVR 141

Query: 434 EDIRQLE 454
            ++++L+
Sbjct: 142 AEVQKLQ 148



 Score = 31.1 bits (67), Expect = 4.2
 Identities = 15/27 (55%), Positives = 18/27 (66%)
 Frame = +1

Query: 487 GRVYDMIIVVRFHANTIKLFVLDEADE 567
           GRV+DM+         IK+FVLDEADE
Sbjct: 160 GRVFDMLNRRYLSPKYIKMFVLDEADE 186


>BT019880-1|AAV38683.1|  406|Homo sapiens eukaryotic translation
           initiation factor 4A, isoform 1 protein.
          Length = 406

 Score =  108 bits (259), Expect = 2e-23
 Identities = 47/62 (75%), Positives = 57/62 (91%)
 Frame = +3

Query: 72  GHLHTDWDQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGT 251
           G + ++W+++V++FDDMNL E LLRGIYAYGFEKPSAIQQRAI+PCI+G DVIAQAQSGT
Sbjct: 21  GVIESNWNEIVDSFDDMNLSESLLRGIYAYGFEKPSAIQQRAILPCIKGYDVIAQAQSGT 80

Query: 252 GK 257
           GK
Sbjct: 81  GK 82



 Score =  105 bits (252), Expect = 2e-22
 Identities = 47/67 (70%), Positives = 60/67 (89%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVR 433
           KTATF+ISILQQI+  ++  QAL+LAPTRELAQQIQKVV+ALGD++ A CHACIGGTNVR
Sbjct: 82  KTATFAISILQQIELDLKATQALVLAPTRELAQQIQKVVMALGDYMGASCHACIGGTNVR 141

Query: 434 EDIRQLE 454
            ++++L+
Sbjct: 142 AEVQKLQ 148



 Score = 31.1 bits (67), Expect = 4.2
 Identities = 15/27 (55%), Positives = 18/27 (66%)
 Frame = +1

Query: 487 GRVYDMIIVVRFHANTIKLFVLDEADE 567
           GRV+DM+         IK+FVLDEADE
Sbjct: 160 GRVFDMLNRRYLSPKYIKMFVLDEADE 186


>BC073752-1|AAH73752.1|  406|Homo sapiens eukaryotic translation
           initiation factor 4A, isoform 1 protein.
          Length = 406

 Score =  108 bits (259), Expect = 2e-23
 Identities = 47/62 (75%), Positives = 57/62 (91%)
 Frame = +3

Query: 72  GHLHTDWDQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGT 251
           G + ++W+++V++FDDMNL E LLRGIYAYGFEKPSAIQQRAI+PCI+G DVIAQAQSGT
Sbjct: 21  GVIESNWNEIVDSFDDMNLSESLLRGIYAYGFEKPSAIQQRAILPCIKGYDVIAQAQSGT 80

Query: 252 GK 257
           GK
Sbjct: 81  GK 82



 Score =  105 bits (252), Expect = 2e-22
 Identities = 47/67 (70%), Positives = 60/67 (89%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVR 433
           KTATF+ISILQQI+  ++  QAL+LAPTRELAQQIQKVV+ALGD++ A CHACIGGTNVR
Sbjct: 82  KTATFAISILQQIELDLKATQALVLAPTRELAQQIQKVVMALGDYMGASCHACIGGTNVR 141

Query: 434 EDIRQLE 454
            ++++L+
Sbjct: 142 AEVQKLQ 148



 Score = 31.1 bits (67), Expect = 4.2
 Identities = 15/27 (55%), Positives = 18/27 (66%)
 Frame = +1

Query: 487 GRVYDMIIVVRFHANTIKLFVLDEADE 567
           GRV+DM+         IK+FVLDEADE
Sbjct: 160 GRVFDMLNRRYLSPKYIKMFVLDEADE 186


>BC009585-1|AAH09585.1|  406|Homo sapiens eukaryotic translation
           initiation factor 4A, isoform 1 protein.
          Length = 406

 Score =  108 bits (259), Expect = 2e-23
 Identities = 47/62 (75%), Positives = 57/62 (91%)
 Frame = +3

Query: 72  GHLHTDWDQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGT 251
           G + ++W+++V++FDDMNL E LLRGIYAYGFEKPSAIQQRAI+PCI+G DVIAQAQSGT
Sbjct: 21  GVIESNWNEIVDSFDDMNLSESLLRGIYAYGFEKPSAIQQRAILPCIKGYDVIAQAQSGT 80

Query: 252 GK 257
           GK
Sbjct: 81  GK 82



 Score =  105 bits (252), Expect = 2e-22
 Identities = 47/67 (70%), Positives = 60/67 (89%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVR 433
           KTATF+ISILQQI+  ++  QAL+LAPTRELAQQIQKVV+ALGD++ A CHACIGGTNVR
Sbjct: 82  KTATFAISILQQIELDLKATQALVLAPTRELAQQIQKVVMALGDYMGASCHACIGGTNVR 141

Query: 434 EDIRQLE 454
            ++++L+
Sbjct: 142 AEVQKLQ 148



 Score = 31.1 bits (67), Expect = 4.2
 Identities = 15/27 (55%), Positives = 18/27 (66%)
 Frame = +1

Query: 487 GRVYDMIIVVRFHANTIKLFVLDEADE 567
           GRV+DM+         IK+FVLDEADE
Sbjct: 160 GRVFDMLNRRYLSPKYIKMFVLDEADE 186


>AB209593-1|BAD92830.1|  375|Homo sapiens CD68 antigen variant
           protein.
          Length = 375

 Score =  108 bits (259), Expect = 2e-23
 Identities = 47/62 (75%), Positives = 57/62 (91%)
 Frame = +3

Query: 72  GHLHTDWDQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGT 251
           G + ++W+++V++FDDMNL E LLRGIYAYGFEKPSAIQQRAI+PCI+G DVIAQAQSGT
Sbjct: 19  GVIESNWNEIVDSFDDMNLSESLLRGIYAYGFEKPSAIQQRAILPCIKGYDVIAQAQSGT 78

Query: 252 GK 257
           GK
Sbjct: 79  GK 80



 Score =  105 bits (252), Expect = 2e-22
 Identities = 47/67 (70%), Positives = 60/67 (89%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVR 433
           KTATF+ISILQQI+  ++  QAL+LAPTRELAQQIQKVV+ALGD++ A CHACIGGTNVR
Sbjct: 80  KTATFAISILQQIELDLKATQALVLAPTRELAQQIQKVVMALGDYMGASCHACIGGTNVR 139

Query: 434 EDIRQLE 454
            ++++L+
Sbjct: 140 AEVQKLQ 146



 Score = 31.1 bits (67), Expect = 4.2
 Identities = 15/27 (55%), Positives = 18/27 (66%)
 Frame = +1

Query: 487 GRVYDMIIVVRFHANTIKLFVLDEADE 567
           GRV+DM+         IK+FVLDEADE
Sbjct: 158 GRVFDMLNRRYLSPKYIKMFVLDEADE 184


>AY207392-1|AAO66460.1|  101|Homo sapiens eukaryotic translation
           initiation factor 4A isoform 2-like protein protein.
          Length = 101

 Score =  106 bits (255), Expect = 7e-23
 Identities = 47/62 (75%), Positives = 56/62 (90%)
 Frame = +3

Query: 72  GHLHTDWDQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGT 251
           G + ++W+++V+ FDDMNLKE L RGIYAYGFEKPSAIQQRAI+PCI+G DVIAQAQSGT
Sbjct: 12  GVIESNWNEIVDNFDDMNLKESLPRGIYAYGFEKPSAIQQRAIIPCIKGYDVIAQAQSGT 71

Query: 252 GK 257
           GK
Sbjct: 72  GK 73



 Score = 41.5 bits (93), Expect = 0.003
 Identities = 18/28 (64%), Positives = 24/28 (85%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPT 337
           KTATF+ISILQQ++   +E QAL+LAP+
Sbjct: 73  KTATFAISILQQLEIEFKETQALVLAPS 100


>X79538-1|CAA56074.1|  411|Homo sapiens translation initiation
           factor protein.
          Length = 411

 Score =  106 bits (254), Expect = 9e-23
 Identities = 49/67 (73%), Positives = 59/67 (88%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVR 433
           KTATFSIS+LQ +D  +RE QALILAPTRELA QIQK ++ALGD++N +CHACIGGTNV 
Sbjct: 88  KTATFSISVLQCLDIQVRETQALILAPTRELAVQIQKGLLALGDYMNVQCHACIGGTNVG 147

Query: 434 EDIRQLE 454
           EDIR+L+
Sbjct: 148 EDIRKLD 154



 Score = 88.6 bits (210), Expect = 2e-17
 Identities = 42/53 (79%), Positives = 46/53 (86%)
 Frame = +3

Query: 99  VVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           V  TFD M L+E+LLRGIYAYGFEKPSAIQQRAI   I+GRDVIAQ+QSGTGK
Sbjct: 36  VTPTFDTMGLREDLLRGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGK 88



 Score = 31.5 bits (68), Expect = 3.2
 Identities = 15/27 (55%), Positives = 17/27 (62%)
 Frame = +1

Query: 487 GRVYDMIIVVRFHANTIKLFVLDEADE 567
           GRV+DMI         IK+ VLDEADE
Sbjct: 165 GRVFDMIRRRSLRTRAIKMLVLDEADE 191


>D21853-1|BAA04879.2|  412|Homo sapiens KIAA0111 protein.
          Length = 412

 Score =  106 bits (254), Expect = 9e-23
 Identities = 49/67 (73%), Positives = 59/67 (88%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVR 433
           KTATFSIS+LQ +D  +RE QALILAPTRELA QIQK ++ALGD++N +CHACIGGTNV 
Sbjct: 89  KTATFSISVLQCLDIQVRETQALILAPTRELAVQIQKGLLALGDYMNVQCHACIGGTNVG 148

Query: 434 EDIRQLE 454
           EDIR+L+
Sbjct: 149 EDIRKLD 155



 Score = 88.6 bits (210), Expect = 2e-17
 Identities = 42/53 (79%), Positives = 46/53 (86%)
 Frame = +3

Query: 99  VVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           V  TFD M L+E+LLRGIYAYGFEKPSAIQQRAI   I+GRDVIAQ+QSGTGK
Sbjct: 37  VTPTFDTMGLREDLLRGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGK 89



 Score = 31.5 bits (68), Expect = 3.2
 Identities = 15/27 (55%), Positives = 17/27 (62%)
 Frame = +1

Query: 487 GRVYDMIIVVRFHANTIKLFVLDEADE 567
           GRV+DMI         IK+ VLDEADE
Sbjct: 166 GRVFDMIRRRSLRTRAIKMLVLDEADE 192


>CR456750-1|CAG33031.1|  411|Homo sapiens DDX48 protein.
          Length = 411

 Score =  106 bits (254), Expect = 9e-23
 Identities = 49/67 (73%), Positives = 59/67 (88%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVR 433
           KTATFSIS+LQ +D  +RE QALILAPTRELA QIQK ++ALGD++N +CHACIGGTNV 
Sbjct: 88  KTATFSISVLQCLDIQVRETQALILAPTRELAVQIQKGLLALGDYMNVQCHACIGGTNVG 147

Query: 434 EDIRQLE 454
           EDIR+L+
Sbjct: 148 EDIRKLD 154



 Score = 88.6 bits (210), Expect = 2e-17
 Identities = 42/53 (79%), Positives = 46/53 (86%)
 Frame = +3

Query: 99  VVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           V  TFD M L+E+LLRGIYAYGFEKPSAIQQRAI   I+GRDVIAQ+QSGTGK
Sbjct: 36  VTPTFDTMGLREDLLRGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGK 88



 Score = 31.5 bits (68), Expect = 3.2
 Identities = 15/27 (55%), Positives = 17/27 (62%)
 Frame = +1

Query: 487 GRVYDMIIVVRFHANTIKLFVLDEADE 567
           GRV+DMI         IK+ VLDEADE
Sbjct: 165 GRVFDMIRRRSLRTRAIKMLVLDEADE 191


>BC011151-1|AAH11151.1|  411|Homo sapiens eukaryotic translation
           initiation factor 4A, isoform 3 protein.
          Length = 411

 Score =  106 bits (254), Expect = 9e-23
 Identities = 49/67 (73%), Positives = 59/67 (88%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVR 433
           KTATFSIS+LQ +D  +RE QALILAPTRELA QIQK ++ALGD++N +CHACIGGTNV 
Sbjct: 88  KTATFSISVLQCLDIQVRETQALILAPTRELAVQIQKGLLALGDYMNVQCHACIGGTNVG 147

Query: 434 EDIRQLE 454
           EDIR+L+
Sbjct: 148 EDIRKLD 154



 Score = 88.6 bits (210), Expect = 2e-17
 Identities = 42/53 (79%), Positives = 46/53 (86%)
 Frame = +3

Query: 99  VVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           V  TFD M L+E+LLRGIYAYGFEKPSAIQQRAI   I+GRDVIAQ+QSGTGK
Sbjct: 36  VTPTFDTMGLREDLLRGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGK 88



 Score = 31.5 bits (68), Expect = 3.2
 Identities = 15/27 (55%), Positives = 17/27 (62%)
 Frame = +1

Query: 487 GRVYDMIIVVRFHANTIKLFVLDEADE 567
           GRV+DMI         IK+ VLDEADE
Sbjct: 165 GRVFDMIRRRSLRTRAIKMLVLDEADE 191


>BC004386-1|AAH04386.1|  411|Homo sapiens eukaryotic translation
           initiation factor 4A, isoform 3 protein.
          Length = 411

 Score =  106 bits (254), Expect = 9e-23
 Identities = 49/67 (73%), Positives = 59/67 (88%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVR 433
           KTATFSIS+LQ +D  +RE QALILAPTRELA QIQK ++ALGD++N +CHACIGGTNV 
Sbjct: 88  KTATFSISVLQCLDIQVRETQALILAPTRELAVQIQKGLLALGDYMNVQCHACIGGTNVG 147

Query: 434 EDIRQLE 454
           EDIR+L+
Sbjct: 148 EDIRKLD 154



 Score = 88.6 bits (210), Expect = 2e-17
 Identities = 42/53 (79%), Positives = 46/53 (86%)
 Frame = +3

Query: 99  VVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           V  TFD M L+E+LLRGIYAYGFEKPSAIQQRAI   I+GRDVIAQ+QSGTGK
Sbjct: 36  VTPTFDTMGLREDLLRGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGK 88



 Score = 31.5 bits (68), Expect = 3.2
 Identities = 15/27 (55%), Positives = 17/27 (62%)
 Frame = +1

Query: 487 GRVYDMIIVVRFHANTIKLFVLDEADE 567
           GRV+DMI         IK+ VLDEADE
Sbjct: 165 GRVFDMIRRRSLRTRAIKMLVLDEADE 191


>BC003662-1|AAH03662.1|  411|Homo sapiens eukaryotic translation
           initiation factor 4A, isoform 3 protein.
          Length = 411

 Score =  106 bits (254), Expect = 9e-23
 Identities = 49/67 (73%), Positives = 59/67 (88%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVR 433
           KTATFSIS+LQ +D  +RE QALILAPTRELA QIQK ++ALGD++N +CHACIGGTNV 
Sbjct: 88  KTATFSISVLQCLDIQVRETQALILAPTRELAVQIQKGLLALGDYMNVQCHACIGGTNVG 147

Query: 434 EDIRQLE 454
           EDIR+L+
Sbjct: 148 EDIRKLD 154



 Score = 88.6 bits (210), Expect = 2e-17
 Identities = 42/53 (79%), Positives = 46/53 (86%)
 Frame = +3

Query: 99  VVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           V  TFD M L+E+LLRGIYAYGFEKPSAIQQRAI   I+GRDVIAQ+QSGTGK
Sbjct: 36  VTPTFDTMGLREDLLRGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGK 88



 Score = 31.5 bits (68), Expect = 3.2
 Identities = 15/27 (55%), Positives = 17/27 (62%)
 Frame = +1

Query: 487 GRVYDMIIVVRFHANTIKLFVLDEADE 567
           GRV+DMI         IK+ VLDEADE
Sbjct: 165 GRVFDMIRRRSLRTRAIKMLVLDEADE 191


>BC006380-1|AAH06380.1|  473|Homo sapiens Unknown (protein for
           IMAGE:4099962) protein.
          Length = 473

 Score =  105 bits (252), Expect = 2e-22
 Identities = 47/67 (70%), Positives = 60/67 (89%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVR 433
           KTATF+ISILQQI+  ++  QAL+LAPTRELAQQIQKVV+ALGD++ A CHACIGGTNVR
Sbjct: 149 KTATFAISILQQIELDLKATQALVLAPTRELAQQIQKVVMALGDYMGASCHACIGGTNVR 208

Query: 434 EDIRQLE 454
            ++++L+
Sbjct: 209 AEVQKLQ 215



 Score = 31.1 bits (67), Expect = 4.2
 Identities = 15/27 (55%), Positives = 18/27 (66%)
 Frame = +1

Query: 487 GRVYDMIIVVRFHANTIKLFVLDEADE 567
           GRV+DM+         IK+FVLDEADE
Sbjct: 227 GRVFDMLNRRYLSPKYIKMFVLDEADE 253


>AB209021-1|BAD92258.1|   67|Homo sapiens BM-010 variant protein.
          Length = 67

 Score = 87.8 bits (208), Expect = 3e-17
 Identities = 36/50 (72%), Positives = 46/50 (92%)
 Frame = +3

Query: 72  GHLHTDWDQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGR 221
           G + ++W+++V+ FDDMNLKE LLRGIYAYGFEKPSAIQQRAI+PCI+G+
Sbjct: 13  GVIESNWNEIVDNFDDMNLKESLLRGIYAYGFEKPSAIQQRAIIPCIKGK 62


>AY735312-1|AAU84667.1|  483|Homo sapiens gonadotropin-regulated
           testicular RNA helicase-GRTH/DDX25 protein.
          Length = 483

 Score = 61.3 bits (142), Expect = 3e-09
 Identities = 30/54 (55%), Positives = 42/54 (77%), Gaps = 2/54 (3%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAI--MPCIQGRDVIAQAQSGTGK 257
           V+TF+++ LKEELL+GIYA GF +PS IQ+ A+  M     +++IAQ+QSGTGK
Sbjct: 96  VKTFEELRLKEELLKGIYAMGFNRPSKIQEMALPMMLAHPPQNLIAQSQSGTGK 149



 Score = 35.1 bits (77), Expect = 0.26
 Identities = 21/58 (36%), Positives = 29/58 (50%)
 Frame = +2

Query: 209 HPRTRCYRSSPVRNWKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALG 382
           HP       S     KTA F +++L +++      Q L LAPT ELA Q  +VV  +G
Sbjct: 134 HPPQNLIAQSQSGTGKTAAFVLAMLSRVNALELFPQCLCLAPTYELALQTGRVVEQMG 191


>AF155140-1|AAF21371.2|  483|Homo sapiens gonadotropin-regulated
           testicular RNA helicase protein.
          Length = 483

 Score = 61.3 bits (142), Expect = 3e-09
 Identities = 30/54 (55%), Positives = 42/54 (77%), Gaps = 2/54 (3%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAI--MPCIQGRDVIAQAQSGTGK 257
           V+TF+++ LKEELL+GIYA GF +PS IQ+ A+  M     +++IAQ+QSGTGK
Sbjct: 96  VKTFEELRLKEELLKGIYAMGFNRPSKIQEMALPMMLAHPPQNLIAQSQSGTGK 149



 Score = 35.1 bits (77), Expect = 0.26
 Identities = 21/58 (36%), Positives = 29/58 (50%)
 Frame = +2

Query: 209 HPRTRCYRSSPVRNWKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALG 382
           HP       S     KTA F +++L +++      Q L LAPT ELA Q  +VV  +G
Sbjct: 134 HPPQNLIAQSQSGTGKTAAFVLAMLSRVNALELFPQCLCLAPTYELALQTGRVVEQMG 191


>D17532-1|BAA04482.1|  472|Homo sapiens RCK protein.
          Length = 472

 Score = 59.3 bits (137), Expect = 1e-08
 Identities = 26/49 (53%), Positives = 37/49 (75%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F+D  LK ELL GI+  G+EKPS IQ+ +I   + GRD++A+A++GTGK
Sbjct: 87  FEDYCLKRELLMGIFEMGWEKPSPIQEESIPIALSGRDILARAKNGTGK 135



 Score = 57.2 bits (132), Expect = 6e-08
 Identities = 26/68 (38%), Positives = 44/68 (64%), Gaps = 1/68 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTNV 430
           K+  + I +L+++D      QA+++ PTRELA Q+ ++ I +  H+  AK  A  GGTN+
Sbjct: 135 KSGAYLIPLLERLDLKKDNIQAMVIVPTRELALQVSQICIQVSKHMGGAKVMATTGGTNL 194

Query: 431 REDIRQLE 454
           R+DI +L+
Sbjct: 195 RDDIMRLD 202


>BC065007-1|AAH65007.1|  483|Homo sapiens DDX6 protein protein.
          Length = 483

 Score = 59.3 bits (137), Expect = 1e-08
 Identities = 26/49 (53%), Positives = 37/49 (75%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F+D  LK ELL GI+  G+EKPS IQ+ +I   + GRD++A+A++GTGK
Sbjct: 98  FEDYCLKRELLMGIFEMGWEKPSPIQEESIPIALSGRDILARAKNGTGK 146



 Score = 57.2 bits (132), Expect = 6e-08
 Identities = 26/68 (38%), Positives = 44/68 (64%), Gaps = 1/68 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTNV 430
           K+  + I +L+++D      QA+++ PTRELA Q+ ++ I +  H+  AK  A  GGTN+
Sbjct: 146 KSGAYLIPLLERLDLKKDNIQAMVIVPTRELALQVSQICIQVSKHMGGAKVMATTGGTNL 205

Query: 431 REDIRQLE 454
           R+DI +L+
Sbjct: 206 RDDIMRLD 213


>BC039826-1|AAH39826.1|  187|Homo sapiens DDX6 protein protein.
          Length = 187

 Score = 59.3 bits (137), Expect = 1e-08
 Identities = 26/49 (53%), Positives = 37/49 (75%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F+D  LK ELL GI+  G+EKPS IQ+ +I   + GRD++A+A++GTGK
Sbjct: 98  FEDYCLKRELLMGIFEMGWEKPSPIQEESIPIALSGRDILARAKNGTGK 146



 Score = 34.7 bits (76), Expect = 0.34
 Identities = 13/38 (34%), Positives = 25/38 (65%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKV 367
           K+  + I +L+++D      QA+++ PTRELA Q+ ++
Sbjct: 146 KSGAYLIPLLERLDLKKDNIQAMVIVPTRELALQVSQI 183


>BC110805-1|AAI10806.1|  449|Homo sapiens DDX19B protein protein.
          Length = 449

 Score = 55.6 bits (128), Expect = 2e-07
 Identities = 26/54 (48%), Positives = 41/54 (75%), Gaps = 2/54 (3%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRA--IMPCIQGRDVIAQAQSGTGK 257
           V++F+++ LK +LL+G+YA GF +PS IQ+ A  +M     +++IAQ+QSGTGK
Sbjct: 61  VKSFEELRLKPQLLQGVYAMGFNRPSKIQENALPLMLAEPPQNLIAQSQSGTGK 114



 Score = 37.1 bits (82), Expect = 0.064
 Identities = 18/43 (41%), Positives = 28/43 (65%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALG 382
           KTA F +++L Q++ + +  Q L L+PT ELA Q  KV+  +G
Sbjct: 114 KTAAFVLAMLSQVEPANKYPQCLCLSPTYELALQTGKVIEQMG 156


>BC006544-1|AAH06544.1|  478|Homo sapiens DEAD (Asp-Glu-Ala-As) box
           polypeptide 19A protein.
          Length = 478

 Score = 55.6 bits (128), Expect = 2e-07
 Identities = 26/54 (48%), Positives = 41/54 (75%), Gaps = 2/54 (3%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAI--MPCIQGRDVIAQAQSGTGK 257
           V++F+++ LK +LL+G+YA GF +PS IQ+ A+  M     +++IAQ+QSGTGK
Sbjct: 90  VKSFEELRLKPQLLQGVYAMGFNRPSKIQENALPMMLAEPPQNLIAQSQSGTGK 143



 Score = 37.9 bits (84), Expect = 0.037
 Identities = 19/43 (44%), Positives = 28/43 (65%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALG 382
           KTA F +++L +++ S R  Q L L+PT ELA Q  KV+  +G
Sbjct: 143 KTAAFVLAMLSRVEPSDRYPQCLCLSPTYELALQTGKVIEQMG 185


>BC005162-1|AAH05162.1|  478|Homo sapiens DEAD (Asp-Glu-Ala-As) box
           polypeptide 19A protein.
          Length = 478

 Score = 55.6 bits (128), Expect = 2e-07
 Identities = 26/54 (48%), Positives = 41/54 (75%), Gaps = 2/54 (3%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAI--MPCIQGRDVIAQAQSGTGK 257
           V++F+++ LK +LL+G+YA GF +PS IQ+ A+  M     +++IAQ+QSGTGK
Sbjct: 90  VKSFEELRLKPQLLQGVYAMGFNRPSKIQENALPMMLAEPPQNLIAQSQSGTGK 143



 Score = 37.9 bits (84), Expect = 0.037
 Identities = 19/43 (44%), Positives = 28/43 (65%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALG 382
           KTA F +++L +++ S R  Q L L+PT ELA Q  KV+  +G
Sbjct: 143 KTAAFVLAMLSRVEPSDRYPQCLCLSPTYELALQTGKVIEQMG 185


>BC003626-1|AAH03626.1|  479|Homo sapiens DEAD (Asp-Glu-Ala-As) box
           polypeptide 19B protein.
          Length = 479

 Score = 55.6 bits (128), Expect = 2e-07
 Identities = 26/54 (48%), Positives = 41/54 (75%), Gaps = 2/54 (3%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRA--IMPCIQGRDVIAQAQSGTGK 257
           V++F+++ LK +LL+G+YA GF +PS IQ+ A  +M     +++IAQ+QSGTGK
Sbjct: 91  VKSFEELRLKPQLLQGVYAMGFNRPSKIQENALPLMLAEPPQNLIAQSQSGTGK 144



 Score = 37.1 bits (82), Expect = 0.064
 Identities = 18/43 (41%), Positives = 28/43 (65%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALG 382
           KTA F +++L Q++ + +  Q L L+PT ELA Q  KV+  +G
Sbjct: 144 KTAAFVLAMLSQVEPANKYPQCLCLSPTYELALQTGKVIEQMG 186


>AK223262-1|BAD96982.1|  478|Homo sapiens DDX19-like protein variant
           protein.
          Length = 478

 Score = 55.6 bits (128), Expect = 2e-07
 Identities = 26/54 (48%), Positives = 41/54 (75%), Gaps = 2/54 (3%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAI--MPCIQGRDVIAQAQSGTGK 257
           V++F+++ LK +LL+G+YA GF +PS IQ+ A+  M     +++IAQ+QSGTGK
Sbjct: 90  VKSFEELRLKPQLLQGVYAMGFNRPSKIQENALPMMLAEPPQNLIAQSQSGTGK 143



 Score = 37.9 bits (84), Expect = 0.037
 Identities = 19/43 (44%), Positives = 28/43 (65%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALG 382
           KTA F +++L +++ S R  Q L L+PT ELA Q  KV+  +G
Sbjct: 143 KTAAFVLAMLSRVEPSDRYPQCLCLSPTYELALQTGKVIEQMG 185


>AK223115-1|BAD96835.1|  479|Homo sapiens DEAD (Asp-Glu-Ala-As) box
           polypeptide 19 variant protein.
          Length = 479

 Score = 55.6 bits (128), Expect = 2e-07
 Identities = 26/54 (48%), Positives = 41/54 (75%), Gaps = 2/54 (3%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRA--IMPCIQGRDVIAQAQSGTGK 257
           V++F+++ LK +LL+G+YA GF +PS IQ+ A  +M     +++IAQ+QSGTGK
Sbjct: 91  VKSFEELRLKPQLLQGVYAMGFNRPSKIQENALPLMLAEPPQNLIAQSQSGTGK 144



 Score = 37.1 bits (82), Expect = 0.064
 Identities = 18/43 (41%), Positives = 28/43 (65%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALG 382
           KTA F +++L Q++ + +  Q L L+PT ELA Q  KV+  +G
Sbjct: 144 KTAAFVLAMLSQVEPANKYPQCLCLSPTYELALQTGKVIEQMG 186


>AK001988-1|BAA92022.1|  478|Homo sapiens protein ( Homo sapiens
           cDNA FLJ11126 fis, clone PLACE1006196, weakly similar to
           PUTATIVE ATP-DEPENDENT RNA HELICASE C12C2.06. ).
          Length = 478

 Score = 55.6 bits (128), Expect = 2e-07
 Identities = 26/54 (48%), Positives = 41/54 (75%), Gaps = 2/54 (3%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAI--MPCIQGRDVIAQAQSGTGK 257
           V++F+++ LK +LL+G+YA GF +PS IQ+ A+  M     +++IAQ+QSGTGK
Sbjct: 90  VKSFEELRLKPQLLQGVYAMGFNRPSKIQENALPMMLAEPPQNLIAQSQSGTGK 143



 Score = 37.9 bits (84), Expect = 0.037
 Identities = 19/43 (44%), Positives = 28/43 (65%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALG 382
           KTA F +++L +++ S R  Q L L+PT ELA Q  KV+  +G
Sbjct: 143 KTAAFVLAMLSRVEPSDRYPQCLCLSPTYELALQTGKVIEQMG 185


>AJ237946-1|CAB52189.1|  479|Homo sapiens DEAD Box Protein 5
           protein.
          Length = 479

 Score = 55.6 bits (128), Expect = 2e-07
 Identities = 26/54 (48%), Positives = 41/54 (75%), Gaps = 2/54 (3%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRA--IMPCIQGRDVIAQAQSGTGK 257
           V++F+++ LK +LL+G+YA GF +PS IQ+ A  +M     +++IAQ+QSGTGK
Sbjct: 91  VKSFEELRLKPQLLQGVYAMGFNRPSKIQENALPLMLAEPPQNLIAQSQSGTGK 144



 Score = 37.1 bits (82), Expect = 0.064
 Identities = 18/43 (41%), Positives = 28/43 (65%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALG 382
           KTA F +++L Q++ + +  Q L L+PT ELA Q  KV+  +G
Sbjct: 144 KTAAFVLAMLSQVEPANKYPQCLCLSPTYELALQTGKVIEQMG 186


>AF183422-1|AAG09691.1|  478|Homo sapiens RNA helicase protein.
          Length = 478

 Score = 55.6 bits (128), Expect = 2e-07
 Identities = 26/54 (48%), Positives = 41/54 (75%), Gaps = 2/54 (3%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAI--MPCIQGRDVIAQAQSGTGK 257
           V++F+++ LK +LL+G+YA GF +PS IQ+ A+  M     +++IAQ+QSGTGK
Sbjct: 90  VKSFEELRLKPQLLQGVYAMGFNRPSKIQENALPMMLAEPPQNLIAQSQSGTGK 143



 Score = 37.9 bits (84), Expect = 0.037
 Identities = 19/43 (44%), Positives = 28/43 (65%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALG 382
           KTA F +++L +++ S R  Q L L+PT ELA Q  KV+  +G
Sbjct: 143 KTAAFVLAMLSRVEPSDRYPQCLCLSPTYELALQTGKVIEQMG 185


>AF136175-1|AAP97265.1|  479|Homo sapiens RNA helicase protein.
          Length = 479

 Score = 55.6 bits (128), Expect = 2e-07
 Identities = 26/54 (48%), Positives = 41/54 (75%), Gaps = 2/54 (3%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAI--MPCIQGRDVIAQAQSGTGK 257
           V++F+++ LK +LL+G+YA GF +PS IQ+ A+  M     +++IAQ+QSGTGK
Sbjct: 91  VKSFEELRLKPQLLQGVYAMGFNRPSKIQENALPMMLAEPPQNLIAQSQSGTGK 144



 Score = 35.1 bits (77), Expect = 0.26
 Identities = 18/43 (41%), Positives = 26/43 (60%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALG 382
           KTA F +++L +++ S R  Q L L PT EL  Q  KV+  +G
Sbjct: 144 KTAAFVLAMLSRVEPSDRYPQCLCLFPTYELGLQTGKVIEQMG 186


>CR457215-1|CAG33496.1|  479|Homo sapiens DDX19 protein.
          Length = 479

 Score = 55.2 bits (127), Expect = 2e-07
 Identities = 26/54 (48%), Positives = 41/54 (75%), Gaps = 2/54 (3%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRA--IMPCIQGRDVIAQAQSGTGK 257
           V++F+++ LK +LL+G+YA GF +PS IQ+ A  +M     +++IAQ+QSGTGK
Sbjct: 91  VKSFEELRLKPQLLQGVYAMGFNRPSKIQENALPLMLVEPPQNLIAQSQSGTGK 144



 Score = 37.1 bits (82), Expect = 0.064
 Identities = 18/43 (41%), Positives = 28/43 (65%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALG 382
           KTA F +++L Q++ + +  Q L L+PT ELA Q  KV+  +G
Sbjct: 144 KTAAFVLAMLSQVEPANKYPQCLCLSPTYELALQTGKVIEQMG 186


>BC034953-1|AAH34953.1|  824|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 20 protein.
          Length = 824

 Score = 51.2 bits (117), Expect = 4e-06
 Identities = 28/68 (41%), Positives = 38/68 (55%), Gaps = 1/68 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNA-KCHACIGGTNV 430
           KT  FS   L  +       Q LILAPTRE+A QI  V+ A+G  +   +CH  IGGT +
Sbjct: 112 KTCVFSTIALDSLVLENLSTQILILAPTREIAVQIHSVITAIGIKMEGLECHVFIGGTPL 171

Query: 431 REDIRQLE 454
            +D  +L+
Sbjct: 172 SQDKTRLK 179



 Score = 46.4 bits (105), Expect = 1e-04
 Identities = 23/49 (46%), Positives = 32/49 (65%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F+ + L   +L G+ A GFE+PS +Q +AI     G D+I QA+SGTGK
Sbjct: 64  FESLLLSRPVLEGLRAAGFERPSPVQLKAIPLGRCGLDLIVQAKSGTGK 112


>BC031062-1|AAH31062.1|  824|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 20 protein.
          Length = 824

 Score = 51.2 bits (117), Expect = 4e-06
 Identities = 28/68 (41%), Positives = 38/68 (55%), Gaps = 1/68 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNA-KCHACIGGTNV 430
           KT  FS   L  +       Q LILAPTRE+A QI  V+ A+G  +   +CH  IGGT +
Sbjct: 112 KTCVFSTIALDSLVLENLSTQILILAPTREIAVQIHSVITAIGIKMEGLECHVFIGGTPL 171

Query: 431 REDIRQLE 454
            +D  +L+
Sbjct: 172 SQDKTRLK 179



 Score = 46.4 bits (105), Expect = 1e-04
 Identities = 23/49 (46%), Positives = 32/49 (65%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F+ + L   +L G+ A GFE+PS +Q +AI     G D+I QA+SGTGK
Sbjct: 64  FESLLLSRPVLEGLRAAGFERPSPVQLKAIPLGRCGLDLIVQAKSGTGK 112


>BC011556-1|AAH11556.1|  824|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 20 protein.
          Length = 824

 Score = 51.2 bits (117), Expect = 4e-06
 Identities = 28/68 (41%), Positives = 38/68 (55%), Gaps = 1/68 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNA-KCHACIGGTNV 430
           KT  FS   L  +       Q LILAPTRE+A QI  V+ A+G  +   +CH  IGGT +
Sbjct: 112 KTCVFSTIALDSLVLENLSTQILILAPTREIAVQIHSVITAIGIKMEGLECHVFIGGTPL 171

Query: 431 REDIRQLE 454
            +D  +L+
Sbjct: 172 SQDKTRLK 179



 Score = 46.4 bits (105), Expect = 1e-04
 Identities = 23/49 (46%), Positives = 32/49 (65%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F+ + L   +L G+ A GFE+PS +Q +AI     G D+I QA+SGTGK
Sbjct: 64  FESLLLSRPVLEGLRAAGFERPSPVQLKAIPLGRCGLDLIVQAKSGTGK 112


>AL049557-7|CAB55686.2|  824|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 20 protein.
          Length = 824

 Score = 51.2 bits (117), Expect = 4e-06
 Identities = 28/68 (41%), Positives = 38/68 (55%), Gaps = 1/68 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNA-KCHACIGGTNV 430
           KT  FS   L  +       Q LILAPTRE+A QI  V+ A+G  +   +CH  IGGT +
Sbjct: 112 KTCVFSTIALDSLVLENLSTQILILAPTREIAVQIHSVITAIGIKMEGLECHVFIGGTPL 171

Query: 431 REDIRQLE 454
            +D  +L+
Sbjct: 172 SQDKTRLK 179



 Score = 46.4 bits (105), Expect = 1e-04
 Identities = 23/49 (46%), Positives = 32/49 (65%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F+ + L   +L G+ A GFE+PS +Q +AI     G D+I QA+SGTGK
Sbjct: 64  FESLLLSRPVLEGLRAAGFERPSPVQLKAIPLGRCGLDLIVQAKSGTGK 112


>AK001506-1|BAA91727.1|  824|Homo sapiens protein ( Homo sapiens
           cDNA FLJ10644 fis, clone NT2RP2005763, weakly similar to
           EUKARYOTIC INITIATION FACTOR 4A. ).
          Length = 824

 Score = 51.2 bits (117), Expect = 4e-06
 Identities = 28/68 (41%), Positives = 38/68 (55%), Gaps = 1/68 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNA-KCHACIGGTNV 430
           KT  FS   L  +       Q LILAPTRE+A QI  V+ A+G  +   +CH  IGGT +
Sbjct: 112 KTCVFSTIALDSLVLENLSTQILILAPTREIAVQIHSVITAIGIKMEGLECHVFIGGTPL 171

Query: 431 REDIRQLE 454
            +D  +L+
Sbjct: 172 SQDKTRLK 179



 Score = 46.4 bits (105), Expect = 1e-04
 Identities = 23/49 (46%), Positives = 32/49 (65%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F+ + L   +L G+ A GFE+PS +Q +AI     G D+I QA+SGTGK
Sbjct: 64  FESLLLSRPVLEGLRAAGFERPSPVQLKAIPLGRCGLDLIVQAKSGTGK 112


>AF171063-1|AAF14544.1|  824|Homo sapiens DEAD box RNA helicase
           Gemin3 protein.
          Length = 824

 Score = 51.2 bits (117), Expect = 4e-06
 Identities = 28/68 (41%), Positives = 38/68 (55%), Gaps = 1/68 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNA-KCHACIGGTNV 430
           KT  FS   L  +       Q LILAPTRE+A QI  V+ A+G  +   +CH  IGGT +
Sbjct: 112 KTCVFSTIALDSLVLENLSTQILILAPTREIAVQIHSVITAIGIKMEGLECHVFIGGTPL 171

Query: 431 REDIRQLE 454
            +D  +L+
Sbjct: 172 SQDKTRLK 179



 Score = 46.4 bits (105), Expect = 1e-04
 Identities = 23/49 (46%), Positives = 32/49 (65%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F+ + L   +L G+ A GFE+PS +Q +AI     G D+I QA+SGTGK
Sbjct: 64  FESLLLSRPVLEGLRAAGFERPSPVQLKAIPLGRCGLDLIVQAKSGTGK 112


>AF155803-1|AAK56799.1|  824|Homo sapiens DEAD-box corepressor DP103
           protein.
          Length = 824

 Score = 51.2 bits (117), Expect = 4e-06
 Identities = 28/68 (41%), Positives = 38/68 (55%), Gaps = 1/68 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNA-KCHACIGGTNV 430
           KT  FS   L  +       Q LILAPTRE+A QI  V+ A+G  +   +CH  IGGT +
Sbjct: 112 KTCVFSTIALDSLVLENLSTQILILAPTREIAVQIHSVITAIGIKMEGLECHVFIGGTPL 171

Query: 431 REDIRQLE 454
            +D  +L+
Sbjct: 172 SQDKTRLK 179



 Score = 46.4 bits (105), Expect = 1e-04
 Identities = 23/49 (46%), Positives = 32/49 (65%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F+ + L   +L G+ A GFE+PS +Q +AI     G D+I QA+SGTGK
Sbjct: 64  FESLLLSRPVLEGLRAAGFERPSPVQLKAIPLGRCGLDLIVQAKSGTGK 112


>AF106019-1|AAD42744.1|  824|Homo sapiens DEAD-box protein protein.
          Length = 824

 Score = 51.2 bits (117), Expect = 4e-06
 Identities = 28/68 (41%), Positives = 38/68 (55%), Gaps = 1/68 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNA-KCHACIGGTNV 430
           KT  FS   L  +       Q LILAPTRE+A QI  V+ A+G  +   +CH  IGGT +
Sbjct: 112 KTCVFSTIALDSLVLENLSTQILILAPTREIAVQIHSVITAIGIKMEGLECHVFIGGTPL 171

Query: 431 REDIRQLE 454
            +D  +L+
Sbjct: 172 SQDKTRLK 179



 Score = 46.4 bits (105), Expect = 1e-04
 Identities = 23/49 (46%), Positives = 32/49 (65%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F+ + L   +L G+ A GFE+PS +Q +AI     G D+I QA+SGTGK
Sbjct: 64  FESLLLSRPVLEGLRAAGFERPSPVQLKAIPLGRCGLDLIVQAKSGTGK 112


>Z37166-1|CAA85523.1|  428|Homo sapiens nuclear RNA helicase (DEAD
           family) protein.
          Length = 428

 Score = 50.8 bits (116), Expect = 5e-06
 Identities = 26/49 (53%), Positives = 29/49 (59%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F D  LK ELLR I   GFE PS +Q   I   I G DV+ QA+SG GK
Sbjct: 47  FRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGK 95



 Score = 39.9 bits (89), Expect = 0.009
 Identities = 21/63 (33%), Positives = 34/63 (53%), Gaps = 1/63 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTNV 430
           KTA F ++ LQQ++    +   L++  TRELA QI K       ++ N K     GG ++
Sbjct: 95  KTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLSI 154

Query: 431 RED 439
           ++D
Sbjct: 155 KKD 157


>Y14768-15|CAA75074.1|  144|Homo sapiens BAT1 protein.
          Length = 144

 Score = 50.8 bits (116), Expect = 5e-06
 Identities = 26/49 (53%), Positives = 29/49 (59%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F D  LK ELLR I   GFE PS +Q   I   I G DV+ QA+SG GK
Sbjct: 47  FRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGK 95



 Score = 33.9 bits (74), Expect = 0.60
 Identities = 16/37 (43%), Positives = 23/37 (62%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQK 364
           KTA F ++ LQQ++    +   L++  TRELA QI K
Sbjct: 95  KTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISK 131


>BX248516-15|CAM25884.1|  187|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 187

 Score = 50.8 bits (116), Expect = 5e-06
 Identities = 26/49 (53%), Positives = 29/49 (59%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F D  LK ELLR I   GFE PS +Q   I   I G DV+ QA+SG GK
Sbjct: 70  FRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGK 118



 Score = 39.9 bits (89), Expect = 0.009
 Identities = 21/63 (33%), Positives = 34/63 (53%), Gaps = 1/63 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTNV 430
           KTA F ++ LQQ++    +   L++  TRELA QI K       ++ N K     GG ++
Sbjct: 118 KTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLSI 177

Query: 431 RED 439
           ++D
Sbjct: 178 KKD 180


>BX248516-14|CAM25883.1|  136|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 136

 Score = 50.8 bits (116), Expect = 5e-06
 Identities = 26/49 (53%), Positives = 29/49 (59%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F D  LK ELLR I   GFE PS +Q   I   I G DV+ QA+SG GK
Sbjct: 62  FRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGK 110


>BX248516-13|CAM25882.1|   96|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 96

 Score = 50.8 bits (116), Expect = 5e-06
 Identities = 26/49 (53%), Positives = 29/49 (59%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F D  LK ELLR I   GFE PS +Q   I   I G DV+ QA+SG GK
Sbjct: 47  FRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGK 95


>BX248516-12|CAM25881.1|  132|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 132

 Score = 50.8 bits (116), Expect = 5e-06
 Identities = 26/49 (53%), Positives = 29/49 (59%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F D  LK ELLR I   GFE PS +Q   I   I G DV+ QA+SG GK
Sbjct: 47  FRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGK 95


>BX248516-11|CAI41927.2|  125|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 125

 Score = 50.8 bits (116), Expect = 5e-06
 Identities = 26/49 (53%), Positives = 29/49 (59%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F D  LK ELLR I   GFE PS +Q   I   I G DV+ QA+SG GK
Sbjct: 47  FRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGK 95


>BX248516-10|CAI41923.2|  197|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 197

 Score = 50.8 bits (116), Expect = 5e-06
 Identities = 26/49 (53%), Positives = 29/49 (59%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F D  LK ELLR I   GFE PS +Q   I   I G DV+ QA+SG GK
Sbjct: 47  FRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGK 95


>BX248516-9|CAM25880.1|  236|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 236

 Score = 50.8 bits (116), Expect = 5e-06
 Identities = 26/49 (53%), Positives = 29/49 (59%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F D  LK ELLR I   GFE PS +Q   I   I G DV+ QA+SG GK
Sbjct: 47  FRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGK 95



 Score = 39.9 bits (89), Expect = 0.009
 Identities = 21/63 (33%), Positives = 34/63 (53%), Gaps = 1/63 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTNV 430
           KTA F ++ LQQ++    +   L++  TRELA QI K       ++ N K     GG ++
Sbjct: 95  KTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLSI 154

Query: 431 RED 439
           ++D
Sbjct: 155 KKD 157


>BX248516-8|CAM25879.1|  238|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 238

 Score = 50.8 bits (116), Expect = 5e-06
 Identities = 26/49 (53%), Positives = 29/49 (59%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F D  LK ELLR I   GFE PS +Q   I   I G DV+ QA+SG GK
Sbjct: 47  FRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGK 95



 Score = 39.9 bits (89), Expect = 0.009
 Identities = 21/63 (33%), Positives = 34/63 (53%), Gaps = 1/63 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTNV 430
           KTA F ++ LQQ++    +   L++  TRELA QI K       ++ N K     GG ++
Sbjct: 95  KTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLSI 154

Query: 431 RED 439
           ++D
Sbjct: 155 KKD 157


>BX248516-7|CAM25878.1|  231|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 231

 Score = 50.8 bits (116), Expect = 5e-06
 Identities = 26/49 (53%), Positives = 29/49 (59%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F D  LK ELLR I   GFE PS +Q   I   I G DV+ QA+SG GK
Sbjct: 47  FRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGK 95



 Score = 39.9 bits (89), Expect = 0.009
 Identities = 21/63 (33%), Positives = 34/63 (53%), Gaps = 1/63 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTNV 430
           KTA F ++ LQQ++    +   L++  TRELA QI K       ++ N K     GG ++
Sbjct: 95  KTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLSI 154

Query: 431 RED 439
           ++D
Sbjct: 155 KKD 157


>BX248516-6|CAM25877.1|  289|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 289

 Score = 50.8 bits (116), Expect = 5e-06
 Identities = 26/49 (53%), Positives = 29/49 (59%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F D  LK ELLR I   GFE PS +Q   I   I G DV+ QA+SG GK
Sbjct: 47  FRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGK 95



 Score = 39.9 bits (89), Expect = 0.009
 Identities = 21/63 (33%), Positives = 34/63 (53%), Gaps = 1/63 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTNV 430
           KTA F ++ LQQ++    +   L++  TRELA QI K       ++ N K     GG ++
Sbjct: 95  KTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLSI 154

Query: 431 RED 439
           ++D
Sbjct: 155 KKD 157


>BX248516-4|CAI41924.2|  425|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 425

 Score = 50.8 bits (116), Expect = 5e-06
 Identities = 26/49 (53%), Positives = 29/49 (59%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F D  LK ELLR I   GFE PS +Q   I   I G DV+ QA+SG GK
Sbjct: 47  FRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGK 95



 Score = 39.9 bits (89), Expect = 0.009
 Identities = 21/63 (33%), Positives = 34/63 (53%), Gaps = 1/63 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTNV 430
           KTA F ++ LQQ++    +   L++  TRELA QI K       ++ N K     GG ++
Sbjct: 95  KTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLSI 154

Query: 431 RED 439
           ++D
Sbjct: 155 KKD 157


>BX248516-3|CAI41922.1|  428|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 428

 Score = 50.8 bits (116), Expect = 5e-06
 Identities = 26/49 (53%), Positives = 29/49 (59%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F D  LK ELLR I   GFE PS +Q   I   I G DV+ QA+SG GK
Sbjct: 47  FRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGK 95



 Score = 39.9 bits (89), Expect = 0.009
 Identities = 21/63 (33%), Positives = 34/63 (53%), Gaps = 1/63 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTNV 430
           KTA F ++ LQQ++    +   L++  TRELA QI K       ++ N K     GG ++
Sbjct: 95  KTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLSI 154

Query: 431 RED 439
           ++D
Sbjct: 155 KKD 157


>BX001040-10|CAI18638.1|  187|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 187

 Score = 50.8 bits (116), Expect = 5e-06
 Identities = 26/49 (53%), Positives = 29/49 (59%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F D  LK ELLR I   GFE PS +Q   I   I G DV+ QA+SG GK
Sbjct: 70  FRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGK 118



 Score = 39.9 bits (89), Expect = 0.009
 Identities = 21/63 (33%), Positives = 34/63 (53%), Gaps = 1/63 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTNV 430
           KTA F ++ LQQ++    +   L++  TRELA QI K       ++ N K     GG ++
Sbjct: 118 KTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLSI 177

Query: 431 RED 439
           ++D
Sbjct: 178 KKD 180


>BX001040-9|CAI18636.1|  177|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 177

 Score = 50.8 bits (116), Expect = 5e-06
 Identities = 26/49 (53%), Positives = 29/49 (59%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F D  LK ELLR I   GFE PS +Q   I   I G DV+ QA+SG GK
Sbjct: 47  FRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGK 95


>BX001040-8|CAI18637.1|  205|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 205

 Score = 50.8 bits (116), Expect = 5e-06
 Identities = 26/49 (53%), Positives = 29/49 (59%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F D  LK ELLR I   GFE PS +Q   I   I G DV+ QA+SG GK
Sbjct: 47  FRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGK 95



 Score = 39.9 bits (89), Expect = 0.009
 Identities = 21/63 (33%), Positives = 34/63 (53%), Gaps = 1/63 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTNV 430
           KTA F ++ LQQ++    +   L++  TRELA QI K       ++ N K     GG ++
Sbjct: 95  KTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLSI 154

Query: 431 RED 439
           ++D
Sbjct: 155 KKD 157


>BX001040-7|CAI18635.1|  245|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 245

 Score = 50.8 bits (116), Expect = 5e-06
 Identities = 26/49 (53%), Positives = 29/49 (59%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F D  LK ELLR I   GFE PS +Q   I   I G DV+ QA+SG GK
Sbjct: 47  FRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGK 95



 Score = 39.9 bits (89), Expect = 0.009
 Identities = 21/63 (33%), Positives = 34/63 (53%), Gaps = 1/63 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTNV 430
           KTA F ++ LQQ++    +   L++  TRELA QI K       ++ N K     GG ++
Sbjct: 95  KTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLSI 154

Query: 431 RED 439
           ++D
Sbjct: 155 KKD 157


>BX001040-6|CAI18634.1|  428|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 428

 Score = 50.8 bits (116), Expect = 5e-06
 Identities = 26/49 (53%), Positives = 29/49 (59%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F D  LK ELLR I   GFE PS +Q   I   I G DV+ QA+SG GK
Sbjct: 47  FRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGK 95



 Score = 39.9 bits (89), Expect = 0.009
 Identities = 21/63 (33%), Positives = 34/63 (53%), Gaps = 1/63 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTNV 430
           KTA F ++ LQQ++    +   L++  TRELA QI K       ++ N K     GG ++
Sbjct: 95  KTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLSI 154

Query: 431 RED 439
           ++D
Sbjct: 155 KKD 157


>BT009909-1|AAP88911.1|  428|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 428

 Score = 50.8 bits (116), Expect = 5e-06
 Identities = 26/49 (53%), Positives = 29/49 (59%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F D  LK ELLR I   GFE PS +Q   I   I G DV+ QA+SG GK
Sbjct: 47  FRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGK 95



 Score = 39.9 bits (89), Expect = 0.009
 Identities = 21/63 (33%), Positives = 34/63 (53%), Gaps = 1/63 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTNV 430
           KTA F ++ LQQ++    +   L++  TRELA QI K       ++ N K     GG ++
Sbjct: 95  KTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLSI 154

Query: 431 RED 439
           ++D
Sbjct: 155 KKD 157


>BC032128-1|AAH32128.1|  322|Homo sapiens DDX39 protein protein.
          Length = 322

 Score = 50.8 bits (116), Expect = 5e-06
 Identities = 26/49 (53%), Positives = 29/49 (59%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F D  LK ELLR I   GFE PS +Q   I   I G DV+ QA+SG GK
Sbjct: 46  FRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGK 94



 Score = 37.9 bits (84), Expect = 0.037
 Identities = 21/63 (33%), Positives = 34/63 (53%), Gaps = 1/63 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTNV 430
           KTA F ++ LQQI+    +   L++  TRELA QI K       ++ + K     GG ++
Sbjct: 94  KTAVFVLATLQQIEPVNGQVTVLVMCHTRELAFQISKEYERFSKYMPSVKVSVFFGGLSI 153

Query: 431 RED 439
           ++D
Sbjct: 154 KKD 156


>BC013006-1|AAH13006.1|  428|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 428

 Score = 50.8 bits (116), Expect = 5e-06
 Identities = 26/49 (53%), Positives = 29/49 (59%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F D  LK ELLR I   GFE PS +Q   I   I G DV+ QA+SG GK
Sbjct: 47  FRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGK 95



 Score = 39.9 bits (89), Expect = 0.009
 Identities = 21/63 (33%), Positives = 34/63 (53%), Gaps = 1/63 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTNV 430
           KTA F ++ LQQ++    +   L++  TRELA QI K       ++ N K     GG ++
Sbjct: 95  KTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLSI 154

Query: 431 RED 439
           ++D
Sbjct: 155 KKD 157


>BC010455-1|AAH10455.1|  316|Homo sapiens DDX39 protein protein.
          Length = 316

 Score = 50.8 bits (116), Expect = 5e-06
 Identities = 26/49 (53%), Positives = 29/49 (59%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F D  LK ELLR I   GFE PS +Q   I   I G DV+ QA+SG GK
Sbjct: 46  FRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGK 94



 Score = 37.9 bits (84), Expect = 0.037
 Identities = 21/63 (33%), Positives = 34/63 (53%), Gaps = 1/63 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTNV 430
           KTA F ++ LQQI+    +   L++  TRELA QI K       ++ + K     GG ++
Sbjct: 94  KTAVFVLATLQQIEPVNGQVTVLVMCHTRELAFQISKEYERFSKYMPSVKVSVFFGGLSI 153

Query: 431 RED 439
           ++D
Sbjct: 154 KKD 156


>BC001009-1|AAH01009.1|  427|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 39 protein.
          Length = 427

 Score = 50.8 bits (116), Expect = 5e-06
 Identities = 26/49 (53%), Positives = 29/49 (59%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F D  LK ELLR I   GFE PS +Q   I   I G DV+ QA+SG GK
Sbjct: 46  FRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGK 94



 Score = 37.9 bits (84), Expect = 0.037
 Identities = 21/63 (33%), Positives = 34/63 (53%), Gaps = 1/63 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTNV 430
           KTA F ++ LQQI+    +   L++  TRELA QI K       ++ + K     GG ++
Sbjct: 94  KTAVFVLATLQQIEPVNGQVTVLVMCHTRELAFQISKEYERFSKYMPSVKVSVFFGGLSI 153

Query: 431 RED 439
           ++D
Sbjct: 154 KKD 156


>BC000361-1|AAH00361.1|  428|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 428

 Score = 50.8 bits (116), Expect = 5e-06
 Identities = 26/49 (53%), Positives = 29/49 (59%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F D  LK ELLR I   GFE PS +Q   I   I G DV+ QA+SG GK
Sbjct: 47  FRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGK 95



 Score = 39.9 bits (89), Expect = 0.009
 Identities = 21/63 (33%), Positives = 34/63 (53%), Gaps = 1/63 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTNV 430
           KTA F ++ LQQ++    +   L++  TRELA QI K       ++ N K     GG ++
Sbjct: 95  KTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLSI 154

Query: 431 RED 439
           ++D
Sbjct: 155 KKD 157


>BA000025-40|BAB63306.1|  428|Homo sapiens putative ATP-dependent
           RNA helicase protein.
          Length = 428

 Score = 50.8 bits (116), Expect = 5e-06
 Identities = 26/49 (53%), Positives = 29/49 (59%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F D  LK ELLR I   GFE PS +Q   I   I G DV+ QA+SG GK
Sbjct: 47  FRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGK 95



 Score = 39.9 bits (89), Expect = 0.009
 Identities = 21/63 (33%), Positives = 34/63 (53%), Gaps = 1/63 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTNV 430
           KTA F ++ LQQ++    +   L++  TRELA QI K       ++ N K     GG ++
Sbjct: 95  KTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLSI 154

Query: 431 RED 439
           ++D
Sbjct: 155 KKD 157


>AL662847-32|CAO72093.1|  187|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 187

 Score = 50.8 bits (116), Expect = 5e-06
 Identities = 26/49 (53%), Positives = 29/49 (59%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F D  LK ELLR I   GFE PS +Q   I   I G DV+ QA+SG GK
Sbjct: 70  FRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGK 118



 Score = 39.9 bits (89), Expect = 0.009
 Identities = 21/63 (33%), Positives = 34/63 (53%), Gaps = 1/63 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTNV 430
           KTA F ++ LQQ++    +   L++  TRELA QI K       ++ N K     GG ++
Sbjct: 118 KTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLSI 177

Query: 431 RED 439
           ++D
Sbjct: 178 KKD 180


>AL662847-31|CAO72092.1|  136|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 136

 Score = 50.8 bits (116), Expect = 5e-06
 Identities = 26/49 (53%), Positives = 29/49 (59%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F D  LK ELLR I   GFE PS +Q   I   I G DV+ QA+SG GK
Sbjct: 62  FRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGK 110


>AL662847-30|CAO72091.1|   96|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 96

 Score = 50.8 bits (116), Expect = 5e-06
 Identities = 26/49 (53%), Positives = 29/49 (59%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F D  LK ELLR I   GFE PS +Q   I   I G DV+ QA+SG GK
Sbjct: 47  FRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGK 95


>AL662847-29|CAI17665.2|  132|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 132

 Score = 50.8 bits (116), Expect = 5e-06
 Identities = 26/49 (53%), Positives = 29/49 (59%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F D  LK ELLR I   GFE PS +Q   I   I G DV+ QA+SG GK
Sbjct: 47  FRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGK 95


>AL662847-28|CAO72090.1|  125|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 125

 Score = 50.8 bits (116), Expect = 5e-06
 Identities = 26/49 (53%), Positives = 29/49 (59%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F D  LK ELLR I   GFE PS +Q   I   I G DV+ QA+SG GK
Sbjct: 47  FRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGK 95


>AL662847-27|CAO72089.1|  197|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 197

 Score = 50.8 bits (116), Expect = 5e-06
 Identities = 26/49 (53%), Positives = 29/49 (59%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F D  LK ELLR I   GFE PS +Q   I   I G DV+ QA+SG GK
Sbjct: 47  FRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGK 95


>AL662847-26|CAI17670.2|  238|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 238

 Score = 50.8 bits (116), Expect = 5e-06
 Identities = 26/49 (53%), Positives = 29/49 (59%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F D  LK ELLR I   GFE PS +Q   I   I G DV+ QA+SG GK
Sbjct: 47  FRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGK 95



 Score = 39.9 bits (89), Expect = 0.009
 Identities = 21/63 (33%), Positives = 34/63 (53%), Gaps = 1/63 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTNV 430
           KTA F ++ LQQ++    +   L++  TRELA QI K       ++ N K     GG ++
Sbjct: 95  KTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLSI 154

Query: 431 RED 439
           ++D
Sbjct: 155 KKD 157


>AL662847-25|CAO72088.1|  231|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 231

 Score = 50.8 bits (116), Expect = 5e-06
 Identities = 26/49 (53%), Positives = 29/49 (59%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F D  LK ELLR I   GFE PS +Q   I   I G DV+ QA+SG GK
Sbjct: 47  FRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGK 95



 Score = 39.9 bits (89), Expect = 0.009
 Identities = 21/63 (33%), Positives = 34/63 (53%), Gaps = 1/63 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTNV 430
           KTA F ++ LQQ++    +   L++  TRELA QI K       ++ N K     GG ++
Sbjct: 95  KTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLSI 154

Query: 431 RED 439
           ++D
Sbjct: 155 KKD 157


>AL662847-24|CAO72087.1|  236|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 236

 Score = 50.8 bits (116), Expect = 5e-06
 Identities = 26/49 (53%), Positives = 29/49 (59%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F D  LK ELLR I   GFE PS +Q   I   I G DV+ QA+SG GK
Sbjct: 47  FRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGK 95



 Score = 39.9 bits (89), Expect = 0.009
 Identities = 21/63 (33%), Positives = 34/63 (53%), Gaps = 1/63 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTNV 430
           KTA F ++ LQQ++    +   L++  TRELA QI K       ++ N K     GG ++
Sbjct: 95  KTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLSI 154

Query: 431 RED 439
           ++D
Sbjct: 155 KKD 157


>AL662847-23|CAO72086.1|  289|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 289

 Score = 50.8 bits (116), Expect = 5e-06
 Identities = 26/49 (53%), Positives = 29/49 (59%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F D  LK ELLR I   GFE PS +Q   I   I G DV+ QA+SG GK
Sbjct: 47  FRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGK 95



 Score = 39.9 bits (89), Expect = 0.009
 Identities = 21/63 (33%), Positives = 34/63 (53%), Gaps = 1/63 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTNV 430
           KTA F ++ LQQ++    +   L++  TRELA QI K       ++ N K     GG ++
Sbjct: 95  KTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLSI 154

Query: 431 RED 439
           ++D
Sbjct: 155 KKD 157


>AL662847-21|CAI17672.2|  425|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 425

 Score = 50.8 bits (116), Expect = 5e-06
 Identities = 26/49 (53%), Positives = 29/49 (59%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F D  LK ELLR I   GFE PS +Q   I   I G DV+ QA+SG GK
Sbjct: 47  FRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGK 95



 Score = 39.9 bits (89), Expect = 0.009
 Identities = 21/63 (33%), Positives = 34/63 (53%), Gaps = 1/63 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTNV 430
           KTA F ++ LQQ++    +   L++  TRELA QI K       ++ N K     GG ++
Sbjct: 95  KTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLSI 154

Query: 431 RED 439
           ++D
Sbjct: 155 KKD 157


>AL662847-20|CAI17664.2|  428|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 428

 Score = 50.8 bits (116), Expect = 5e-06
 Identities = 26/49 (53%), Positives = 29/49 (59%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F D  LK ELLR I   GFE PS +Q   I   I G DV+ QA+SG GK
Sbjct: 47  FRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGK 95



 Score = 39.9 bits (89), Expect = 0.009
 Identities = 21/63 (33%), Positives = 34/63 (53%), Gaps = 1/63 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTNV 430
           KTA F ++ LQQ++    +   L++  TRELA QI K       ++ N K     GG ++
Sbjct: 95  KTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLSI 154

Query: 431 RED 439
           ++D
Sbjct: 155 KKD 157


>AL662801-15|CAM25579.1|  187|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 187

 Score = 50.8 bits (116), Expect = 5e-06
 Identities = 26/49 (53%), Positives = 29/49 (59%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F D  LK ELLR I   GFE PS +Q   I   I G DV+ QA+SG GK
Sbjct: 70  FRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGK 118



 Score = 39.9 bits (89), Expect = 0.009
 Identities = 21/63 (33%), Positives = 34/63 (53%), Gaps = 1/63 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTNV 430
           KTA F ++ LQQ++    +   L++  TRELA QI K       ++ N K     GG ++
Sbjct: 118 KTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLSI 177

Query: 431 RED 439
           ++D
Sbjct: 178 KKD 180


>AL662801-14|CAI18286.2|  136|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 136

 Score = 50.8 bits (116), Expect = 5e-06
 Identities = 26/49 (53%), Positives = 29/49 (59%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F D  LK ELLR I   GFE PS +Q   I   I G DV+ QA+SG GK
Sbjct: 62  FRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGK 110


>AL662801-13|CAI18279.2|   96|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 96

 Score = 50.8 bits (116), Expect = 5e-06
 Identities = 26/49 (53%), Positives = 29/49 (59%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F D  LK ELLR I   GFE PS +Q   I   I G DV+ QA+SG GK
Sbjct: 47  FRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGK 95


>AL662801-12|CAM25578.1|  132|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 132

 Score = 50.8 bits (116), Expect = 5e-06
 Identities = 26/49 (53%), Positives = 29/49 (59%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F D  LK ELLR I   GFE PS +Q   I   I G DV+ QA+SG GK
Sbjct: 47  FRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGK 95


>AL662801-11|CAM25577.1|  125|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 125

 Score = 50.8 bits (116), Expect = 5e-06
 Identities = 26/49 (53%), Positives = 29/49 (59%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F D  LK ELLR I   GFE PS +Q   I   I G DV+ QA+SG GK
Sbjct: 47  FRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGK 95


>AL662801-10|CAI18285.2|  197|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 197

 Score = 50.8 bits (116), Expect = 5e-06
 Identities = 26/49 (53%), Positives = 29/49 (59%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F D  LK ELLR I   GFE PS +Q   I   I G DV+ QA+SG GK
Sbjct: 47  FRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGK 95


>AL662801-9|CAI18278.2|  238|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 238

 Score = 50.8 bits (116), Expect = 5e-06
 Identities = 26/49 (53%), Positives = 29/49 (59%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F D  LK ELLR I   GFE PS +Q   I   I G DV+ QA+SG GK
Sbjct: 47  FRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGK 95



 Score = 39.9 bits (89), Expect = 0.009
 Identities = 21/63 (33%), Positives = 34/63 (53%), Gaps = 1/63 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTNV 430
           KTA F ++ LQQ++    +   L++  TRELA QI K       ++ N K     GG ++
Sbjct: 95  KTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLSI 154

Query: 431 RED 439
           ++D
Sbjct: 155 KKD 157


>AL662801-8|CAI18281.2|  231|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 231

 Score = 50.8 bits (116), Expect = 5e-06
 Identities = 26/49 (53%), Positives = 29/49 (59%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F D  LK ELLR I   GFE PS +Q   I   I G DV+ QA+SG GK
Sbjct: 47  FRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGK 95



 Score = 39.9 bits (89), Expect = 0.009
 Identities = 21/63 (33%), Positives = 34/63 (53%), Gaps = 1/63 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTNV 430
           KTA F ++ LQQ++    +   L++  TRELA QI K       ++ N K     GG ++
Sbjct: 95  KTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLSI 154

Query: 431 RED 439
           ++D
Sbjct: 155 KKD 157


>AL662801-7|CAI18283.2|  236|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 236

 Score = 50.8 bits (116), Expect = 5e-06
 Identities = 26/49 (53%), Positives = 29/49 (59%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F D  LK ELLR I   GFE PS +Q   I   I G DV+ QA+SG GK
Sbjct: 47  FRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGK 95



 Score = 39.9 bits (89), Expect = 0.009
 Identities = 21/63 (33%), Positives = 34/63 (53%), Gaps = 1/63 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTNV 430
           KTA F ++ LQQ++    +   L++  TRELA QI K       ++ N K     GG ++
Sbjct: 95  KTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLSI 154

Query: 431 RED 439
           ++D
Sbjct: 155 KKD 157


>AL662801-6|CAI18282.2|  289|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 289

 Score = 50.8 bits (116), Expect = 5e-06
 Identities = 26/49 (53%), Positives = 29/49 (59%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F D  LK ELLR I   GFE PS +Q   I   I G DV+ QA+SG GK
Sbjct: 47  FRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGK 95



 Score = 39.9 bits (89), Expect = 0.009
 Identities = 21/63 (33%), Positives = 34/63 (53%), Gaps = 1/63 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTNV 430
           KTA F ++ LQQ++    +   L++  TRELA QI K       ++ N K     GG ++
Sbjct: 95  KTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLSI 154

Query: 431 RED 439
           ++D
Sbjct: 155 KKD 157


>AL662801-4|CAI18284.2|  425|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 425

 Score = 50.8 bits (116), Expect = 5e-06
 Identities = 26/49 (53%), Positives = 29/49 (59%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F D  LK ELLR I   GFE PS +Q   I   I G DV+ QA+SG GK
Sbjct: 47  FRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGK 95



 Score = 39.9 bits (89), Expect = 0.009
 Identities = 21/63 (33%), Positives = 34/63 (53%), Gaps = 1/63 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTNV 430
           KTA F ++ LQQ++    +   L++  TRELA QI K       ++ N K     GG ++
Sbjct: 95  KTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLSI 154

Query: 431 RED 439
           ++D
Sbjct: 155 KKD 157


>AL662801-3|CAI18280.1|  428|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 428

 Score = 50.8 bits (116), Expect = 5e-06
 Identities = 26/49 (53%), Positives = 29/49 (59%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F D  LK ELLR I   GFE PS +Q   I   I G DV+ QA+SG GK
Sbjct: 47  FRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGK 95



 Score = 39.9 bits (89), Expect = 0.009
 Identities = 21/63 (33%), Positives = 34/63 (53%), Gaps = 1/63 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTNV 430
           KTA F ++ LQQ++    +   L++  TRELA QI K       ++ N K     GG ++
Sbjct: 95  KTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLSI 154

Query: 431 RED 439
           ++D
Sbjct: 155 KKD 157


>AK222912-1|BAD96632.1|  428|Homo sapiens HLA-B associated
           transcript 1 variant protein.
          Length = 428

 Score = 50.8 bits (116), Expect = 5e-06
 Identities = 26/49 (53%), Positives = 29/49 (59%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F D  LK ELLR I   GFE PS +Q   I   I G DV+ QA+SG GK
Sbjct: 47  FRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGK 95



 Score = 39.9 bits (89), Expect = 0.009
 Identities = 21/63 (33%), Positives = 34/63 (53%), Gaps = 1/63 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTNV 430
           KTA F ++ LQQ++    +   L++  TRELA QI K       ++ N K     GG ++
Sbjct: 95  KTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLSI 154

Query: 431 RED 439
           ++D
Sbjct: 155 KKD 157


>AK026614-1|BAB15509.1|  461|Homo sapiens protein ( Homo sapiens
           cDNA: FLJ22961 fis, clone KAT10214. ).
          Length = 461

 Score = 50.8 bits (116), Expect = 5e-06
 Identities = 26/49 (53%), Positives = 29/49 (59%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F D  LK ELLR I   GFE PS +Q   I   I G DV+ QA+SG GK
Sbjct: 80  FRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGK 128



 Score = 37.9 bits (84), Expect = 0.037
 Identities = 21/63 (33%), Positives = 34/63 (53%), Gaps = 1/63 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTNV 430
           KTA F ++ LQQI+    +   L++  TRELA QI K       ++ + K     GG ++
Sbjct: 128 KTAVFVLATLQQIEPVNGQVTVLVMCHTRELAFQISKEYERFSKYMPSVKVSVFFGGLSI 187

Query: 431 RED 439
           ++D
Sbjct: 188 KKD 190


>AB209217-1|BAD92454.1|  310|Homo sapiens HLA-B associated
           transcript 1 variant protein.
          Length = 310

 Score = 50.8 bits (116), Expect = 5e-06
 Identities = 26/49 (53%), Positives = 29/49 (59%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F D  LK ELLR I   GFE PS +Q   I   I G DV+ QA+SG GK
Sbjct: 67  FRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGK 115



 Score = 39.9 bits (89), Expect = 0.009
 Identities = 21/63 (33%), Positives = 34/63 (53%), Gaps = 1/63 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTNV 430
           KTA F ++ LQQ++    +   L++  TRELA QI K       ++ N K     GG ++
Sbjct: 115 KTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLSI 174

Query: 431 RED 439
           ++D
Sbjct: 175 KKD 177


>AB202112-3|BAE78637.1|  428|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 428

 Score = 50.8 bits (116), Expect = 5e-06
 Identities = 26/49 (53%), Positives = 29/49 (59%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F D  LK ELLR I   GFE PS +Q   I   I G DV+ QA+SG GK
Sbjct: 47  FRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGK 95



 Score = 39.9 bits (89), Expect = 0.009
 Identities = 21/63 (33%), Positives = 34/63 (53%), Gaps = 1/63 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTNV 430
           KTA F ++ LQQ++    +   L++  TRELA QI K       ++ N K     GG ++
Sbjct: 95  KTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLSI 154

Query: 431 RED 439
           ++D
Sbjct: 155 KKD 157


>AB103621-3|BAF31287.1|  443|Homo sapiens BAT1 protein protein.
          Length = 443

 Score = 50.8 bits (116), Expect = 5e-06
 Identities = 26/49 (53%), Positives = 29/49 (59%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F D  LK ELLR I   GFE PS +Q   I   I G DV+ QA+SG GK
Sbjct: 47  FRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGK 95


>AB088115-3|BAC54953.1|  428|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 428

 Score = 50.8 bits (116), Expect = 5e-06
 Identities = 26/49 (53%), Positives = 29/49 (59%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F D  LK ELLR I   GFE PS +Q   I   I G DV+ QA+SG GK
Sbjct: 47  FRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGK 95



 Score = 39.9 bits (89), Expect = 0.009
 Identities = 21/63 (33%), Positives = 34/63 (53%), Gaps = 1/63 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTNV 430
           KTA F ++ LQQ++    +   L++  TRELA QI K       ++ N K     GG ++
Sbjct: 95  KTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLSI 154

Query: 431 RED 439
           ++D
Sbjct: 155 KKD 157


>D26528-1|BAA05534.1|  439|Homo sapiens RNA helicase protein.
          Length = 439

 Score = 49.2 bits (112), Expect = 1e-05
 Identities = 26/73 (35%), Positives = 39/73 (53%)
 Frame = +2

Query: 236 SPVRNWKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACI 415
           +P    KT  F + IL +ID  +++ Q LILAP++ELA Q   V    G  ++    + I
Sbjct: 39  APTGTGKTLAFLLPILSRIDPKVKQTQVLILAPSQELAMQTTAVAREWGALVDVSVTSLI 98

Query: 416 GGTNVREDIRQLE 454
           GG N R    +L+
Sbjct: 99  GGANGRRQADKLK 111


>BC130275-1|AAI30276.1|  796|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 27 protein.
          Length = 796

 Score = 49.2 bits (112), Expect = 1e-05
 Identities = 23/50 (46%), Positives = 33/50 (66%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           +F DMNL   LL+ I A GF++P+ IQ+  I   + G+D+ A A +GTGK
Sbjct: 219 SFQDMNLSRPLLKAITAMGFKQPTPIQKACIPVGLLGKDICACAATGTGK 268



 Score = 37.5 bits (83), Expect = 0.048
 Identities = 20/63 (31%), Positives = 33/63 (52%), Gaps = 3/63 (4%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIREC---QALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGT 424
           KTA F++ +L+++    R+    + L+L PTREL  Q+  V   L    N      +GG 
Sbjct: 268 KTAAFALPVLERLIYKPRQAPVTRVLVLVPTRELGIQVHSVTRQLAQFCNITTCLAVGGL 327

Query: 425 NVR 433
           +V+
Sbjct: 328 DVK 330


>BC126287-1|AAI26288.1|  796|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 27 protein.
          Length = 796

 Score = 49.2 bits (112), Expect = 1e-05
 Identities = 23/50 (46%), Positives = 33/50 (66%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           +F DMNL   LL+ I A GF++P+ IQ+  I   + G+D+ A A +GTGK
Sbjct: 219 SFQDMNLSRPLLKAITAMGFKQPTPIQKACIPVGLLGKDICACAATGTGK 268



 Score = 37.5 bits (83), Expect = 0.048
 Identities = 20/63 (31%), Positives = 33/63 (52%), Gaps = 3/63 (4%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIREC---QALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGT 424
           KTA F++ +L+++    R+    + L+L PTREL  Q+  V   L    N      +GG 
Sbjct: 268 KTAAFALPVLERLIYKPRQAPVTRVLVLVPTRELGIQVHSVTRQLAQFCNITTCLAVGGL 327

Query: 425 NVR 433
           +V+
Sbjct: 328 DVK 330


>BC016060-1|AAH16060.2|  767|Homo sapiens DDX27 protein protein.
          Length = 767

 Score = 49.2 bits (112), Expect = 1e-05
 Identities = 23/50 (46%), Positives = 33/50 (66%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           +F DMNL   LL+ I A GF++P+ IQ+  I   + G+D+ A A +GTGK
Sbjct: 190 SFQDMNLSRPLLKAITAMGFKQPTPIQKACIPVGLLGKDICACAATGTGK 239



 Score = 37.5 bits (83), Expect = 0.048
 Identities = 20/63 (31%), Positives = 33/63 (52%), Gaps = 3/63 (4%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIREC---QALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGT 424
           KTA F++ +L+++    R+    + L+L PTREL  Q+  V   L    N      +GG 
Sbjct: 239 KTAAFALPVLERLIYKPRQAPVTRVLVLVPTRELGIQVHSVTRQLAQFCNITTCLAVGGL 298

Query: 425 NVR 433
           +V+
Sbjct: 299 DVK 301


>BC011927-1|AAH11927.2|  767|Homo sapiens DDX27 protein protein.
          Length = 767

 Score = 49.2 bits (112), Expect = 1e-05
 Identities = 23/50 (46%), Positives = 33/50 (66%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           +F DMNL   LL+ I A GF++P+ IQ+  I   + G+D+ A A +GTGK
Sbjct: 190 SFQDMNLSRPLLKAITAMGFKQPTPIQKACIPVGLLGKDICACAATGTGK 239



 Score = 37.5 bits (83), Expect = 0.048
 Identities = 20/63 (31%), Positives = 33/63 (52%), Gaps = 3/63 (4%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIREC---QALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGT 424
           KTA F++ +L+++    R+    + L+L PTREL  Q+  V   L    N      +GG 
Sbjct: 239 KTAAFALPVLERLIYKPRQAPVTRVLVLVPTRELGIQVHSVTRQLAQFCNITTCLAVGGL 298

Query: 425 NVR 433
           +V+
Sbjct: 299 DVK 301


>BC009304-1|AAH09304.2|  769|Homo sapiens DDX27 protein protein.
          Length = 769

 Score = 49.2 bits (112), Expect = 1e-05
 Identities = 23/50 (46%), Positives = 33/50 (66%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           +F DMNL   LL+ I A GF++P+ IQ+  I   + G+D+ A A +GTGK
Sbjct: 192 SFQDMNLSRPLLKAITAMGFKQPTPIQKACIPVGLLGKDICACAATGTGK 241



 Score = 37.5 bits (83), Expect = 0.048
 Identities = 20/63 (31%), Positives = 33/63 (52%), Gaps = 3/63 (4%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIREC---QALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGT 424
           KTA F++ +L+++    R+    + L+L PTREL  Q+  V   L    N      +GG 
Sbjct: 241 KTAAFALPVLERLIYKPRQAPVTRVLVLVPTRELGIQVHSVTRQLAQFCNITTCLAVGGL 300

Query: 425 NVR 433
           +V+
Sbjct: 301 DVK 303


>AY044431-1|AAK95821.1|  796|Homo sapiens RNA helicase-like protein
           protein.
          Length = 796

 Score = 49.2 bits (112), Expect = 1e-05
 Identities = 23/50 (46%), Positives = 33/50 (66%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           +F DMNL   LL+ I A GF++P+ IQ+  I   + G+D+ A A +GTGK
Sbjct: 219 SFQDMNLSRPLLKAITAMGFKQPTPIQKACIPVGLLGKDICACAATGTGK 268



 Score = 37.5 bits (83), Expect = 0.048
 Identities = 20/63 (31%), Positives = 33/63 (52%), Gaps = 3/63 (4%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIREC---QALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGT 424
           KTA F++ +L+++    R+    + L+L PTREL  Q+  V   L    N      +GG 
Sbjct: 268 KTAAFALPVLERLIYKPRQAPVTRVLVLVPTRELGIQVHSVTRQLAQFCNITTCLAVGGL 327

Query: 425 NVR 433
           +V+
Sbjct: 328 DVK 330


>AL357560-1|CAH70236.1|  796|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 27 protein.
          Length = 796

 Score = 49.2 bits (112), Expect = 1e-05
 Identities = 23/50 (46%), Positives = 33/50 (66%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           +F DMNL   LL+ I A GF++P+ IQ+  I   + G+D+ A A +GTGK
Sbjct: 219 SFQDMNLSRPLLKAITAMGFKQPTPIQKACIPVGLLGKDICACAATGTGK 268



 Score = 37.5 bits (83), Expect = 0.048
 Identities = 20/63 (31%), Positives = 33/63 (52%), Gaps = 3/63 (4%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIREC---QALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGT 424
           KTA F++ +L+++    R+    + L+L PTREL  Q+  V   L    N      +GG 
Sbjct: 268 KTAAFALPVLERLIYKPRQAPVTRVLVLVPTRELGIQVHSVTRQLAQFCNITTCLAVGGL 327

Query: 425 NVR 433
           +V+
Sbjct: 328 DVK 330


>AL049766-1|CAI22427.1|  796|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 27 protein.
          Length = 796

 Score = 49.2 bits (112), Expect = 1e-05
 Identities = 23/50 (46%), Positives = 33/50 (66%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           +F DMNL   LL+ I A GF++P+ IQ+  I   + G+D+ A A +GTGK
Sbjct: 219 SFQDMNLSRPLLKAITAMGFKQPTPIQKACIPVGLLGKDICACAATGTGK 268



 Score = 37.5 bits (83), Expect = 0.048
 Identities = 20/63 (31%), Positives = 33/63 (52%), Gaps = 3/63 (4%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIREC---QALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGT 424
           KTA F++ +L+++    R+    + L+L PTREL  Q+  V   L    N      +GG 
Sbjct: 268 KTAAFALPVLERLIYKPRQAPVTRVLVLVPTRELGIQVHSVTRQLAQFCNITTCLAVGGL 327

Query: 425 NVR 433
           +V+
Sbjct: 328 DVK 330


>AK022979-1|BAB14343.1|  765|Homo sapiens protein ( Homo sapiens
           cDNA FLJ12917 fis, clone NT2RP2004568, weakly similar to
           PUTATIVE ATP-DEPENDENT RNA HELICASE C30D11.03. ).
          Length = 765

 Score = 49.2 bits (112), Expect = 1e-05
 Identities = 23/50 (46%), Positives = 33/50 (66%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           +F DMNL   LL+ I A GF++P+ IQ+  I   + G+D+ A A +GTGK
Sbjct: 188 SFQDMNLSRPLLKAITAMGFKQPTPIQKACIPVGLLGKDICACAATGTGK 237



 Score = 37.5 bits (83), Expect = 0.048
 Identities = 20/63 (31%), Positives = 33/63 (52%), Gaps = 3/63 (4%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIREC---QALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGT 424
           KTA F++ +L+++    R+    + L+L PTREL  Q+  V   L    N      +GG 
Sbjct: 237 KTAAFALPVLERLIYKPRQAPVTRVLVLVPTRELGIQVHSVTRQLAQFCNITTCLAVGGL 296

Query: 425 NVR 433
           +V+
Sbjct: 297 DVK 299


>U90426-1|AAB50231.1|  427|Homo sapiens nuclear RNA helicase
           protein.
          Length = 427

 Score = 48.4 bits (110), Expect = 3e-05
 Identities = 25/49 (51%), Positives = 28/49 (57%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F D  LK ELLR I   G E PS +Q   I   I G DV+ QA+SG GK
Sbjct: 46  FRDFLLKPELLRAIVDCGLEHPSEVQHECIPQAILGMDVLCQAKSGMGK 94



 Score = 37.9 bits (84), Expect = 0.037
 Identities = 21/63 (33%), Positives = 34/63 (53%), Gaps = 1/63 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTNV 430
           KTA F ++ LQQI+    +   L++  TRELA QI K       ++ + K     GG ++
Sbjct: 94  KTAVFVLATLQQIEPVNGQVTVLVMCHTRELAFQISKEYERFSKYMPSVKVSVFFGGLSI 153

Query: 431 RED 439
           ++D
Sbjct: 154 KKD 156


>BC001235-1|AAH01235.1|  547|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 56 protein.
          Length = 547

 Score = 45.6 bits (103), Expect = 2e-04
 Identities = 18/49 (36%), Positives = 35/49 (71%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F+ M L   LL+ +   G+ +P+ IQ++AI   ++G+D++A+A++G+GK
Sbjct: 9   FEHMGLDPRLLQAVTDLGWSRPTLIQEKAIPLALEGKDLLARARTGSGK 57


>AK222662-1|BAD96382.1|  547|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 56 variant protein.
          Length = 547

 Score = 45.6 bits (103), Expect = 2e-04
 Identities = 18/49 (36%), Positives = 35/49 (71%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F+ M L   LL+ +   G+ +P+ IQ++AI   ++G+D++A+A++G+GK
Sbjct: 9   FEHMGLDPRLLQAVTDLGWSRPTLIQEKAIPLALEGKDLLARARTGSGK 57


>AK022774-1|BAB14238.1|  547|Homo sapiens protein ( Homo sapiens
           cDNA FLJ12712 fis, clone NT2RP1001080, weakly similar to
           PROBABLE ATP-DEPENDENT RNA HELICASE DBP9. ).
          Length = 547

 Score = 45.6 bits (103), Expect = 2e-04
 Identities = 18/49 (36%), Positives = 35/49 (71%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F+ M L   LL+ +   G+ +P+ IQ++AI   ++G+D++A+A++G+GK
Sbjct: 9   FEHMGLDPRLLQAVTDLGWSRPTLIQEKAIPLALEGKDLLARARTGSGK 57


>AJ131712-1|CAB87992.1|  547|Homo sapiens nucleolar RNA-helicase
           protein.
          Length = 547

 Score = 45.6 bits (103), Expect = 2e-04
 Identities = 18/49 (36%), Positives = 35/49 (71%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F+ M L   LL+ +   G+ +P+ IQ++AI   ++G+D++A+A++G+GK
Sbjct: 9   FEHMGLDPRLLQAVTDLGWSRPTLIQEKAIPLALEGKDLLARARTGSGK 57


>AF247666-1|AAG36876.1|  547|Homo sapiens DEAD-box RNA helicase
           protein.
          Length = 547

 Score = 45.6 bits (103), Expect = 2e-04
 Identities = 18/49 (36%), Positives = 35/49 (71%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F+ M L   LL+ +   G+ +P+ IQ++AI   ++G+D++A+A++G+GK
Sbjct: 9   FEHMGLDPRLLQAVTDLGWSRPTLIQEKAIPLALEGKDLLARARTGSGK 57


>BC066938-1|AAH66938.1|  648|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 43 protein.
          Length = 648

 Score = 44.8 bits (101), Expect = 3e-04
 Identities = 25/56 (44%), Positives = 33/56 (58%), Gaps = 1/56 (1%)
 Frame = +3

Query: 108 TFDD-MNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSL 272
           TFDD      E++  I   GF+KP+ IQ +A    +QG D+I  AQ+GTGK L  L
Sbjct: 242 TFDDAFQCYPEVMENIKKAGFQKPTPIQSQAWPIVLQGIDLIGVAQTGTGKTLCYL 297


>AJ278110-1|CAB92442.1|  648|Homo sapiens DEAD-box protein protein.
          Length = 648

 Score = 44.8 bits (101), Expect = 3e-04
 Identities = 25/56 (44%), Positives = 33/56 (58%), Gaps = 1/56 (1%)
 Frame = +3

Query: 108 TFDD-MNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSL 272
           TFDD      E++  I   GF+KP+ IQ +A    +QG D+I  AQ+GTGK L  L
Sbjct: 242 TFDDAFQCYPEVMENIKKAGFQKPTPIQSQAWPIVLQGIDLIGVAQTGTGKTLCYL 297


>EF036507-1|ABO65093.1|  182|Homo sapiens DEAD box polypeptide 47
           isoform 1 variant protein.
          Length = 182

 Score = 44.0 bits (99), Expect = 6e-04
 Identities = 20/55 (36%), Positives = 33/55 (60%)
 Frame = +3

Query: 93  DQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           ++  +TF D+ + + L       G+ KP+ IQ  AI   +QGRD+I  A++G+GK
Sbjct: 9   EEETKTFKDLGVTDVLCEACDQLGWTKPTKIQIEAIPLALQGRDIIGLAETGSGK 63



 Score = 40.3 bits (90), Expect = 0.007
 Identities = 21/56 (37%), Positives = 31/56 (55%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGG 421
           KT  F++ IL  +  + +   AL+L PTRELA QI +   ALG  +  +    +GG
Sbjct: 63  KTGAFALPILNALLETPQRLFALVLTPTRELAFQISEQFEALGSSIGVQSAVIVGG 118


>BC068009-1|AAH68009.1|  455|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 47 protein.
          Length = 455

 Score = 44.0 bits (99), Expect = 6e-04
 Identities = 20/55 (36%), Positives = 33/55 (60%)
 Frame = +3

Query: 93  DQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           ++  +TF D+ + + L       G+ KP+ IQ  AI   +QGRD+I  A++G+GK
Sbjct: 20  EEETKTFKDLGVTDVLCEACDQLGWTKPTKIQIEAIPLALQGRDIIGLAETGSGK 74



 Score = 40.3 bits (90), Expect = 0.007
 Identities = 21/56 (37%), Positives = 31/56 (55%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGG 421
           KT  F++ IL  +  + +   AL+L PTRELA QI +   ALG  +  +    +GG
Sbjct: 74  KTGAFALPILNALLETPQRLFALVLTPTRELAFQISEQFEALGSSIGVQSAVIVGG 129


>BC009379-1|AAH09379.2|  450|Homo sapiens DDX47 protein protein.
          Length = 450

 Score = 44.0 bits (99), Expect = 6e-04
 Identities = 20/55 (36%), Positives = 33/55 (60%)
 Frame = +3

Query: 93  DQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           ++  +TF D+ + + L       G+ KP+ IQ  AI   +QGRD+I  A++G+GK
Sbjct: 15  EEETKTFKDLGVTDVLCEACDQLGWTKPTKIQIEAIPLALQGRDIIGLAETGSGK 69



 Score = 40.3 bits (90), Expect = 0.007
 Identities = 21/56 (37%), Positives = 31/56 (55%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGG 421
           KT  F++ IL  +  + +   AL+L PTRELA QI +   ALG  +  +    +GG
Sbjct: 69  KTGAFALPILNALLETPQRLFALVLTPTRELAFQISEQFEALGSSIGVQSAVIVGG 124


>BC005848-1|AAH05848.2|  864|Homo sapiens DDX54 protein protein.
          Length = 864

 Score = 44.0 bits (99), Expect = 6e-04
 Identities = 19/60 (31%), Positives = 34/60 (56%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSLYRFYNK 290
           F  M L   + +GI   G++ P+ IQ++ I   + G+DV+A A++G+GK    L   + +
Sbjct: 81  FQSMGLSYPVFKGIMKKGYKVPTPIQRKTIPVILDGKDVVAMARTGSGKTACFLLPMFER 140



 Score = 38.3 bits (85), Expect = 0.028
 Identities = 23/68 (33%), Positives = 34/68 (50%), Gaps = 2/68 (2%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRE--CQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTN 427
           KTA F + + +++ T   +   +ALIL+PTRELA Q  K    LG     K    +GG  
Sbjct: 129 KTACFLLPMFERLKTHSAQTGARALILSPTRELALQTLKFTKELGKFTGLKTALILGGDR 188

Query: 428 VREDIRQL 451
           + +    L
Sbjct: 189 MEDQFAAL 196


>AY148094-1|AAN59978.1|  865|Homo sapiens DEAD box RNA helicase DP97
           protein.
          Length = 865

 Score = 44.0 bits (99), Expect = 6e-04
 Identities = 19/60 (31%), Positives = 34/60 (56%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSLYRFYNK 290
           F  M L   + +GI   G++ P+ IQ++ I   + G+DV+A A++G+GK    L   + +
Sbjct: 82  FQSMGLSYPVFKGIMKKGYKVPTPIQRKTIPVILDGKDVVAMARTGSGKTACFLLPMFER 141



 Score = 38.3 bits (85), Expect = 0.028
 Identities = 23/68 (33%), Positives = 34/68 (50%), Gaps = 2/68 (2%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRE--CQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTN 427
           KTA F + + +++ T   +   +ALIL+PTRELA Q  K    LG     K    +GG  
Sbjct: 130 KTACFLLPMFERLKTHSAQTGARALILSPTRELALQTLKFTKELGKFTGLKTALILGGDR 189

Query: 428 VREDIRQL 451
           + +    L
Sbjct: 190 MEDQFAAL 197


>AL136666-1|CAB66601.1|  455|Homo sapiens hypothetical protein
           protein.
          Length = 455

 Score = 44.0 bits (99), Expect = 6e-04
 Identities = 20/55 (36%), Positives = 33/55 (60%)
 Frame = +3

Query: 93  DQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           ++  +TF D+ + + L       G+ KP+ IQ  AI   +QGRD+I  A++G+GK
Sbjct: 20  EEETKTFKDLGVTDVLCEACDQLGWTKPTKIQIEAIPLALQGRDIIGLAETGSGK 74



 Score = 40.3 bits (90), Expect = 0.007
 Identities = 21/56 (37%), Positives = 31/56 (55%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGG 421
           KT  F++ IL  +  + +   AL+L PTRELA QI +   ALG  +  +    +GG
Sbjct: 74  KTGAFALPILNALLETPQRLFALVLTPTRELAFQISEQFEALGSSIGVQSAVIVGG 129


>AK222940-1|BAD96660.1|  448|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 47 isoform 1 variant protein.
          Length = 448

 Score = 44.0 bits (99), Expect = 6e-04
 Identities = 20/55 (36%), Positives = 33/55 (60%)
 Frame = +3

Query: 93  DQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           ++  +TF D+ + + L       G+ KP+ IQ  AI   +QGRD+I  A++G+GK
Sbjct: 13  EEETKTFKDLGVTDVLCEACDQLGWTKPTKIQIEAIPLALQGRDIIGLAETGSGK 67



 Score = 40.3 bits (90), Expect = 0.007
 Identities = 21/56 (37%), Positives = 31/56 (55%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGG 421
           KT  F++ IL  +  + +   AL+L PTRELA QI +   ALG  +  +    +GG
Sbjct: 67  KTGAFALPILNALLETPQRLFALVLTPTRELAFQISEQFEALGSSIGVQSAVIVGG 122


>AJ276704-1|CAC14786.1|  455|Homo sapiens DEAD box protein protein.
          Length = 455

 Score = 44.0 bits (99), Expect = 6e-04
 Identities = 20/55 (36%), Positives = 33/55 (60%)
 Frame = +3

Query: 93  DQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           ++  +TF D+ + + L       G+ KP+ IQ  AI   +QGRD+I  A++G+GK
Sbjct: 20  EEETKTFKDLGVTDVLCEACDQLGWTKPTKIQIEAIPLALQGRDIIGLAETGSGK 74



 Score = 40.3 bits (90), Expect = 0.007
 Identities = 21/56 (37%), Positives = 31/56 (55%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGG 421
           KT  F++ IL  +  + +   AL+L PTRELA QI +   ALG  +  +    +GG
Sbjct: 74  KTGAFALPILNALLETPQRLFALVLTPTRELAFQISEQFEALGSSIGVQSAVIVGG 129


>AF478457-1|AAL85336.1|  882|Homo sapiens ATP-dependent RNA helicase
           protein.
          Length = 882

 Score = 44.0 bits (99), Expect = 6e-04
 Identities = 19/60 (31%), Positives = 34/60 (56%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSLYRFYNK 290
           F  M L   + +GI   G++ P+ IQ++ I   + G+DV+A A++G+GK    L   + +
Sbjct: 98  FQSMGLSYPVFKGIMKKGYKVPTPIQRKTIPVILDGKDVVAMARTGSGKTACFLLPMFER 157



 Score = 38.3 bits (85), Expect = 0.028
 Identities = 23/68 (33%), Positives = 34/68 (50%), Gaps = 2/68 (2%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRE--CQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTN 427
           KTA F + + +++ T   +   +ALIL+PTRELA Q  K    LG     K    +GG  
Sbjct: 146 KTACFLLPMFERLKTHSAQTGARALILSPTRELALQTLKFTKELGKFTGLKTALILGGDR 205

Query: 428 VREDIRQL 451
           + +    L
Sbjct: 206 MEDQFAAL 213


>AF193054-1|AAG22482.1|  312|Homo sapiens unknown protein.
          Length = 312

 Score = 44.0 bits (99), Expect = 6e-04
 Identities = 21/46 (45%), Positives = 30/46 (65%)
 Frame = +3

Query: 120 MNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           MNL   LL+ I A GF++P+ IQ+  I   + G+D+ A A +GTGK
Sbjct: 1   MNLSRPLLKAITAMGFKQPTPIQKACIPVGLLGKDICACAATGTGK 46



 Score = 37.5 bits (83), Expect = 0.048
 Identities = 20/63 (31%), Positives = 33/63 (52%), Gaps = 3/63 (4%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIREC---QALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGT 424
           KTA F++ +L+++    R+    + L+L PTREL  Q+  V   L    N      +GG 
Sbjct: 46  KTAAFALPVLERLIYKPRQAPVTRVLVLVPTRELGIQVHSVTRQLAQFCNITTCLAVGGL 105

Query: 425 NVR 433
           +V+
Sbjct: 106 DVK 108


>BC041785-1|AAH41785.1|  599|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 52 protein.
          Length = 599

 Score = 43.6 bits (98), Expect = 7e-04
 Identities = 26/68 (38%), Positives = 38/68 (55%), Gaps = 1/68 (1%)
 Frame = +2

Query: 206 LHPRTRCYRSSPVRNWKTATFSISILQQIDTSIRE-CQALILAPTRELAQQIQKVVIALG 382
           LH R     S+P  + KT  FSI IL Q+     +  +ALI++PTRELA QI + +I + 
Sbjct: 200 LHGR-ELLASAPTGSGKTLAFSIPILMQLKQPANKGFRALIISPTRELASQIHRELIKIS 258

Query: 383 DHLNAKCH 406
           +    + H
Sbjct: 259 EGTGFRIH 266



 Score = 42.3 bits (95), Expect = 0.002
 Identities = 22/64 (34%), Positives = 36/64 (56%), Gaps = 4/64 (6%)
 Frame = +3

Query: 84  TDWDQVVETFDDMN----LKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGT 251
           TD    + TF  ++    +   LL+ I   GF+ P+ IQ +AI   + GR+++A A +G+
Sbjct: 154 TDLPDPIATFQQLDQEYKINSRLLQNILDAGFQMPTPIQMQAIPVMLHGRELLASAPTGS 213

Query: 252 GKLL 263
           GK L
Sbjct: 214 GKTL 217


>BC002366-1|AAH02366.1|  820|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 23 protein.
          Length = 820

 Score = 43.6 bits (98), Expect = 7e-04
 Identities = 25/53 (47%), Positives = 34/53 (64%)
 Frame = +2

Query: 281 LQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVRED 439
           + +I+ S +   A+ILAPTRELAQQI++  I  G  L  +  A IGG + RED
Sbjct: 459 IDRIEESDQGPYAIILAPTRELAQQIEEETIKFGKPLGIRTVAVIGGIS-RED 510



 Score = 40.3 bits (90), Expect = 0.007
 Identities = 18/52 (34%), Positives = 34/52 (65%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           + ++ D +L   +L  I   G+++P+ IQ++AI   +Q RD+I  A++G+GK
Sbjct: 390 IRSWKDSSLPPHILEVIDKCGYKEPTPIQRQAIPIGLQNRDIIGVAETGSGK 441


>AK093661-1|BAC04214.1|  360|Homo sapiens protein ( Homo sapiens
           cDNA FLJ36342 fis, clone THYMU2006666, highly similar to
           Homo sapiens putative ATP-dependent RNA helicase ROK1
           mRNA. ).
          Length = 360

 Score = 43.6 bits (98), Expect = 7e-04
 Identities = 26/68 (38%), Positives = 38/68 (55%), Gaps = 1/68 (1%)
 Frame = +2

Query: 206 LHPRTRCYRSSPVRNWKTATFSISILQQIDTSIRE-CQALILAPTRELAQQIQKVVIALG 382
           LH R     S+P  + KT  FSI IL Q+     +  +ALI++PTRELA QI + +I + 
Sbjct: 92  LHGR-ELLASAPTGSGKTLAFSIPILMQLKQPANKGFRALIISPTRELASQIHRELIKIS 150

Query: 383 DHLNAKCH 406
           +    + H
Sbjct: 151 EGTGFRIH 158



 Score = 42.3 bits (95), Expect = 0.002
 Identities = 22/64 (34%), Positives = 36/64 (56%), Gaps = 4/64 (6%)
 Frame = +3

Query: 84  TDWDQVVETFDDMN----LKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGT 251
           TD    + TF  ++    +   LL+ I   GF+ P+ IQ +AI   + GR+++A A +G+
Sbjct: 46  TDLPDPIATFQQLDQEYKINSRLLQNILDAGFQMPTPIQMQAIPVMLHGRELLASAPTGS 105

Query: 252 GKLL 263
           GK L
Sbjct: 106 GKTL 109


>AK054574-1|BAB70762.1|  455|Homo sapiens protein ( Homo sapiens
           cDNA FLJ30012 fis, clone 3NB692000281, moderately
           similar to PUTATIVE ATP-DEPENDENT RNA HELICASE T26G10.1
           IN CHROMOSOME III. ).
          Length = 455

 Score = 43.6 bits (98), Expect = 7e-04
 Identities = 19/55 (34%), Positives = 33/55 (60%)
 Frame = +3

Query: 93  DQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           ++  +TF D+ + + L       G+ KP+ IQ  A+   +QGRD+I  A++G+GK
Sbjct: 20  EEETKTFKDLGVTDVLCEACDQLGWTKPTKIQIEAVPLALQGRDIIGLAETGSGK 74



 Score = 40.3 bits (90), Expect = 0.007
 Identities = 21/56 (37%), Positives = 31/56 (55%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGG 421
           KT  F++ IL  +  + +   AL+L PTRELA QI +   ALG  +  +    +GG
Sbjct: 74  KTGAFALPILNALLETPQRLFALVLTPTRELAFQISEQFEALGSSIGVQSAVIVGG 129


>AK001652-1|BAA91812.1|  491|Homo sapiens protein ( Homo sapiens
           cDNA FLJ10790 fis, clone NT2RP4000518, weakly similar to
           ATP-DEPENDENT RNA HELICASE ROK1. ).
          Length = 491

 Score = 43.6 bits (98), Expect = 7e-04
 Identities = 26/68 (38%), Positives = 38/68 (55%), Gaps = 1/68 (1%)
 Frame = +2

Query: 206 LHPRTRCYRSSPVRNWKTATFSISILQQIDTSIRE-CQALILAPTRELAQQIQKVVIALG 382
           LH R     S+P  + KT  FSI IL Q+     +  +ALI++PTRELA QI + +I + 
Sbjct: 92  LHGR-ELLASAPTGSGKTLAFSIPILMQLKQPANKGFRALIISPTRELASQIHRELIKIS 150

Query: 383 DHLNAKCH 406
           +    + H
Sbjct: 151 EGTGFRIH 158



 Score = 42.3 bits (95), Expect = 0.002
 Identities = 22/64 (34%), Positives = 36/64 (56%), Gaps = 4/64 (6%)
 Frame = +3

Query: 84  TDWDQVVETFDDMN----LKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGT 251
           TD    + TF  ++    +   LL+ I   GF+ P+ IQ +AI   + GR+++A A +G+
Sbjct: 46  TDLPDPIATFQQLDQEYKINSRLLQNILDAGFQMPTPIQMQAIPVMLHGRELLASAPTGS 105

Query: 252 GKLL 263
           GK L
Sbjct: 106 GKTL 109


>AJ010840-1|CAA09374.1|  420|Homo sapiens ATP-dependent RNA helicase
           protein.
          Length = 420

 Score = 43.6 bits (98), Expect = 7e-04
 Identities = 26/68 (38%), Positives = 38/68 (55%), Gaps = 1/68 (1%)
 Frame = +2

Query: 206 LHPRTRCYRSSPVRNWKTATFSISILQQIDTSIRE-CQALILAPTRELAQQIQKVVIALG 382
           LH R     S+P  + KT  FSI IL Q+     +  +ALI++PTRELA QI + +I + 
Sbjct: 21  LHGR-ELLASAPTGSGKTLAFSIPILMQLKQPANKGFRALIISPTRELASQIHRELIKIS 79

Query: 383 DHLNAKCH 406
           +    + H
Sbjct: 80  EGTGFRIH 87



 Score = 36.3 bits (80), Expect = 0.11
 Identities = 15/34 (44%), Positives = 24/34 (70%)
 Frame = +3

Query: 162 GFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLL 263
           GF+ P+ IQ +AI   + GR+++A A +G+GK L
Sbjct: 5   GFQMPTPIQMQAIPVMLHGRELLASAPTGSGKTL 38


>AF026402-1|AAB87902.1|  820|Homo sapiens U5 snRNP 100 kD protein
           protein.
          Length = 820

 Score = 43.6 bits (98), Expect = 7e-04
 Identities = 25/53 (47%), Positives = 34/53 (64%)
 Frame = +2

Query: 281 LQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVRED 439
           + +I+ S +   A+ILAPTRELAQQI++  I  G  L  +  A IGG + RED
Sbjct: 459 IDRIEESDQGPYAIILAPTRELAQQIEEETIKFGKPLGIRTVAVIGGIS-RED 510



 Score = 40.3 bits (90), Expect = 0.007
 Identities = 18/52 (34%), Positives = 34/52 (65%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           + ++ D +L   +L  I   G+++P+ IQ++AI   +Q RD+I  A++G+GK
Sbjct: 390 IRSWKDSSLPPHILEVIDKCGYKEPTPIQRQAIPIGLQNRDIIGVAETGSGK 441


>AB208938-1|BAD92175.1|  512|Homo sapiens ATP-dependent RNA helicase
           ROK1 isoform a variant protein.
          Length = 512

 Score = 43.6 bits (98), Expect = 7e-04
 Identities = 26/68 (38%), Positives = 38/68 (55%), Gaps = 1/68 (1%)
 Frame = +2

Query: 206 LHPRTRCYRSSPVRNWKTATFSISILQQIDTSIRE-CQALILAPTRELAQQIQKVVIALG 382
           LH R     S+P  + KT  FSI IL Q+     +  +ALI++PTRELA QI + +I + 
Sbjct: 199 LHGR-ELLASAPTGSGKTLAFSIPILMQLKQPANKGFRALIISPTRELASQIHRELIKIS 257

Query: 383 DHLNAKCH 406
           +    + H
Sbjct: 258 EGTGFRIH 265



 Score = 42.3 bits (95), Expect = 0.002
 Identities = 22/64 (34%), Positives = 36/64 (56%), Gaps = 4/64 (6%)
 Frame = +3

Query: 84  TDWDQVVETFDDMN----LKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGT 251
           TD    + TF  ++    +   LL+ I   GF+ P+ IQ +AI   + GR+++A A +G+
Sbjct: 153 TDLPDPIATFQQLDQEYKINSRLLQNILDAGFQMPTPIQMQAIPVMLHGRELLASAPTGS 212

Query: 252 GKLL 263
           GK L
Sbjct: 213 GKTL 216


>X98743-1|CAA67295.1|  610|Homo sapiens RNA helicase protein.
          Length = 610

 Score = 42.7 bits (96), Expect = 0.001
 Identities = 19/49 (38%), Positives = 31/49 (63%)
 Frame = +3

Query: 126 LKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSL 272
           + E  L+ I   GF   + IQ ++I P ++GRD++A A++G+GK L  L
Sbjct: 126 VNENTLKAIKEMGFTNMTEIQHKSIRPLLEGRDLLAAAKTGSGKTLAFL 174


>CR457060-1|CAG33341.1|  610|Homo sapiens DDX18 protein.
          Length = 610

 Score = 42.7 bits (96), Expect = 0.001
 Identities = 19/49 (38%), Positives = 31/49 (63%)
 Frame = +3

Query: 126 LKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSL 272
           + E  L+ I   GF   + IQ ++I P ++GRD++A A++G+GK L  L
Sbjct: 126 VNENTLKAIKEMGFTNMTEIQHKSIRPLLEGRDLLAAAKTGSGKTLAFL 174


>BC024739-1|AAH24739.1|  670|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 18 protein.
          Length = 670

 Score = 42.7 bits (96), Expect = 0.001
 Identities = 19/49 (38%), Positives = 31/49 (63%)
 Frame = +3

Query: 126 LKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSL 272
           + E  L+ I   GF   + IQ ++I P ++GRD++A A++G+GK L  L
Sbjct: 186 VNENTLKAIKEMGFTNMTEIQHKSIRPLLEGRDLLAAAKTGSGKTLAFL 234


>BC003360-1|AAH03360.1|  670|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 18 protein.
          Length = 670

 Score = 42.7 bits (96), Expect = 0.001
 Identities = 19/49 (38%), Positives = 31/49 (63%)
 Frame = +3

Query: 126 LKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSL 272
           + E  L+ I   GF   + IQ ++I P ++GRD++A A++G+GK L  L
Sbjct: 186 VNENTLKAIKEMGFTNMTEIQHKSIRPLLEGRDLLAAAKTGSGKTLAFL 234


>BC001238-1|AAH01238.1|  670|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 18 protein.
          Length = 670

 Score = 42.7 bits (96), Expect = 0.001
 Identities = 19/49 (38%), Positives = 31/49 (63%)
 Frame = +3

Query: 126 LKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSL 272
           + E  L+ I   GF   + IQ ++I P ++GRD++A A++G+GK L  L
Sbjct: 186 VNENTLKAIKEMGFTNMTEIQHKSIRPLLEGRDLLAAAKTGSGKTLAFL 234


>AK001467-1|BAA91709.1|  670|Homo sapiens protein ( Homo sapiens
           cDNA FLJ10605 fis, clone NT2RP2005126, highly similar to
           H.sapiens mRNA for RNA helicase. ).
          Length = 670

 Score = 42.7 bits (96), Expect = 0.001
 Identities = 19/49 (38%), Positives = 31/49 (63%)
 Frame = +3

Query: 126 LKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSL 272
           + E  L+ I   GF   + IQ ++I P ++GRD++A A++G+GK L  L
Sbjct: 186 VNENTLKAIKEMGFTNMTEIQHKSIRPLLEGRDLLAAAKTGSGKTLAFL 234


>AC009404-1|AAX88947.1|  546|Homo sapiens unknown protein.
          Length = 546

 Score = 42.7 bits (96), Expect = 0.001
 Identities = 19/49 (38%), Positives = 31/49 (63%)
 Frame = +3

Query: 126 LKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSL 272
           + E  L+ I   GF   + IQ ++I P ++GRD++A A++G+GK L  L
Sbjct: 62  VNENTLKAIKEMGFTNMTEIQHKSIRPLLEGRDLLAAAKTGSGKTLAFL 110


>CR457213-1|CAG33494.1|  547|Homo sapiens DDX56 protein.
          Length = 547

 Score = 42.3 bits (95), Expect = 0.002
 Identities = 17/49 (34%), Positives = 34/49 (69%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F+ M L   LL+ +   G+ + + IQ++AI   ++G+D++A+A++G+GK
Sbjct: 9   FEHMGLDPRLLQAVTDLGWSRSTLIQEKAIPLALEGKDLLARARTGSGK 57


>BC012304-1|AAH12304.1| 1031|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 46 protein.
          Length = 1031

 Score = 42.3 bits (95), Expect = 0.002
 Identities = 18/57 (31%), Positives = 36/57 (63%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSL 272
           ++++    +  ++L  +  +G+EKP+ IQ +AI   + GRD+I  A++G+GK +  L
Sbjct: 371 IKSWVQCGISMKILNSLKKHGYEKPTPIQTQAIPAIMSGRDLIGIAKTGSGKTIAFL 427



 Score = 34.7 bits (76), Expect = 0.34
 Identities = 24/72 (33%), Positives = 35/72 (48%), Gaps = 5/72 (6%)
 Frame = +2

Query: 254 KTATFSISILQQI--DTSIRECQ---ALILAPTRELAQQIQKVVIALGDHLNAKCHACIG 418
           KT  F + + + I    S+ E +   A+I+ PTRELA QI K        L  +     G
Sbjct: 422 KTIAFLLPMFRHIMDQRSLEEGEGPIAVIMTPTRELALQITKECKKFSKTLGLRVVCVYG 481

Query: 419 GTNVREDIRQLE 454
           GT + E I +L+
Sbjct: 482 GTGISEQIAELK 493


>AF106680-1|AAD43033.1| 1031|Homo sapiens RNA helicase protein.
          Length = 1031

 Score = 42.3 bits (95), Expect = 0.002
 Identities = 18/57 (31%), Positives = 36/57 (63%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSL 272
           ++++    +  ++L  +  +G+EKP+ IQ +AI   + GRD+I  A++G+GK +  L
Sbjct: 371 IKSWVQCGISMKILNSLKKHGYEKPTPIQTQAIPAIMSGRDLIGIAKTGSGKTIAFL 427



 Score = 32.7 bits (71), Expect = 1.4
 Identities = 25/72 (34%), Positives = 37/72 (51%), Gaps = 5/72 (6%)
 Frame = +2

Query: 254 KTATFSISILQQI--DTSIRECQ---ALILAPTRELAQQIQKVVIALGDHLNAKCHACIG 418
           KT  F + + + I    S+ E +   A+I+ PTRELA QI K V +    L  +     G
Sbjct: 422 KTIAFLLPMFRHIMDQRSLEEGEGPLAVIMTPTRELALQIPKGVRSF-KTLGLRVVCVYG 480

Query: 419 GTNVREDIRQLE 454
           GT + E I +L+
Sbjct: 481 GTGISEQIAELK 492


>AB018344-1|BAA34521.2| 1058|Homo sapiens KIAA0801 protein protein.
          Length = 1058

 Score = 42.3 bits (95), Expect = 0.002
 Identities = 18/57 (31%), Positives = 36/57 (63%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSL 272
           ++++    +  ++L  +  +G+EKP+ IQ +AI   + GRD+I  A++G+GK +  L
Sbjct: 397 IKSWVQCGISMKILNSLKKHGYEKPTPIQTQAIPAIMSGRDLIGIAKTGSGKTIAFL 453



 Score = 34.7 bits (76), Expect = 0.34
 Identities = 24/72 (33%), Positives = 35/72 (48%), Gaps = 5/72 (6%)
 Frame = +2

Query: 254 KTATFSISILQQI--DTSIRECQ---ALILAPTRELAQQIQKVVIALGDHLNAKCHACIG 418
           KT  F + + + I    S+ E +   A+I+ PTRELA QI K        L  +     G
Sbjct: 448 KTIAFLLPMFRHIMDQRSLEEGEGPIAVIMTPTRELALQITKECKKFSKTLGLRVVCVYG 507

Query: 419 GTNVREDIRQLE 454
           GT + E I +L+
Sbjct: 508 GTGISEQIAELK 519


>BX641072-1|CAE46035.1|  496|Homo sapiens hypothetical protein
           protein.
          Length = 496

 Score = 41.1 bits (92), Expect = 0.004
 Identities = 19/55 (34%), Positives = 32/55 (58%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLL 266
           +++F +M     +LRG+   G   P+ IQ + I   + GRD+I  A +G+GK L+
Sbjct: 54  IKSFKEMKFPAAILRGLKKKGIHHPTPIQIQGIPTILSGRDMIGIAFTGSGKTLV 108


>BC015476-1|AAH15476.1|  622|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 41 protein.
          Length = 622

 Score = 41.1 bits (92), Expect = 0.004
 Identities = 19/55 (34%), Positives = 32/55 (58%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLL 266
           +++F +M     +LRG+   G   P+ IQ + I   + GRD+I  A +G+GK L+
Sbjct: 180 IKSFKEMKFPAAILRGLKKKGIHHPTPIQIQGIPTILSGRDMIGIAFTGSGKTLV 234


>AK222598-1|BAD96318.1|  622|Homo sapiens DEAD-box protein abstrakt
           variant protein.
          Length = 622

 Score = 41.1 bits (92), Expect = 0.004
 Identities = 19/55 (34%), Positives = 32/55 (58%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLL 266
           +++F +M     +LRG+   G   P+ IQ + I   + GRD+I  A +G+GK L+
Sbjct: 180 IKSFKEMKFPAAILRGLKKKGIHHPTPIQIQGIPTILSGRDMIGIAFTGSGKTLV 234


>AK027768-1|BAB55355.1|  622|Homo sapiens protein ( Homo sapiens
           cDNA FLJ14862 fis, clone PLACE1001739, weakly similar to
           PUTATIVE ATP-DEPENDENT RNA HELICASE PL10. ).
          Length = 622

 Score = 41.1 bits (92), Expect = 0.004
 Identities = 19/55 (34%), Positives = 32/55 (58%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLL 266
           +++F +M     +LRG+   G   P+ IQ + I   + GRD+I  A +G+GK L+
Sbjct: 180 IKSFKEMKFPAAILRGLKKKGIHHPTPIQIQGIPTILSGRDMIGIAFTGSGKTLV 234


>AK001255-1|BAA91585.1|  622|Homo sapiens protein ( Homo sapiens
           cDNA FLJ10393 fis, clone NT2RM4000191, weakly similar to
           PUTATIVE ATP-DEPENDENT RNA HELICASE PL10. ).
          Length = 622

 Score = 41.1 bits (92), Expect = 0.004
 Identities = 19/55 (34%), Positives = 32/55 (58%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLL 266
           +++F +M     +LRG+   G   P+ IQ + I   + GRD+I  A +G+GK L+
Sbjct: 180 IKSFKEMKFPATILRGLKKKGIHHPTPIQIQGIPTILSGRDMIGIAFTGSGKTLV 234


>AF195417-1|AAF04150.1|  621|Homo sapiens DEAD-box protein abstrakt
           protein.
          Length = 621

 Score = 41.1 bits (92), Expect = 0.004
 Identities = 19/55 (34%), Positives = 32/55 (58%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLL 266
           +++F +M     +LRG+   G   P+ IQ + I   + GRD+I  A +G+GK L+
Sbjct: 179 IKSFKEMKFPAAILRGLKKKGIHHPTPIQIQGIPTILSGRDMIGIAFTGSGKTLV 233


>BC002674-1|AAH02674.1|  483|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 49 protein.
          Length = 483

 Score = 40.7 bits (91), Expect = 0.005
 Identities = 24/69 (34%), Positives = 34/69 (49%)
 Frame = +2

Query: 224 CYRSSPVRNWKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKC 403
           C   +   + KTA F + ILQ++         L+L PTRELA QI +    LG  L  K 
Sbjct: 42  CLGCAKTGSGKTAAFVLPILQKLSEDPYGIFCLVLTPTRELAYQIAEQFRVLGKPLGLKD 101

Query: 404 HACIGGTNV 430
              +GG ++
Sbjct: 102 CIIVGGMDM 110



 Score = 31.9 bits (69), Expect = 2.4
 Identities = 14/49 (28%), Positives = 27/49 (55%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F ++ L   L+      G ++P+ +Q   I   ++GRD +  A++G+GK
Sbjct: 4   FAELGLSSWLVEQCRQLGLKQPTPVQLGCIPAILEGRDCLGCAKTGSGK 52


>AK223294-1|BAD97014.1|  483|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 49 variant protein.
          Length = 483

 Score = 40.7 bits (91), Expect = 0.005
 Identities = 24/69 (34%), Positives = 34/69 (49%)
 Frame = +2

Query: 224 CYRSSPVRNWKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKC 403
           C   +   + KTA F + ILQ++         L+L PTRELA QI +    LG  L  K 
Sbjct: 42  CLGCAKTGSGKTAAFVLPILQKLSEDPYGIFCLVLTPTRELAYQIAEQFRVLGKPLGLKD 101

Query: 404 HACIGGTNV 430
              +GG ++
Sbjct: 102 CIIVGGMDM 110



 Score = 31.5 bits (68), Expect = 3.2
 Identities = 14/49 (28%), Positives = 27/49 (55%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F ++ L   L+      G ++P+ +Q   I   ++GRD +  A++G+GK
Sbjct: 4   FAELGLSSWLVEQCRQLGLKQPTPVQLGCIPVILEGRDCLGCAKTGSGK 52


>AC002985-2|AAB81544.1|  483|Homo sapiens R27090_2 protein.
          Length = 483

 Score = 40.7 bits (91), Expect = 0.005
 Identities = 24/69 (34%), Positives = 34/69 (49%)
 Frame = +2

Query: 224 CYRSSPVRNWKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKC 403
           C   +   + KTA F + ILQ++         L+L PTRELA QI +    LG  L  K 
Sbjct: 42  CLGCAKTGSGKTAAFVLPILQKLSEDPYGIFCLVLTPTRELAYQIAEQFRVLGKPLGLKD 101

Query: 404 HACIGGTNV 430
              +GG ++
Sbjct: 102 CIIVGGMDM 110



 Score = 31.9 bits (69), Expect = 2.4
 Identities = 14/49 (28%), Positives = 27/49 (55%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F ++ L   L+      G ++P+ +Q   I   ++GRD +  A++G+GK
Sbjct: 4   FAELGLSSWLVEQCRQLGLKQPTPVQLGCIPAILEGRDCLGCAKTGSGK 52


>AK001294-1|BAA91606.1|  257|Homo sapiens protein ( Homo sapiens
           cDNA FLJ10432 fis, clone NT2RP1000470, weakly similar to
           PUTATIVE ATP-DEPENDENT RNA HELICASE T26G10.1 IN
           CHROMOSOME III. ).
          Length = 257

 Score = 40.3 bits (90), Expect = 0.007
 Identities = 24/69 (34%), Positives = 34/69 (49%)
 Frame = +2

Query: 224 CYRSSPVRNWKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKC 403
           C   +   + KTA F + ILQ++         L+L PTRELA QI +    LG  L  K 
Sbjct: 42  CLGCAKTGSGKTAAFVLPILQKLSEDPYGIFCLVLTPTRELAYQIAERFRVLGKPLGLKD 101

Query: 404 HACIGGTNV 430
              +GG ++
Sbjct: 102 CIIVGGMDM 110



 Score = 33.5 bits (73), Expect = 0.79
 Identities = 15/49 (30%), Positives = 27/49 (55%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F ++ L   L+      G +KP+ +Q   I   ++GRD +  A++G+GK
Sbjct: 4   FAELGLSSWLVEQCRQLGLKKPTPVQLGCIPAILEGRDCLGCAKTGSGK 52


>AF000985-1|AAC51832.1|  660|Homo sapiens dead box, Y isoform
           protein.
          Length = 660

 Score = 40.3 bits (90), Expect = 0.007
 Identities = 20/53 (37%), Positives = 36/53 (67%), Gaps = 1/53 (1%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQG-RDVIAQAQSGTGK 257
           +E F D+++ E ++  I    + +P+ +Q+ AI P I+G RD++A AQ+G+GK
Sbjct: 177 IENFSDIDMGEIIMGNIELTRYTRPTPVQKHAI-PIIKGKRDLVACAQTGSGK 228



 Score = 32.3 bits (70), Expect = 1.8
 Identities = 17/46 (36%), Positives = 24/46 (52%)
 Frame = +2

Query: 317 ALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLE 454
           +L+LAPTRELA QI +           +     GG ++ + IR LE
Sbjct: 267 SLVLAPTRELAVQIYEEARKFSYRSRVRPCVVYGGADIGQQIRDLE 312


>AF000984-1|AAC51831.1|  660|Homo sapiens dead box, Y isoform
           protein.
          Length = 660

 Score = 40.3 bits (90), Expect = 0.007
 Identities = 20/53 (37%), Positives = 36/53 (67%), Gaps = 1/53 (1%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQG-RDVIAQAQSGTGK 257
           +E F D+++ E ++  I    + +P+ +Q+ AI P I+G RD++A AQ+G+GK
Sbjct: 177 IENFSDIDMGEIIMGNIELTRYTRPTPVQKHAI-PIIKGKRDLVACAQTGSGK 228



 Score = 32.3 bits (70), Expect = 1.8
 Identities = 17/46 (36%), Positives = 24/46 (52%)
 Frame = +2

Query: 317 ALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLE 454
           +L+LAPTRELA QI +           +     GG ++ + IR LE
Sbjct: 267 SLVLAPTRELAVQIYEEARKFSYRSRVRPCVVYGGADIGQQIRDLE 312


>BC088362-1|AAH88362.1|  724|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 4 protein.
          Length = 724

 Score = 39.5 bits (88), Expect = 0.012
 Identities = 20/57 (35%), Positives = 34/57 (59%)
 Frame = +3

Query: 87  DWDQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           D    + TF++ NL + L   I   G+ K + +Q+ +I   + GRD++A AQ+G+GK
Sbjct: 282 DAPPAILTFEEANLCQTLNNNIAKAGYTKLTPVQKYSIPIILAGRDLMACAQTGSGK 338



 Score = 29.9 bits (64), Expect = 9.7
 Identities = 16/50 (32%), Positives = 24/50 (48%)
 Frame = +2

Query: 302 IRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQL 451
           ++E + +I+APTREL  QI             +     GGT +   IRQ+
Sbjct: 363 LQEPECIIVAPTRELVNQIYLEARKFSFGTCVRAVVIYGGTQLGHSIRQI 412


>BC051703-1|AAH51703.1|  631|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 53 protein.
          Length = 631

 Score = 39.5 bits (88), Expect = 0.012
 Identities = 20/43 (46%), Positives = 27/43 (62%)
 Frame = +3

Query: 135 ELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLL 263
           +LL+ I   G  KP+ IQ +A    +QG D+I  AQ+GTGK L
Sbjct: 232 DLLKSIIRVGIVKPTPIQSQAWPIILQGIDLIVVAQTGTGKTL 274


>BC047455-1|AAH47455.1|  690|Homo sapiens DDX4 protein protein.
          Length = 690

 Score = 39.5 bits (88), Expect = 0.012
 Identities = 20/57 (35%), Positives = 34/57 (59%)
 Frame = +3

Query: 87  DWDQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           D    + TF++ NL + L   I   G+ K + +Q+ +I   + GRD++A AQ+G+GK
Sbjct: 248 DAPPAILTFEEANLCQTLNNNIAKAGYTKLTPVQKYSIPIILAGRDLMACAQTGSGK 304


>BC034942-1|AAH34942.1|  660|Homo sapiens DDX3Y protein protein.
          Length = 660

 Score = 39.5 bits (88), Expect = 0.012
 Identities = 20/53 (37%), Positives = 36/53 (67%), Gaps = 1/53 (1%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQG-RDVIAQAQSGTGK 257
           +E F D+++ E ++  I    + +P+ +Q+ AI P I+G RD++A AQ+G+GK
Sbjct: 177 IENFSDIDMGEIIMGNIELTRYTRPTPVQKHAI-PIIKGKRDLMACAQTGSGK 228



 Score = 32.3 bits (70), Expect = 1.8
 Identities = 17/46 (36%), Positives = 24/46 (52%)
 Frame = +2

Query: 317 ALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLE 454
           +L+LAPTRELA QI +           +     GG ++ + IR LE
Sbjct: 267 SLVLAPTRELAVQIYEEARKFSYRSRVRPCVVYGGADIGQQIRDLE 312


>AY039237-1|AAK72102.1|  630|Homo sapiens DEAD-box protein CAGE
           protein.
          Length = 630

 Score = 39.5 bits (88), Expect = 0.012
 Identities = 20/43 (46%), Positives = 27/43 (62%)
 Frame = +3

Query: 135 ELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLL 263
           +LL+ I   G  KP+ IQ +A    +QG D+I  AQ+GTGK L
Sbjct: 232 DLLKSIIRVGIVKPTPIQSQAWPIILQGIDLIVVAQTGTGKTL 274


>AY004154-1|AAF86585.1|  724|Homo sapiens DEAD box RNA helicase
           protein.
          Length = 724

 Score = 39.5 bits (88), Expect = 0.012
 Identities = 20/57 (35%), Positives = 34/57 (59%)
 Frame = +3

Query: 87  DWDQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           D    + TF++ NL + L   I   G+ K + +Q+ +I   + GRD++A AQ+G+GK
Sbjct: 282 DAPPAILTFEEANLCQTLNNNIAKAGYTKLTPVQKYSIPIILAGRDLMACAQTGSGK 338



 Score = 29.9 bits (64), Expect = 9.7
 Identities = 16/50 (32%), Positives = 24/50 (48%)
 Frame = +2

Query: 302 IRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQL 451
           ++E + +I+APTREL  QI             +     GGT +   IRQ+
Sbjct: 363 LQEPECIIVAPTRELVNQIYLEARKFSFGTCVRAVVIYGGTQLGHSIRQI 412


>AL137462-1|CAB70750.1|  635|Homo sapiens hypothetical protein
           protein.
          Length = 635

 Score = 39.5 bits (88), Expect = 0.012
 Identities = 20/57 (35%), Positives = 34/57 (59%)
 Frame = +3

Query: 87  DWDQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           D    + TF++ NL + L   I   G+ K + +Q+ +I   + GRD++A AQ+G+GK
Sbjct: 193 DAPPAILTFEEANLCQTLNNNIAKAGYTKLTPVQKYSIPIILAGRDLMACAQTGSGK 249



 Score = 29.9 bits (64), Expect = 9.7
 Identities = 16/50 (32%), Positives = 24/50 (48%)
 Frame = +2

Query: 302 IRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQL 451
           ++E + +I+APTREL  QI             +     GGT +   IRQ+
Sbjct: 274 LQEPECIIVAPTRELVNQIYLEARKFSFGTCVRAVVIYGGTQLGHSIRQI 323


>AF262962-1|AAF72705.1|  724|Homo sapiens VASA protein protein.
          Length = 724

 Score = 39.5 bits (88), Expect = 0.012
 Identities = 20/57 (35%), Positives = 34/57 (59%)
 Frame = +3

Query: 87  DWDQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           D    + TF++ NL + L   I   G+ K + +Q+ +I   + GRD++A AQ+G+GK
Sbjct: 282 DAPPAILTFEEANLCQTLNNNIAKAGYTKLTPVQKYSIPIILAGRDLMACAQTGSGK 338



 Score = 29.9 bits (64), Expect = 9.7
 Identities = 16/50 (32%), Positives = 24/50 (48%)
 Frame = +2

Query: 302 IRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQL 451
           ++E + +I+APTREL  QI             +     GGT +   IRQ+
Sbjct: 363 LQEPECIIVAPTRELVNQIYLEARKFSFGTCVRAVVIYGGTQLGHSIRQI 412


>BC067878-1|AAH67878.1|  631|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 53 protein.
          Length = 631

 Score = 39.1 bits (87), Expect = 0.016
 Identities = 20/43 (46%), Positives = 27/43 (62%)
 Frame = +3

Query: 135 ELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLL 263
           +LL+ I   G  KP+ IQ +A    +QG D+I  AQ+GTGK L
Sbjct: 232 DLLKSIIRVGILKPTPIQSQAWPIILQGIDLIVVAQTGTGKTL 274


>U28042-1|AAC50823.1|  875|Homo sapiens protein ( Human DEAD box RNA
           helicase-like protein mRNA, complete cds. ).
          Length = 875

 Score = 38.7 bits (86), Expect = 0.021
 Identities = 18/57 (31%), Positives = 33/57 (57%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSL 272
           +  F D  L ++ L+G+    +   + IQ++ I   +QG+DV+  A++G+GK L  L
Sbjct: 68  ITRFSDFPLSKKTLKGLQEAQYRLVTEIQKQTIGLALQGKDVLGAAKTGSGKTLAFL 124



 Score = 32.7 bits (71), Expect = 1.4
 Identities = 20/70 (28%), Positives = 37/70 (52%), Gaps = 4/70 (5%)
 Frame = +2

Query: 254 KTATFSISILQQID----TSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGG 421
           KT  F + +L+ +     TS      LI++PTRELA Q  +V+  +G + +      IGG
Sbjct: 119 KTLAFLVPVLEALYRLQWTSTDGLGVLIISPTRELAYQTFEVLRKVGKNHDFSAGLIIGG 178

Query: 422 TNVREDIRQL 451
            +++ +  ++
Sbjct: 179 KDLKHEAERI 188


>BC093656-1|AAH93656.1|  875|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 10 protein.
          Length = 875

 Score = 38.7 bits (86), Expect = 0.021
 Identities = 18/57 (31%), Positives = 33/57 (57%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSL 272
           +  F D  L ++ L+G+    +   + IQ++ I   +QG+DV+  A++G+GK L  L
Sbjct: 68  ITRFSDFPLSKKTLKGLQEAQYRLVTEIQKQTIGLALQGKDVLGAAKTGSGKTLAFL 124



 Score = 32.7 bits (71), Expect = 1.4
 Identities = 20/70 (28%), Positives = 37/70 (52%), Gaps = 4/70 (5%)
 Frame = +2

Query: 254 KTATFSISILQQID----TSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGG 421
           KT  F + +L+ +     TS      LI++PTRELA Q  +V+  +G + +      IGG
Sbjct: 119 KTLAFLVPVLEALYRLQWTSTDGLGVLIISPTRELAYQTFEVLRKVGKNHDFSAGLIIGG 178

Query: 422 TNVREDIRQL 451
            +++ +  ++
Sbjct: 179 KDLKHEAERI 188


>BC093654-1|AAH93654.1|  875|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 10 protein.
          Length = 875

 Score = 38.7 bits (86), Expect = 0.021
 Identities = 18/57 (31%), Positives = 33/57 (57%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSL 272
           +  F D  L ++ L+G+    +   + IQ++ I   +QG+DV+  A++G+GK L  L
Sbjct: 68  ITRFSDFPLSKKTLKGLQEAQYRLVTEIQKQTIGLALQGKDVLGAAKTGSGKTLAFL 124



 Score = 32.7 bits (71), Expect = 1.4
 Identities = 20/70 (28%), Positives = 37/70 (52%), Gaps = 4/70 (5%)
 Frame = +2

Query: 254 KTATFSISILQQID----TSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGG 421
           KT  F + +L+ +     TS      LI++PTRELA Q  +V+  +G + +      IGG
Sbjct: 119 KTLAFLVPVLEALYRLQWTSTDGLGVLIISPTRELAYQTFEVLRKVGKNHDFSAGLIIGG 178

Query: 422 TNVREDIRQL 451
            +++ +  ++
Sbjct: 179 KDLKHEAERI 188


>BC091521-1|AAH91521.1|  875|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 10 protein.
          Length = 875

 Score = 38.7 bits (86), Expect = 0.021
 Identities = 18/57 (31%), Positives = 33/57 (57%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSL 272
           +  F D  L ++ L+G+    +   + IQ++ I   +QG+DV+  A++G+GK L  L
Sbjct: 68  ITRFSDFPLSKKTLKGLQEAQYRLVTEIQKQTIGLALQGKDVLGAAKTGSGKTLAFL 124



 Score = 32.7 bits (71), Expect = 1.4
 Identities = 20/70 (28%), Positives = 37/70 (52%), Gaps = 4/70 (5%)
 Frame = +2

Query: 254 KTATFSISILQQID----TSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGG 421
           KT  F + +L+ +     TS      LI++PTRELA Q  +V+  +G + +      IGG
Sbjct: 119 KTLAFLVPVLEALYRLQWTSTDGLGVLIISPTRELAYQTFEVLRKVGKNHDFSAGLIIGG 178

Query: 422 TNVREDIRQL 451
            +++ +  ++
Sbjct: 179 KDLKHEAERI 188


>BC049217-1|AAH49217.1|  745|Homo sapiens DDX10 protein protein.
          Length = 745

 Score = 38.7 bits (86), Expect = 0.021
 Identities = 18/57 (31%), Positives = 33/57 (57%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSL 272
           +  F D  L ++ L+G+    +   + IQ++ I   +QG+DV+  A++G+GK L  L
Sbjct: 68  ITRFSDFPLSKKTLKGLQEAQYRLVTEIQKQTIGLALQGKDVLGAAKTGSGKTLAFL 124



 Score = 32.7 bits (71), Expect = 1.4
 Identities = 20/70 (28%), Positives = 37/70 (52%), Gaps = 4/70 (5%)
 Frame = +2

Query: 254 KTATFSISILQQID----TSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGG 421
           KT  F + +L+ +     TS      LI++PTRELA Q  +V+  +G + +      IGG
Sbjct: 119 KTLAFLVPVLEALYRLQWTSTDGLGVLIISPTRELAYQTFEVLRKVGKNHDFSAGLIIGG 178

Query: 422 TNVREDIRQL 451
            +++ +  ++
Sbjct: 179 KDLKHEAERI 188


>AB209884-1|BAD93121.1|  845|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 10 variant protein.
          Length = 845

 Score = 38.7 bits (86), Expect = 0.021
 Identities = 18/57 (31%), Positives = 33/57 (57%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSL 272
           +  F D  L ++ L+G+    +   + IQ++ I   +QG+DV+  A++G+GK L  L
Sbjct: 78  ITRFSDFPLSKKTLKGLQEAQYRLVTEIQKQTIGLALQGKDVLGAAKTGSGKTLAFL 134



 Score = 32.7 bits (71), Expect = 1.4
 Identities = 20/70 (28%), Positives = 37/70 (52%), Gaps = 4/70 (5%)
 Frame = +2

Query: 254 KTATFSISILQQID----TSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGG 421
           KT  F + +L+ +     TS      LI++PTRELA Q  +V+  +G + +      IGG
Sbjct: 129 KTLAFLVPVLEALYRLQWTSTDGLGVLIISPTRELAYQTFEVLRKVGKNHDFSAGLIIGG 188

Query: 422 TNVREDIRQL 451
            +++ +  ++
Sbjct: 189 KDLKHEAERI 198


>AB040537-1|BAB18536.1|  875|Homo sapiens RNA helicase protein.
          Length = 875

 Score = 38.7 bits (86), Expect = 0.021
 Identities = 18/57 (31%), Positives = 33/57 (57%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSL 272
           +  F D  L ++ L+G+    +   + IQ++ I   +QG+DV+  A++G+GK L  L
Sbjct: 68  ITRFSDFPLSKKTLKGLQEAQYRLVTEIQKQTIGLALQGKDVLGAAKTGSGKTLAFL 124



 Score = 32.7 bits (71), Expect = 1.4
 Identities = 20/70 (28%), Positives = 37/70 (52%), Gaps = 4/70 (5%)
 Frame = +2

Query: 254 KTATFSISILQQID----TSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGG 421
           KT  F + +L+ +     TS      LI++PTRELA Q  +V+  +G + +      IGG
Sbjct: 119 KTLAFLVPVLEALYRLQWTSTDGLGVLIISPTRELAYQTFEVLRKVGKNHDFSAGLIIGG 178

Query: 422 TNVREDIRQL 451
            +++ +  ++
Sbjct: 179 KDLKHEAERI 188


>BC041801-1|AAH41801.1|  619|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 59 protein.
          Length = 619

 Score = 38.3 bits (85), Expect = 0.028
 Identities = 18/49 (36%), Positives = 29/49 (59%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F+  +L E L   +   G+E P+ IQ + I   + GRD++A A +G+GK
Sbjct: 205 FEHCSLPEVLNHNLKKSGYEVPTPIQMQMIPVGLLGRDILASADTGSGK 253



 Score = 33.1 bits (72), Expect = 1.0
 Identities = 23/75 (30%), Positives = 37/75 (49%), Gaps = 1/75 (1%)
 Frame = +2

Query: 233 SSPVRNWKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHA 409
           S+   + KTA F + ++ +     +   ALIL PTRELA QI++    L   L   K   
Sbjct: 246 SADTGSGKTAAFLLPVIMRALFESKTPSALILTPTRELAIQIERQAKELMSGLPRMKTVL 305

Query: 410 CIGGTNVREDIRQLE 454
            +GG  +   + +L+
Sbjct: 306 LVGGLPLPPQLYRLQ 320


>BC014183-1|AAH14183.1|  434|Homo sapiens DDX59 protein protein.
          Length = 434

 Score = 38.3 bits (85), Expect = 0.028
 Identities = 18/49 (36%), Positives = 29/49 (59%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F+  +L E L   +   G+E P+ IQ + I   + GRD++A A +G+GK
Sbjct: 205 FEHCSLPEVLNHNLKKSGYEVPTPIQMQMIPVGLLGRDILASADTGSGK 253



 Score = 33.1 bits (72), Expect = 1.0
 Identities = 23/75 (30%), Positives = 37/75 (49%), Gaps = 1/75 (1%)
 Frame = +2

Query: 233 SSPVRNWKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHA 409
           S+   + KTA F + ++ +     +   ALIL PTRELA QI++    L   L   K   
Sbjct: 246 SADTGSGKTAAFLLPVIMRALFESKTPSALILTPTRELAIQIERQAKELMSGLPRMKTVL 305

Query: 410 CIGGTNVREDIRQLE 454
            +GG  +   + +L+
Sbjct: 306 LVGGLPLPPQLYRLQ 320


>AL445483-6|CAI17056.1|  619|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 59 protein.
          Length = 619

 Score = 38.3 bits (85), Expect = 0.028
 Identities = 18/49 (36%), Positives = 29/49 (59%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F+  +L E L   +   G+E P+ IQ + I   + GRD++A A +G+GK
Sbjct: 205 FEHCSLPEVLNHNLKKSGYEVPTPIQMQMIPVGLLGRDILASADTGSGK 253



 Score = 33.1 bits (72), Expect = 1.0
 Identities = 23/75 (30%), Positives = 37/75 (49%), Gaps = 1/75 (1%)
 Frame = +2

Query: 233 SSPVRNWKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHA 409
           S+   + KTA F + ++ +     +   ALIL PTRELA QI++    L   L   K   
Sbjct: 246 SADTGSGKTAAFLLPVIMRALFESKTPSALILTPTRELAIQIERQAKELMSGLPRMKTVL 305

Query: 410 CIGGTNVREDIRQLE 454
            +GG  +   + +L+
Sbjct: 306 LVGGLPLPPQLYRLQ 320


>AL445483-5|CAI17055.1|  580|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 59 protein.
          Length = 580

 Score = 38.3 bits (85), Expect = 0.028
 Identities = 18/49 (36%), Positives = 29/49 (59%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F+  +L E L   +   G+E P+ IQ + I   + GRD++A A +G+GK
Sbjct: 205 FEHCSLPEVLNHNLKKSGYEVPTPIQMQMIPVGLLGRDILASADTGSGK 253



 Score = 33.1 bits (72), Expect = 1.0
 Identities = 23/75 (30%), Positives = 37/75 (49%), Gaps = 1/75 (1%)
 Frame = +2

Query: 233 SSPVRNWKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHA 409
           S+   + KTA F + ++ +     +   ALIL PTRELA QI++    L   L   K   
Sbjct: 246 SADTGSGKTAAFLLPVIMRALFESKTPSALILTPTRELAIQIERQAKELMSGLPRMKTVL 305

Query: 410 CIGGTNVREDIRQLE 454
            +GG  +   + +L+
Sbjct: 306 LVGGLPLPPQLYRLQ 320


>Z97056-3|CAB09792.1|  650|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 17 protein.
          Length = 650

 Score = 37.9 bits (84), Expect = 0.037
 Identities = 21/45 (46%), Positives = 24/45 (53%)
 Frame = +2

Query: 320 LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLE 454
           L+LAPTRELAQQ+Q+V    G     K     GG      IR LE
Sbjct: 169 LVLAPTRELAQQVQQVADDYGKCSRLKSTCIYGGAPKGPQIRDLE 213



 Score = 32.3 bits (70), Expect = 1.8
 Identities = 17/57 (29%), Positives = 29/57 (50%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSL 272
           V  F   N  + ++  +    F +P+ IQ +     + GRD++  AQ+G+GK L  L
Sbjct: 91  VFAFHHANFPQYVMDVLMDQHFTEPTPIQCQGFPLALSGRDMVGIAQTGSGKTLAYL 147


>U59321-1|AAC50787.1|  650|Homo sapiens DEAD-box protein p72
           protein.
          Length = 650

 Score = 37.9 bits (84), Expect = 0.037
 Identities = 21/45 (46%), Positives = 24/45 (53%)
 Frame = +2

Query: 320 LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLE 454
           L+LAPTRELAQQ+Q+V    G     K     GG      IR LE
Sbjct: 169 LVLAPTRELAQQVQQVADDYGKCSRLKSTCIYGGAPKGPQIRDLE 213



 Score = 32.3 bits (70), Expect = 1.8
 Identities = 17/57 (29%), Positives = 29/57 (50%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSL 272
           V  F   N  + ++  +    F +P+ IQ +     + GRD++  AQ+G+GK L  L
Sbjct: 91  VFAFHHANFPQYVMDVLMDQHFTEPTPIQCQGFPLALSGRDMVGIAQTGSGKTLAYL 147


>U50553-1|AAB95637.1|  662|Homo sapiens helicase like protein 2
           protein.
          Length = 662

 Score = 37.9 bits (84), Expect = 0.037
 Identities = 17/52 (32%), Positives = 33/52 (63%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           +E+F D+ + E ++  I    + +P+ +Q+ AI    + RD++A AQ+G+GK
Sbjct: 179 IESFSDVEMGEIIMGNIELTRYTRPTPVQKHAIPIIKEKRDLMACAQTGSGK 230



 Score = 32.3 bits (70), Expect = 1.8
 Identities = 17/46 (36%), Positives = 24/46 (52%)
 Frame = +2

Query: 317 ALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLE 454
           +L+LAPTRELA QI +           +     GG ++ + IR LE
Sbjct: 269 SLVLAPTRELAVQIYEEARKFSYRSRVRPCVVYGGADIGQQIRDLE 314


>CR456432-1|CAG30318.1|  652|Homo sapiens DDX17 protein.
          Length = 652

 Score = 37.9 bits (84), Expect = 0.037
 Identities = 21/45 (46%), Positives = 24/45 (53%)
 Frame = +2

Query: 320 LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLE 454
           L+LAPTRELAQQ+Q+V    G     K     GG      IR LE
Sbjct: 169 LVLAPTRELAQQVQQVADDYGKCSRLKSTCIYGGAPKGPQIRDLE 213



 Score = 32.3 bits (70), Expect = 1.8
 Identities = 17/57 (29%), Positives = 29/57 (50%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSL 272
           V  F   N  + ++  +    F +P+ IQ +     + GRD++  AQ+G+GK L  L
Sbjct: 91  VFAFHHANFPQYVMDVLMDQHFTEPTPIQCQGFPLALSGRDMVGIAQTGSGKTLAYL 147


>BC011819-1|AAH11819.1|  662|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 3, X-linked protein.
          Length = 662

 Score = 37.9 bits (84), Expect = 0.037
 Identities = 17/52 (32%), Positives = 33/52 (63%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           +E+F D+ + E ++  I    + +P+ +Q+ AI    + RD++A AQ+G+GK
Sbjct: 179 IESFSDVEMGEIIMGNIELTRYTRPTPVQKHAIPIIKEKRDLMACAQTGSGK 230



 Score = 32.3 bits (70), Expect = 1.8
 Identities = 17/46 (36%), Positives = 24/46 (52%)
 Frame = +2

Query: 317 ALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLE 454
           +L+LAPTRELA QI +           +     GG ++ + IR LE
Sbjct: 269 SLVLAPTRELAVQIYEEARKFSYRSRVRPCVVYGGADIGQQIRDLE 314


>BC000595-1|AAH00595.2|  729|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 17 protein.
          Length = 729

 Score = 37.9 bits (84), Expect = 0.037
 Identities = 21/45 (46%), Positives = 24/45 (53%)
 Frame = +2

Query: 320 LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLE 454
           L+LAPTRELAQQ+Q+V    G     K     GG      IR LE
Sbjct: 248 LVLAPTRELAQQVQQVADDYGKCSRLKSTCIYGGAPKGPQIRDLE 292



 Score = 32.3 bits (70), Expect = 1.8
 Identities = 17/57 (29%), Positives = 29/57 (50%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSL 272
           V  F   N  + ++  +    F +P+ IQ +     + GRD++  AQ+G+GK L  L
Sbjct: 170 VFAFHHANFPQYVMDVLMDQHFTEPTPIQCQGFPLALSGRDMVGIAQTGSGKTLAYL 226


>AL391647-2|CAI41416.1|  662|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 3, X-linked protein.
          Length = 662

 Score = 37.9 bits (84), Expect = 0.037
 Identities = 17/52 (32%), Positives = 33/52 (63%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           +E+F D+ + E ++  I    + +P+ +Q+ AI    + RD++A AQ+G+GK
Sbjct: 179 IESFSDVEMGEIIMGNIELTRYTRPTPVQKHAIPIIKEKRDLMACAQTGSGK 230



 Score = 32.3 bits (70), Expect = 1.8
 Identities = 17/46 (36%), Positives = 24/46 (52%)
 Frame = +2

Query: 317 ALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLE 454
           +L+LAPTRELA QI +           +     GG ++ + IR LE
Sbjct: 269 SLVLAPTRELAVQIYEEARKFSYRSRVRPCVVYGGADIGQQIRDLE 314


>AF061337-1|AAC34298.1|  662|Homo sapiens DEAD box RNA helicase DDX3
           protein.
          Length = 662

 Score = 37.9 bits (84), Expect = 0.037
 Identities = 17/52 (32%), Positives = 33/52 (63%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           +E+F D+ + E ++  I    + +P+ +Q+ AI    + RD++A AQ+G+GK
Sbjct: 179 IESFSDVEMGEIIMGNIELTRYTRPTPVQKHAIPIIKEKRDLMACAQTGSGK 230



 Score = 32.3 bits (70), Expect = 1.8
 Identities = 17/46 (36%), Positives = 24/46 (52%)
 Frame = +2

Query: 317 ALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLE 454
           +L+LAPTRELA QI +           +     GG ++ + IR LE
Sbjct: 269 SLVLAPTRELAVQIYEEARKFSYRSRVRPCVVYGGADIGQQIRDLE 314


>AF000983-1|AAC51830.1|  662|Homo sapiens dead box, X isoform
           protein.
          Length = 662

 Score = 37.9 bits (84), Expect = 0.037
 Identities = 17/52 (32%), Positives = 33/52 (63%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           +E+F D+ + E ++  I    + +P+ +Q+ AI    + RD++A AQ+G+GK
Sbjct: 179 IESFSDVEMGEIIMGNIELTRYTRPTPVQKHAIPIIKEKRDLMACAQTGSGK 230



 Score = 32.3 bits (70), Expect = 1.8
 Identities = 17/46 (36%), Positives = 24/46 (52%)
 Frame = +2

Query: 317 ALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLE 454
           +L+LAPTRELA QI +           +     GG ++ + IR LE
Sbjct: 269 SLVLAPTRELAVQIYEEARKFSYRSRVRPCVVYGGADIGQQIRDLE 314


>AF000982-1|AAC51829.1|  662|Homo sapiens dead box, X isoform
           protein.
          Length = 662

 Score = 37.9 bits (84), Expect = 0.037
 Identities = 17/52 (32%), Positives = 33/52 (63%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           +E+F D+ + E ++  I    + +P+ +Q+ AI    + RD++A AQ+G+GK
Sbjct: 179 IESFSDVEMGEIIMGNIELTRYTRPTPVQKHAIPIIKEKRDLMACAQTGSGK 230



 Score = 32.3 bits (70), Expect = 1.8
 Identities = 17/46 (36%), Positives = 24/46 (52%)
 Frame = +2

Query: 317 ALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLE 454
           +L+LAPTRELA QI +           +     GG ++ + IR LE
Sbjct: 269 SLVLAPTRELAVQIYEEARKFSYRSRVRPCVVYGGADIGQQIRDLE 314


>AB209595-1|BAD92832.1|  737|Homo sapiens DEAD box polypeptide 17
           isoform p82 variant protein.
          Length = 737

 Score = 37.9 bits (84), Expect = 0.037
 Identities = 21/45 (46%), Positives = 24/45 (53%)
 Frame = +2

Query: 320 LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLE 454
           L+LAPTRELAQQ+Q+V    G     K     GG      IR LE
Sbjct: 250 LVLAPTRELAQQVQQVADDYGKCSRLKSTCIYGGAPKGPQIRDLE 294



 Score = 32.3 bits (70), Expect = 1.8
 Identities = 17/57 (29%), Positives = 29/57 (50%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSL 272
           V  F   N  + ++  +    F +P+ IQ +     + GRD++  AQ+G+GK L  L
Sbjct: 172 VFAFHHANFPQYVMDVLMDQHFTEPTPIQCQGFPLALSGRDMVGIAQTGSGKTLAYL 228


>AB208983-1|BAD92220.1|  674|Homo sapiens DEAD/H
           (Asp-Glu-Ala-Asp/His) box polypeptide 3 variant protein.
          Length = 674

 Score = 37.9 bits (84), Expect = 0.037
 Identities = 17/52 (32%), Positives = 33/52 (63%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           +E+F D+ + E ++  I    + +P+ +Q+ AI    + RD++A AQ+G+GK
Sbjct: 191 IESFSDVEMGEIIMGNIELTRYTRPTPVQKHAIPIIKEKRDLMACAQTGSGK 242



 Score = 32.3 bits (70), Expect = 1.8
 Identities = 17/46 (36%), Positives = 24/46 (52%)
 Frame = +2

Query: 317 ALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLE 454
           +L+LAPTRELA QI +           +     GG ++ + IR LE
Sbjct: 281 SLVLAPTRELAVQIYEEARKFSYRSRVRPCVVYGGADIGQQIRDLE 326


>AF336851-1|AAK21271.1|  561|Homo sapiens RNA helicase-like protein
           protein.
          Length = 561

 Score = 37.5 bits (83), Expect = 0.048
 Identities = 20/63 (31%), Positives = 33/63 (52%), Gaps = 3/63 (4%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIREC---QALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGT 424
           KTA F++ +L+++    R+    + L+L PTREL  Q+  V   L    N      +GG 
Sbjct: 33  KTAAFALPVLERLIYKPRQAPVTRVLVLVPTRELGIQVHSVTRQLAQFCNITTCLAVGGL 92

Query: 425 NVR 433
           +V+
Sbjct: 93  DVK 95



 Score = 32.3 bits (70), Expect = 1.8
 Identities = 14/32 (43%), Positives = 22/32 (68%)
 Frame = +3

Query: 162 GFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           GF++P+ IQ+  I   + G+D+ A A +GTGK
Sbjct: 2   GFKQPTPIQKACIPVGLLGKDICACAATGTGK 33


>CR533509-1|CAG38540.1|  448|Homo sapiens DDX19 protein.
          Length = 448

 Score = 37.1 bits (82), Expect = 0.064
 Identities = 18/43 (41%), Positives = 28/43 (65%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALG 382
           KTA F +++L Q++ + +  Q L L+PT ELA Q  KV+  +G
Sbjct: 113 KTAAFVLAMLSQVEPANKYPQCLCLSPTYELALQTGKVIEQMG 155


>BC010008-1|AAH10008.1|  370|Homo sapiens DEAD (Asp-Glu-Ala-As) box
           polypeptide 19B protein.
          Length = 370

 Score = 37.1 bits (82), Expect = 0.064
 Identities = 18/43 (41%), Positives = 28/43 (65%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALG 382
           KTA F +++L Q++ + +  Q L L+PT ELA Q  KV+  +G
Sbjct: 35  KTAAFVLAMLSQVEPANKYPQCLCLSPTYELALQTGKVIEQMG 77



 Score = 33.1 bits (72), Expect = 1.0
 Identities = 17/34 (50%), Positives = 24/34 (70%), Gaps = 2/34 (5%)
 Frame = +3

Query: 162 GFEKPSAIQQRAI--MPCIQGRDVIAQAQSGTGK 257
           GF +PS IQ+ A+  M     +++IAQ+QSGTGK
Sbjct: 2   GFNRPSKIQENALPLMLAEPPQNLIAQSQSGTGK 35


>AK097078-1|BAC04942.1|  666|Homo sapiens protein ( Homo sapiens
           cDNA FLJ39759 fis, clone SMINT2019153, weakly similar to
           ATP-DEPENDENT RNA HELICASE DBP73D. ).
          Length = 666

 Score = 37.1 bits (82), Expect = 0.064
 Identities = 21/64 (32%), Positives = 32/64 (50%), Gaps = 1/64 (1%)
 Frame = +2

Query: 179 CNPATRNNALHPRTRCYRSSPVRNWKTATFSISILQQI-DTSIRECQALILAPTRELAQQ 355
           C          P   C  S+P  + KT  F I ++Q +    +   +AL++ PT+ELAQQ
Sbjct: 238 CGFLVGRGGYRPSDLCV-SAPTGSGKTLAFVIPVVQALLSRVVCHIRALVVLPTKELAQQ 296

Query: 356 IQKV 367
           + KV
Sbjct: 297 VSKV 300


>AF353720-1|AAK40102.1|  370|Homo sapiens testicular DEAD-box
           helicase protein protein.
          Length = 370

 Score = 37.1 bits (82), Expect = 0.064
 Identities = 18/43 (41%), Positives = 28/43 (65%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALG 382
           KTA F +++L Q++ + +  Q L L+PT ELA Q  KV+  +G
Sbjct: 35  KTAAFVLAMLSQVEPANKYPQCLCLSPTYELALQTGKVIEQMG 77



 Score = 33.1 bits (72), Expect = 1.0
 Identities = 17/34 (50%), Positives = 24/34 (70%), Gaps = 2/34 (5%)
 Frame = +3

Query: 162 GFEKPSAIQQRAI--MPCIQGRDVIAQAQSGTGK 257
           GF +PS IQ+ A+  M     +++IAQ+QSGTGK
Sbjct: 2   GFNRPSKIQENALPLMLAEPPQNLIAQSQSGTGK 35


>BC000272-1|AAH00272.1|  737|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 50 protein.
          Length = 737

 Score = 36.3 bits (80), Expect = 0.11
 Identities = 18/55 (32%), Positives = 30/55 (54%)
 Frame = +3

Query: 93  DQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           +Q    F +  + EE ++ +   G      IQ +   P  +G+D+IAQA++GTGK
Sbjct: 133 EQKEGAFSNFPISEETIKLLKGRGVTYLFPIQVKTFGPVYEGKDLIAQARTGTGK 187



 Score = 34.3 bits (75), Expect = 0.45
 Identities = 22/72 (30%), Positives = 38/72 (52%), Gaps = 6/72 (8%)
 Frame = +2

Query: 254 KTATFSISILQQIDTS------IRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACI 415
           KT +F+I +++++  +       R  + L+LAPTRELA Q+ K    +   L+  C    
Sbjct: 187 KTFSFAIPLIERLQRNQETIKKSRSPKVLVLAPTRELANQVAKDFKDITRKLSVACF--Y 244

Query: 416 GGTNVREDIRQL 451
           GGT+ +  I  +
Sbjct: 245 GGTSYQSQINHI 256


>AL359844-2|CAH72376.1|  737|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 50 protein.
          Length = 737

 Score = 36.3 bits (80), Expect = 0.11
 Identities = 18/55 (32%), Positives = 30/55 (54%)
 Frame = +3

Query: 93  DQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           +Q    F +  + EE ++ +   G      IQ +   P  +G+D+IAQA++GTGK
Sbjct: 133 EQKEGAFSNFPISEETIKLLKGRGVTYLFPIQVKTFGPVYEGKDLIAQARTGTGK 187



 Score = 34.3 bits (75), Expect = 0.45
 Identities = 22/72 (30%), Positives = 38/72 (52%), Gaps = 6/72 (8%)
 Frame = +2

Query: 254 KTATFSISILQQIDTS------IRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACI 415
           KT +F+I +++++  +       R  + L+LAPTRELA Q+ K    +   L+  C    
Sbjct: 187 KTFSFAIPLIERLQRNQETIKKSRSPKVLVLAPTRELANQVAKDFKDITRKLSVACF--Y 244

Query: 416 GGTNVREDIRQL 451
           GGT+ +  I  +
Sbjct: 245 GGTSYQSQINHI 256


>AK223297-1|BAD97017.1|  363|Homo sapiens nucleolar protein GU2
           variant protein.
          Length = 363

 Score = 36.3 bits (80), Expect = 0.11
 Identities = 18/55 (32%), Positives = 30/55 (54%)
 Frame = +3

Query: 93  DQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           +Q    F +  + EE ++ +   G      IQ +   P  +G+D+IAQA++GTGK
Sbjct: 133 EQKEGAFSNFPISEETIKLLKGRGVTYLFPIQVKTFGPVYEGKDLIAQARTGTGK 187



 Score = 31.5 bits (68), Expect = 3.2
 Identities = 21/72 (29%), Positives = 37/72 (51%), Gaps = 6/72 (8%)
 Frame = +2

Query: 254 KTATFSISILQQIDTS------IRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACI 415
           KT +F+I +++++  +       R  + L+LAPT ELA Q+ K    +   L+  C    
Sbjct: 187 KTFSFAIPLIERLQRNQETIKKSRSPKVLVLAPTGELANQVAKDFKDITRKLSVACF--Y 244

Query: 416 GGTNVREDIRQL 451
           GGT+ +  I  +
Sbjct: 245 GGTSYQSQINHI 256


>AK056044-1|BAB71082.1|  189|Homo sapiens protein ( Homo sapiens
           cDNA FLJ31482 fis, clone NT2NE2001666, weakly similar to
           PUTATIVE ATP-DEPENDENT RNA HELICASE YDL031W. ).
          Length = 189

 Score = 36.3 bits (80), Expect = 0.11
 Identities = 18/55 (32%), Positives = 30/55 (54%)
 Frame = +3

Query: 93  DQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           +Q    F +  + EE ++ +   G      IQ +   P  +G+D+IAQA++GTGK
Sbjct: 68  EQKEGAFSNFPISEETIKLLKGRGVTYLFPIQVKTFGPVYEGKDLIAQARTGTGK 122



 Score = 30.3 bits (65), Expect = 7.3
 Identities = 16/43 (37%), Positives = 27/43 (62%), Gaps = 6/43 (13%)
 Frame = +2

Query: 254 KTATFSISILQQIDTS------IRECQALILAPTRELAQQIQK 364
           KT +F+I +++++  +       R  + L+LAPTRELA Q+ K
Sbjct: 122 KTFSFAIPLIERLQRNQETIKKSRSPKVLVLAPTRELANQVAK 164


>AF334103-1|AAK29402.1|  737|Homo sapiens nucleolar protein GU2
           protein.
          Length = 737

 Score = 36.3 bits (80), Expect = 0.11
 Identities = 18/55 (32%), Positives = 30/55 (54%)
 Frame = +3

Query: 93  DQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           +Q    F +  + EE ++ +   G      IQ +   P  +G+D+IAQA++GTGK
Sbjct: 133 EQKEGAFSNFPISEETIKLLKGRGVTYLFPIQVKTFGPVYEGKDLIAQARTGTGK 187



 Score = 34.3 bits (75), Expect = 0.45
 Identities = 22/72 (30%), Positives = 38/72 (52%), Gaps = 6/72 (8%)
 Frame = +2

Query: 254 KTATFSISILQQIDTS------IRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACI 415
           KT +F+I +++++  +       R  + L+LAPTRELA Q+ K    +   L+  C    
Sbjct: 187 KTFSFAIPLIERLQRNQETIKKSRSPKVLVLAPTRELANQVAKDFKDITRKLSVACF--Y 244

Query: 416 GGTNVREDIRQL 451
           GGT+ +  I  +
Sbjct: 245 GGTSYQSQINHI 256


>X52104-1|CAA36324.1|  614|Homo sapiens protein ( Human mRNA for p68
           protein. ).
          Length = 614

 Score = 35.9 bits (79), Expect = 0.15
 Identities = 20/45 (44%), Positives = 23/45 (51%)
 Frame = +2

Query: 320 LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLE 454
           L+LAPTRELAQQ+Q+V          K     GG      IR LE
Sbjct: 171 LVLAPTRELAQQVQQVAAEYCRACRLKSTCIYGGAPKGPQIRDLE 215



 Score = 33.1 bits (72), Expect = 1.0
 Identities = 17/54 (31%), Positives = 28/54 (51%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLL 263
           V  F + N    ++  I    F +P+AIQ +     + G D++  AQ+G+GK L
Sbjct: 93  VLNFYEANFPANVMDVIARQNFTEPTAIQAQGWPVALSGLDMVGVAQTGSGKTL 146


>X15729-1|CAA33751.1|  614|Homo sapiens protein ( Human mRNA for
           nuclear p68 protein. ).
          Length = 614

 Score = 35.9 bits (79), Expect = 0.15
 Identities = 20/45 (44%), Positives = 23/45 (51%)
 Frame = +2

Query: 320 LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLE 454
           L+LAPTRELAQQ+Q+V          K     GG      IR LE
Sbjct: 171 LVLAPTRELAQQVQQVAAEYCRACRLKSTCIYGGAPKGPQIRDLE 215



 Score = 33.1 bits (72), Expect = 1.0
 Identities = 17/54 (31%), Positives = 28/54 (51%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLL 263
           V  F + N    ++  I    F +P+AIQ +     + G D++  AQ+G+GK L
Sbjct: 93  VLNFYEANFPANVMDVIARQNFTEPTAIQAQGWPVALSGLDMVGVAQTGSGKTL 146


>BX571764-1|CAE11890.1|  406|Homo sapiens hypothetical protein
           protein.
          Length = 406

 Score = 35.9 bits (79), Expect = 0.15
 Identities = 20/45 (44%), Positives = 23/45 (51%)
 Frame = +2

Query: 320 LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLE 454
           L+LAPTRELAQQ+Q+V          K     GG      IR LE
Sbjct: 171 LVLAPTRELAQQVQQVAAEYCRACRLKSTCIYGGAPKGPQIRDLE 215



 Score = 33.1 bits (72), Expect = 1.0
 Identities = 17/54 (31%), Positives = 28/54 (51%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLL 263
           V  F + N    ++  I    F +P+AIQ +     + G D++  AQ+G+GK L
Sbjct: 93  VLNFYEANFPANVMDVIARQNFTEPTAIQAQGWPVALSGLDMVGVAQTGSGKTL 146


>BT006943-1|AAP35589.1|  614|Homo sapiens DEAD/H
           (Asp-Glu-Ala-Asp/His) box polypeptide 5 (RNA helicase,
           68kDa) protein.
          Length = 614

 Score = 35.9 bits (79), Expect = 0.15
 Identities = 20/45 (44%), Positives = 23/45 (51%)
 Frame = +2

Query: 320 LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLE 454
           L+LAPTRELAQQ+Q+V          K     GG      IR LE
Sbjct: 171 LVLAPTRELAQQVQQVAAEYCRACRLKSTCIYGGAPKGPQIRDLE 215



 Score = 33.1 bits (72), Expect = 1.0
 Identities = 17/54 (31%), Positives = 28/54 (51%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLL 263
           V  F + N    ++  I    F +P+AIQ +     + G D++  AQ+G+GK L
Sbjct: 93  VLNFYEANFPANVMDVIARQNFTEPTAIQAQGWPVALSGLDMVGVAQTGSGKTL 146


>BC016027-1|AAH16027.1|  614|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 5 protein.
          Length = 614

 Score = 35.9 bits (79), Expect = 0.15
 Identities = 20/45 (44%), Positives = 23/45 (51%)
 Frame = +2

Query: 320 LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLE 454
           L+LAPTRELAQQ+Q+V          K     GG      IR LE
Sbjct: 171 LVLAPTRELAQQVQQVAAEYCRACRLKSTCIYGGAPKGPQIRDLE 215



 Score = 33.1 bits (72), Expect = 1.0
 Identities = 17/54 (31%), Positives = 28/54 (51%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLL 263
           V  F + N    ++  I    F +P+AIQ +     + G D++  AQ+G+GK L
Sbjct: 93  VLNFYEANFPANVMDVIARQNFTEPTAIQAQGWPVALSGLDMVGVAQTGSGKTL 146


>AF015812-1|AAB84094.1|  614|Homo sapiens RNA helicase p68 protein.
          Length = 614

 Score = 35.9 bits (79), Expect = 0.15
 Identities = 20/45 (44%), Positives = 23/45 (51%)
 Frame = +2

Query: 320 LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLE 454
           L+LAPTRELAQQ+Q+V          K     GG      IR LE
Sbjct: 171 LVLAPTRELAQQVQQVAAEYCRACRLKSTCIYGGAPKGPQIRDLE 215



 Score = 33.1 bits (72), Expect = 1.0
 Identities = 17/54 (31%), Positives = 28/54 (51%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLL 263
           V  F + N    ++  I    F +P+AIQ +     + G D++  AQ+G+GK L
Sbjct: 93  VLNFYEANFPANVMDVIARQNFTEPTAIQAQGWPVALSGLDMVGVAQTGSGKTL 146


>AB209919-1|BAD93156.1|  457|Homo sapiens Hypothetical protein
           DKFZp686J01190 variant protein.
          Length = 457

 Score = 35.9 bits (79), Expect = 0.15
 Identities = 20/45 (44%), Positives = 23/45 (51%)
 Frame = +2

Query: 320 LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLE 454
           L+LAPTRELAQQ+Q+V          K     GG      IR LE
Sbjct: 222 LVLAPTRELAQQVQQVAAEYCRACRLKSTCIYGGAPKGPQIRDLE 266



 Score = 33.1 bits (72), Expect = 1.0
 Identities = 17/54 (31%), Positives = 28/54 (51%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLL 263
           V  F + N    ++  I    F +P+AIQ +     + G D++  AQ+G+GK L
Sbjct: 144 VLNFYEANFPANVMDVIARQNFTEPTAIQAQGWPVALSGLDMVGVAQTGSGKTL 197


>AK131260-1|BAD18438.1|  528|Homo sapiens protein ( Homo sapiens
           cDNA FLJ16192 fis, clone BRTHA2017364, weakly  similar
           to ATP-DEPENDENT RNA HELICASE T26G10.1 IN CHROMOSOME
           III. ).
          Length = 528

 Score = 35.5 bits (78), Expect = 0.20
 Identities = 16/57 (28%), Positives = 29/57 (50%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSL 272
           +++F ++   E ++  +      +PS +Q  A  P I G+  +   QSG+GK L  L
Sbjct: 123 LKSFKEIGCSEYMIESLQKLLLSRPSHVQAMAFAPVISGKTCVIADQSGSGKTLAYL 179


>BC050360-1|AAH50360.2|  369|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 25 protein.
          Length = 369

 Score = 35.1 bits (77), Expect = 0.26
 Identities = 21/58 (36%), Positives = 29/58 (50%)
 Frame = +2

Query: 209 HPRTRCYRSSPVRNWKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALG 382
           HP       S     KTA F +++L +++      Q L LAPT ELA Q  +VV  +G
Sbjct: 20  HPPQNLIAQSQSGTGKTAAFVLAMLSRVNALELFPQCLCLAPTYELALQTGRVVEQMG 77


>BC040185-1|AAH40185.1|  666|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 51 protein.
          Length = 666

 Score = 35.1 bits (77), Expect = 0.26
 Identities = 17/46 (36%), Positives = 29/46 (63%), Gaps = 1/46 (2%)
 Frame = +2

Query: 233 SSPVRNWKTATFSISILQQI-DTSIRECQALILAPTRELAQQIQKV 367
           S+P  + KT  F I ++Q +    +   +AL++ PT+ELA+Q+ KV
Sbjct: 255 SAPTGSGKTLAFVIPVVQALLSRVVCHIRALVVLPTKELARQVSKV 300


>BC035388-1|AAH35388.2|  369|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 25 protein.
          Length = 369

 Score = 35.1 bits (77), Expect = 0.26
 Identities = 21/58 (36%), Positives = 29/58 (50%)
 Frame = +2

Query: 209 HPRTRCYRSSPVRNWKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALG 382
           HP       S     KTA F +++L +++      Q L LAPT ELA Q  +VV  +G
Sbjct: 20  HPPQNLIAQSQSGTGKTAAFVLAMLSRVNALELFPQCLCLAPTYELALQTGRVVEQMG 77


>AJ010931-1|CAA09408.1|  111|Homo sapiens p68 RNA helicase protein.
          Length = 111

 Score = 34.7 bits (76), Expect = 0.34
 Identities = 17/54 (31%), Positives = 28/54 (51%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLL 263
           V  F + N    ++  I    F +P+AIQ +     + G D++  AQ+G+GK L
Sbjct: 41  VLNFYEANFPANVMDXIARQNFTEPTAIQAQGXPVALSGLDMVGVAQTGSGKTL 94


>U41387-1|AAB02546.1|  801|Homo sapiens Gu protein protein.
          Length = 801

 Score = 34.3 bits (75), Expect = 0.45
 Identities = 22/63 (34%), Positives = 34/63 (53%), Gaps = 6/63 (9%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSI------RECQALILAPTRELAQQIQKVVIALGDHLNAKCHACI 415
           KT +F+I +++++   +      R  Q L+LAPTRELA Q+ K    +   L+  C    
Sbjct: 254 KTFSFAIPLIEKLHGELQDRKRGRAPQVLVLAPTRELANQVSKDFSDITKKLSVACF--Y 311

Query: 416 GGT 424
           GGT
Sbjct: 312 GGT 314



 Score = 32.3 bits (70), Expect = 1.8
 Identities = 17/55 (30%), Positives = 28/55 (50%)
 Frame = +3

Query: 93  DQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           +Q    F +  + EE ++ +   G      IQ +       G+D+IAQA++GTGK
Sbjct: 200 EQKEGAFSNFPISEETIKLLKGRGVTFLFPIQAKTFHHVYSGKDLIAQARTGTGK 254


>BC030020-1|AAH30020.1|  600|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 55 protein.
          Length = 600

 Score = 34.3 bits (75), Expect = 0.45
 Identities = 25/73 (34%), Positives = 38/73 (52%), Gaps = 6/73 (8%)
 Frame = +2

Query: 254 KTATFSISILQQI---DTSIRECQ--ALILAPTRELAQQIQKVVIALGDHLNAKCHAC-I 415
           KT  F I IL+ +   +  +++ Q  A+I+ PTRELA QI +V+     H         I
Sbjct: 59  KTLAFVIPILEILLRREEKLKKSQVGAIIITPTRELAIQIDEVLSHFTKHFPEFSQILWI 118

Query: 416 GGTNVREDIRQLE 454
           GG N  ED+ + +
Sbjct: 119 GGRNPGEDVERFK 131


>BC008071-1|AAH08071.2|  783|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 21 protein.
          Length = 783

 Score = 34.3 bits (75), Expect = 0.45
 Identities = 22/63 (34%), Positives = 34/63 (53%), Gaps = 6/63 (9%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSI------RECQALILAPTRELAQQIQKVVIALGDHLNAKCHACI 415
           KT +F+I +++++   +      R  Q L+LAPTRELA Q+ K    +   L+  C    
Sbjct: 236 KTFSFAIPLIEKLHGELQDRKRGRAPQVLVLAPTRELANQVSKDFSDITKKLSVACF--Y 293

Query: 416 GGT 424
           GGT
Sbjct: 294 GGT 296



 Score = 32.3 bits (70), Expect = 1.8
 Identities = 17/55 (30%), Positives = 28/55 (50%)
 Frame = +3

Query: 93  DQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           +Q    F +  + EE ++ +   G      IQ +       G+D+IAQA++GTGK
Sbjct: 182 EQKEGAFSNFPISEETIKLLKGRGVTFLFPIQAKTFHHVYSGKDLIAQARTGTGK 236


>AL359844-3|CAH72377.1|  783|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 21 protein.
          Length = 783

 Score = 34.3 bits (75), Expect = 0.45
 Identities = 22/63 (34%), Positives = 34/63 (53%), Gaps = 6/63 (9%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSI------RECQALILAPTRELAQQIQKVVIALGDHLNAKCHACI 415
           KT +F+I +++++   +      R  Q L+LAPTRELA Q+ K    +   L+  C    
Sbjct: 236 KTFSFAIPLIEKLHGELQDRKRGRAPQVLVLAPTRELANQVSKDFSDITKKLSVACF--Y 293

Query: 416 GGT 424
           GGT
Sbjct: 294 GGT 296



 Score = 32.3 bits (70), Expect = 1.8
 Identities = 17/55 (30%), Positives = 28/55 (50%)
 Frame = +3

Query: 93  DQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           +Q    F +  + EE ++ +   G      IQ +       G+D+IAQA++GTGK
Sbjct: 182 EQKEGAFSNFPISEETIKLLKGRGVTFLFPIQAKTFHHVYSGKDLIAQARTGTGK 236


>AK074219-1|BAB85021.1|  353|Homo sapiens protein ( Homo sapiens
           cDNA FLJ23639 fis, clone CAS11535. ).
          Length = 353

 Score = 34.3 bits (75), Expect = 0.45
 Identities = 25/73 (34%), Positives = 38/73 (52%), Gaps = 6/73 (8%)
 Frame = +2

Query: 254 KTATFSISILQQI---DTSIRECQ--ALILAPTRELAQQIQKVVIALGDHLNAKCHAC-I 415
           KT  F I IL+ +   +  +++ Q  A+I+ PTRELA QI +V+     H         I
Sbjct: 59  KTLAFVIPILEILLRREEKLKKSQVGAIIITPTRELAIQIDEVLSHFTKHFPEFSQILWI 118

Query: 416 GGTNVREDIRQLE 454
           GG N  ED+ + +
Sbjct: 119 GGRNPGEDVERFK 131


>BC093081-1|AAH93081.1|  938|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 42 protein.
          Length = 938

 Score = 33.1 bits (72), Expect = 1.0
 Identities = 15/50 (30%), Positives = 28/50 (56%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           +F      E+L+  I    + +P+ IQ + +   + GRD+I  A++G+GK
Sbjct: 254 SFAHFGFDEQLMHQIRKSEYTQPTPIQCQGVPVALSGRDMIGIAKTGSGK 303



 Score = 31.9 bits (69), Expect = 2.4
 Identities = 17/46 (36%), Positives = 24/46 (52%)
 Frame = +2

Query: 317 ALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLE 454
           A+I+ PTREL QQI       G   N +  A  GG ++ E  + L+
Sbjct: 329 AVIVCPTRELCQQIHAECKRFGKAYNLRSVAVYGGGSMWEQAKALQ 374


>BC078667-1|AAH78667.1|  919|Homo sapiens DDX42 protein protein.
          Length = 919

 Score = 33.1 bits (72), Expect = 1.0
 Identities = 15/50 (30%), Positives = 28/50 (56%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           +F      E+L+  I    + +P+ IQ + +   + GRD+I  A++G+GK
Sbjct: 235 SFAHFGFDEQLMHQIRKSEYTQPTPIQCQGVPVALSGRDMIGIAKTGSGK 284



 Score = 31.9 bits (69), Expect = 2.4
 Identities = 17/46 (36%), Positives = 24/46 (52%)
 Frame = +2

Query: 317 ALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLE 454
           A+I+ PTREL QQI       G   N +  A  GG ++ E  + L+
Sbjct: 310 AVIVCPTRELCQQIHAECKRFGKAYNLRSVAVYGGGSMWEQAKALQ 355


>BC015505-1|AAH15505.1|  819|Homo sapiens DDX42 protein protein.
          Length = 819

 Score = 33.1 bits (72), Expect = 1.0
 Identities = 15/50 (30%), Positives = 28/50 (56%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           +F      E+L+  I    + +P+ IQ + +   + GRD+I  A++G+GK
Sbjct: 135 SFAHFGFDEQLMHQIRKSEYTQPTPIQCQGVPVALSGRDMIGIAKTGSGK 184



 Score = 31.9 bits (69), Expect = 2.4
 Identities = 17/46 (36%), Positives = 24/46 (52%)
 Frame = +2

Query: 317 ALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLE 454
           A+I+ PTREL QQI       G   N +  A  GG ++ E  + L+
Sbjct: 210 AVIVCPTRELCQQIHAECKRFGKAYNLRSVAVYGGGSMWEQAKALQ 255


>AF083255-1|AAC32396.1|  709|Homo sapiens RNA helicase-related
           protein protein.
          Length = 709

 Score = 33.1 bits (72), Expect = 1.0
 Identities = 15/50 (30%), Positives = 28/50 (56%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           +F      E+L+  I    + +P+ IQ + +   + GRD+I  A++G+GK
Sbjct: 135 SFAHFGFDEQLMHQIRKSEYTQPTPIQCQGVPVALSGRDMIGIAKTGSGK 184



 Score = 31.9 bits (69), Expect = 2.4
 Identities = 17/46 (36%), Positives = 24/46 (52%)
 Frame = +2

Query: 317 ALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLE 454
           A+I+ PTREL QQI       G   N +  A  GG ++ E  + L+
Sbjct: 210 AVIVCPTRELCQQIHAECKRFGKAYNLRSVAVYGGGSMWEQAKALQ 255


>AB036090-1|BAC66466.1|  938|Homo sapiens RNA helicase-related
           protein protein.
          Length = 938

 Score = 33.1 bits (72), Expect = 1.0
 Identities = 15/50 (30%), Positives = 28/50 (56%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           +F      E+L+  I    + +P+ IQ + +   + GRD+I  A++G+GK
Sbjct: 254 SFAHFGFDEQLMHQIRKSEYTQPTPIQCQGVPVALSGRDMIGIAKTGSGK 303



 Score = 31.9 bits (69), Expect = 2.4
 Identities = 17/46 (36%), Positives = 24/46 (52%)
 Frame = +2

Query: 317 ALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLE 454
           A+I+ PTREL QQI       G   N +  A  GG ++ E  + L+
Sbjct: 329 AVIVCPTRELCQQIHAECKRFGKAYNLRSVAVYGGGSMWEQAKALQ 374


>BC024273-1|AAH24273.1|  540|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 28 protein.
          Length = 540

 Score = 32.7 bits (71), Expect = 1.4
 Identities = 16/54 (29%), Positives = 30/54 (55%), Gaps = 2/54 (3%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFE--KPSAIQQRAIMPCIQGRDVIAQAQSGTGKLL 263
           +F D+ L+  +L  +     E  +P+ +Q   I   ++GR V+  A++G+GK L
Sbjct: 127 SFADLGLEPRVLHALQEAAPEVVQPTTVQSSTIPSLLRGRHVVCAAETGSGKTL 180



 Score = 31.9 bits (69), Expect = 2.4
 Identities = 18/46 (39%), Positives = 24/46 (52%)
 Frame = +2

Query: 314 QALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQL 451
           + L+L P+RELAQQ++ V   LG  L        GG  +R    QL
Sbjct: 205 RGLVLVPSRELAQQVRAVAQPLGRSLGLLVRDLEGGHGMRRIRLQL 250


>AK002144-1|BAA92106.1|  540|Homo sapiens protein ( Homo sapiens
           cDNA FLJ11282 fis, clone PLACE1009476, weakly similar to
           PUTATIVE ATP-DEPENDENT RNA HELICASE T26G10.1 IN
           CHROMOSOME III. ).
          Length = 540

 Score = 32.7 bits (71), Expect = 1.4
 Identities = 16/54 (29%), Positives = 30/54 (55%), Gaps = 2/54 (3%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFE--KPSAIQQRAIMPCIQGRDVIAQAQSGTGKLL 263
           +F D+ L+  +L  +     E  +P+ +Q   I   ++GR V+  A++G+GK L
Sbjct: 127 SFADLGLEPRVLHALQEAAPEVVQPTTVQSSTIPSLLRGRHVVCAAETGSGKTL 180



 Score = 31.9 bits (69), Expect = 2.4
 Identities = 18/46 (39%), Positives = 24/46 (52%)
 Frame = +2

Query: 314 QALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQL 451
           + L+L P+RELAQQ++ V   LG  L        GG  +R    QL
Sbjct: 205 RGLVLVPSRELAQQVRAVAQPLGRSLGLLVRDLEGGHGMRRIRLQL 250


>AF329821-1|AAG59833.1|  540|Homo sapiens putative DEAD-box helicase
           MDDX28 protein.
          Length = 540

 Score = 32.7 bits (71), Expect = 1.4
 Identities = 16/54 (29%), Positives = 30/54 (55%), Gaps = 2/54 (3%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFE--KPSAIQQRAIMPCIQGRDVIAQAQSGTGKLL 263
           +F D+ L+  +L  +     E  +P+ +Q   I   ++GR V+  A++G+GK L
Sbjct: 127 SFADLGLEPRVLHALQEAAPEVVQPTTVQSSTIPSLLRGRHVVCAAETGSGKTL 180



 Score = 31.9 bits (69), Expect = 2.4
 Identities = 18/46 (39%), Positives = 24/46 (52%)
 Frame = +2

Query: 314 QALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQL 451
           + L+L P+RELAQQ++ V   LG  L        GG  +R    QL
Sbjct: 205 RGLVLVPSRELAQQVRAVAQPLGRSLGLLVRDLEGGHGMRRIRLQL 250


>AF261917-1|AAF78930.2|  715|Homo sapiens RNA helicase II/Gu protein
           protein.
          Length = 715

 Score = 32.7 bits (71), Expect = 1.4
 Identities = 21/63 (33%), Positives = 33/63 (52%), Gaps = 6/63 (9%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSI------RECQALILAPTRELAQQIQKVVIALGDHLNAKCHACI 415
           KT +F+I +++++   +      R  Q L+LAPTREL  Q+ K    +   L+  C    
Sbjct: 168 KTFSFAIPLIEKLHGELQDRKRGRAPQVLVLAPTRELCNQVSKDFSDITKKLSVACF--Y 225

Query: 416 GGT 424
           GGT
Sbjct: 226 GGT 228



 Score = 32.3 bits (70), Expect = 1.8
 Identities = 17/55 (30%), Positives = 28/55 (50%)
 Frame = +3

Query: 93  DQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           +Q    F +  + EE ++ +   G      IQ +       G+D+IAQA++GTGK
Sbjct: 114 EQKEGAFSNFPISEETIKLLKGRGVTFLFPIQAKTFHHVYSGKDLIAQARTGTGK 168


>EF523384-1|ABP57734.1| 1075|Homo sapiens POTE-2 alpha-actin
           protein.
          Length = 1075

 Score = 32.3 bits (70), Expect = 1.8
 Identities = 20/58 (34%), Positives = 26/58 (44%)
 Frame = -1

Query: 523 ESARRLSYHIHDPGVPTTYMNTTLQLANIFTDIGATNASMAFSIQVITKSYHHLLNLL 350
           E A  L  H  DP +P  Y NTTL  A    D     A + +   + +K+ H L  LL
Sbjct: 220 ECALMLLEHGTDPNIPDEYGNTTLHYAIYNEDKLMAKALLLYGADIESKNKHGLTPLL 277


>BC096826-1|AAH96826.1|  804|Homo sapiens DDX24 protein protein.
          Length = 804

 Score = 32.3 bits (70), Expect = 1.8
 Identities = 16/49 (32%), Positives = 26/49 (53%)
 Frame = +2

Query: 305 RECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQL 451
           R    L+L PTRELA Q+++ + A+      K    +GG + ++  R L
Sbjct: 331 RPLLGLVLTPTRELAVQVKQHIDAVARFTGIKTAILVGGMSTQKQQRML 379


>BC009406-1|AAH09406.1|  859|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 24 protein.
          Length = 859

 Score = 32.3 bits (70), Expect = 1.8
 Identities = 16/49 (32%), Positives = 26/49 (53%)
 Frame = +2

Query: 305 RECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQL 451
           R    L+L PTRELA Q+++ + A+      K    +GG + ++  R L
Sbjct: 386 RPLLGLVLTPTRELAVQVKQHIDAVARFTGIKTAILVGGMSTQKQQRML 434


>BC008847-1|AAH08847.1|  859|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 24 protein.
          Length = 859

 Score = 32.3 bits (70), Expect = 1.8
 Identities = 16/49 (32%), Positives = 26/49 (53%)
 Frame = +2

Query: 305 RECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQL 451
           R    L+L PTRELA Q+++ + A+      K    +GG + ++  R L
Sbjct: 386 RPLLGLVLTPTRELAVQVKQHIDAVARFTGIKTAILVGGMSTQKQQRML 434


>AY465172-1|AAS58871.1|  486|Homo sapiens POTE14C protein.
          Length = 486

 Score = 32.3 bits (70), Expect = 1.8
 Identities = 20/58 (34%), Positives = 26/58 (44%)
 Frame = -1

Query: 523 ESARRLSYHIHDPGVPTTYMNTTLQLANIFTDIGATNASMAFSIQVITKSYHHLLNLL 350
           E A  L  H  DP +P  Y NTTL  A    D     A + +   + +K+ H L  LL
Sbjct: 220 ECALMLLEHGTDPNIPDEYGNTTLHYAIYNEDKLMAKALLLYGADIESKNKHGLTPLL 277


>AY462873-1|AAS58867.1|  376|Homo sapiens POTE2C protein.
          Length = 376

 Score = 32.3 bits (70), Expect = 1.8
 Identities = 20/58 (34%), Positives = 26/58 (44%)
 Frame = -1

Query: 523 ESARRLSYHIHDPGVPTTYMNTTLQLANIFTDIGATNASMAFSIQVITKSYHHLLNLL 350
           E A  L  H  DP +P  Y NTTL  A    D     A + +   + +K+ H L  LL
Sbjct: 220 ECALMLLEHGTDPNIPDEYGNTTLHYAIYNEDKLMAKALLLYGADIESKNKHGLTPLL 277


>AY462872-1|AAS58866.1|  394|Homo sapiens POTE2B protein.
          Length = 394

 Score = 32.3 bits (70), Expect = 1.8
 Identities = 20/58 (34%), Positives = 26/58 (44%)
 Frame = -1

Query: 523 ESARRLSYHIHDPGVPTTYMNTTLQLANIFTDIGATNASMAFSIQVITKSYHHLLNLL 350
           E A  L  H  DP +P  Y NTTL  A    D     A + +   + +K+ H L  LL
Sbjct: 230 ECALMLLEHGTDPNIPDEYGNTTLHYAIYNEDKLMAKALLLYGADIESKNKHGLTPLL 287


>AY462871-1|AAS58865.1|  712|Homo sapiens POTE2A protein.
          Length = 712

 Score = 32.3 bits (70), Expect = 1.8
 Identities = 20/58 (34%), Positives = 26/58 (44%)
 Frame = -1

Query: 523 ESARRLSYHIHDPGVPTTYMNTTLQLANIFTDIGATNASMAFSIQVITKSYHHLLNLL 350
           E A  L  H  DP +P  Y NTTL  A    D     A + +   + +K+ H L  LL
Sbjct: 220 ECALMLLEHGTDPNIPDEYGNTTLHYAIYNEDKLMAKALLLYGADIESKNKHGLTPLL 277


>AY462868-1|AAS58862.1|  376|Homo sapiens POTE2D protein.
          Length = 376

 Score = 32.3 bits (70), Expect = 1.8
 Identities = 20/58 (34%), Positives = 26/58 (44%)
 Frame = -1

Query: 523 ESARRLSYHIHDPGVPTTYMNTTLQLANIFTDIGATNASMAFSIQVITKSYHHLLNLL 350
           E A  L  H  DP +P  Y NTTL  A    D     A + +   + +K+ H L  LL
Sbjct: 220 ECALMLLEHGTDPNIPDEYGNTTLHYAIYNEDKLMAKALLLYGADIESKNKHGLTPLL 277


>AK025162-1|BAB15079.1|  859|Homo sapiens protein ( Homo sapiens
           cDNA: FLJ21509 fis, clone COL05745. ).
          Length = 859

 Score = 32.3 bits (70), Expect = 1.8
 Identities = 16/49 (32%), Positives = 26/49 (53%)
 Frame = +2

Query: 305 RECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQL 451
           R    L+L PTRELA Q+++ + A+      K    +GG + ++  R L
Sbjct: 386 RPLLGLVLTPTRELAVQVKQHIDAVARFTGIKTAILVGGMSTQKQQRML 434


>AF214731-1|AAG02169.1|  859|Homo sapiens ATP-dependent RNA helicase
           protein.
          Length = 859

 Score = 32.3 bits (70), Expect = 1.8
 Identities = 16/49 (32%), Positives = 26/49 (53%)
 Frame = +2

Query: 305 RECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQL 451
           R    L+L PTRELA Q+++ + A+      K    +GG + ++  R L
Sbjct: 386 RPLLGLVLTPTRELAVQVKQHIDAVARFTGIKTAILVGGMSTQKQQRML 434


>AB209382-1|BAD92619.1|  676|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 24 variant protein.
          Length = 676

 Score = 32.3 bits (70), Expect = 1.8
 Identities = 16/49 (32%), Positives = 26/49 (53%)
 Frame = +2

Query: 305 RECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQL 451
           R    L+L PTRELA Q+++ + A+      K    +GG + ++  R L
Sbjct: 392 RPLLGLVLTPTRELAVQVKQHIDAVARFTGIKTAILVGGMSTQKQQRML 440


>BC067092-1|AAH67092.1|  237|Homo sapiens IGKC protein protein.
          Length = 237

 Score = 30.7 bits (66), Expect = 5.6
 Identities = 11/24 (45%), Positives = 17/24 (70%)
 Frame = -3

Query: 377 ELSPPSEFVGPALLWEPGSKLDIH 306
           ++  P++ +G  LLW PGS+ DIH
Sbjct: 2   DMRVPAQLLGLLLLWFPGSRCDIH 25


>X70649-1|CAA49992.1|  740|Homo sapiens member of DEAD box protein
           family protein.
          Length = 740

 Score = 30.3 bits (65), Expect = 7.3
 Identities = 14/49 (28%), Positives = 27/49 (55%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F +M +  E+ + +    +  P+ IQ  +I   + G DV+  A++G+GK
Sbjct: 4   FSEMGVMPEIAQAVEEMDWLLPTDIQAESIPLILGGGDVLMAAETGSGK 52


>EF418571-1|ABN70941.1|  740|Homo sapiens DEAD box polypeptide 1
           protein.
          Length = 740

 Score = 30.3 bits (65), Expect = 7.3
 Identities = 14/49 (28%), Positives = 27/49 (55%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F +M +  E+ + +    +  P+ IQ  +I   + G DV+  A++G+GK
Sbjct: 4   FSEMGVMPEIAQAVEEMDWLLPTDIQAESIPLILGGGDVLMAAETGSGK 52


>EF418570-1|ABN70940.1|  740|Homo sapiens DEAD box polypeptide 1
           protein.
          Length = 740

 Score = 30.3 bits (65), Expect = 7.3
 Identities = 14/49 (28%), Positives = 27/49 (55%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F +M +  E+ + +    +  P+ IQ  +I   + G DV+  A++G+GK
Sbjct: 4   FSEMGVMPEIAQAVEEMDWLLPTDIQAESIPLILGGGDVLMAAETGSGK 52


>BC053673-1|AAH53673.1|  740|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 1 protein.
          Length = 740

 Score = 30.3 bits (65), Expect = 7.3
 Identities = 14/49 (28%), Positives = 27/49 (55%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F +M +  E+ + +    +  P+ IQ  +I   + G DV+  A++G+GK
Sbjct: 4   FSEMGVMPEIAQAVEEMDWLLPTDIQAESIPLILGGGDVLMAAETGSGK 52


>BC012132-1|AAH12132.1|  740|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 1 protein.
          Length = 740

 Score = 30.3 bits (65), Expect = 7.3
 Identities = 14/49 (28%), Positives = 27/49 (55%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F +M +  E+ + +    +  P+ IQ  +I   + G DV+  A++G+GK
Sbjct: 4   FSEMGVMPEIAQAVEEMDWLLPTDIQAESIPLILGGGDVLMAAETGSGK 52


>AF145022-1|AAP97274.1|  454|Homo sapiens ATP-dependent RNA helicase
           protein.
          Length = 454

 Score = 30.3 bits (65), Expect = 7.3
 Identities = 14/43 (32%), Positives = 24/43 (55%)
 Frame = +2

Query: 323 ILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQL 451
           +L PTRELA Q+++ + A+      K    +GG + ++  R L
Sbjct: 19  VLTPTRELAVQVKQHIDAVARFTGIKTAILVGGMSTQKQQRML 61


>AF134475-1|AAP97252.1|  486|Homo sapiens ATP-dependent RNA helicase
           protein.
          Length = 486

 Score = 30.3 bits (65), Expect = 7.3
 Identities = 14/43 (32%), Positives = 24/43 (55%)
 Frame = +2

Query: 323 ILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQL 451
           +L PTRELA Q+++ + A+      K    +GG + ++  R L
Sbjct: 19  VLTPTRELAVQVKQHIDAVARFTGIKTAILVGGMSTQKQQRML 61


>BC012726-1|AAH12726.2|  777|Homo sapiens DDX31 protein protein.
          Length = 777

 Score = 29.9 bits (64), Expect = 9.7
 Identities = 10/29 (34%), Positives = 23/29 (79%)
 Frame = +3

Query: 177 SAIQQRAIMPCIQGRDVIAQAQSGTGKLL 263
           +++Q+++I   ++GRD + ++Q+G+GK L
Sbjct: 181 TSVQKQSIPVLLEGRDALVRSQTGSGKTL 209


>AL354735-2|CAI16565.1|  775|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 31 protein.
          Length = 775

 Score = 29.9 bits (64), Expect = 9.7
 Identities = 10/29 (34%), Positives = 23/29 (79%)
 Frame = +3

Query: 177 SAIQQRAIMPCIQGRDVIAQAQSGTGKLL 263
           +++Q+++I   ++GRD + ++Q+G+GK L
Sbjct: 255 TSVQKQSIPVLLEGRDALVRSQTGSGKTL 283


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 122,246,410
Number of Sequences: 237096
Number of extensions: 2964667
Number of successful extensions: 7213
Number of sequences better than 10.0: 260
Number of HSP's better than 10.0 without gapping: 6372
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7130
length of database: 76,859,062
effective HSP length: 88
effective length of database: 55,994,614
effective search space used: 8567175942
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).