SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30048
         (717 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BC112926-1|AAI12927.1| 1306|Homo sapiens ARHGEF10 protein protein.     30   7.2  
AF009205-1|AAB71662.1|  988|Homo sapiens unknown protein.              30   7.2  
AB002292-1|BAA20754.2| 1405|Homo sapiens KIAA0294 protein.             30   7.2  

>BC112926-1|AAI12927.1| 1306|Homo sapiens ARHGEF10 protein protein.
          Length = 1306

 Score = 30.3 bits (65), Expect = 7.2
 Identities = 18/58 (31%), Positives = 31/58 (53%), Gaps = 1/58 (1%)
 Frame = -3

Query: 706  SSTSGSTPVKHTNQGLPLQPHQGMVWLNLKEP-STAARSLNFRKLPASIALLQVGAKG 536
            SS+SGS  + H +  L  +     ++  LK+P S  +++   +K  AS AL+  G +G
Sbjct: 1219 SSSSGSLSLSHGSSSLEHRSEDSTIYDLLKDPVSLRSKARRAKKAKASSALVVCGGQG 1276


>AF009205-1|AAB71662.1|  988|Homo sapiens unknown protein.
          Length = 988

 Score = 30.3 bits (65), Expect = 7.2
 Identities = 18/58 (31%), Positives = 31/58 (53%), Gaps = 1/58 (1%)
 Frame = -3

Query: 706  SSTSGSTPVKHTNQGLPLQPHQGMVWLNLKEP-STAARSLNFRKLPASIALLQVGAKG 536
            SS+SGS  + H +  L  +     ++  LK+P S  +++   +K  AS AL+  G +G
Sbjct: 901  SSSSGSLSLSHGSSSLEHRSEDSTIYDLLKDPVSLRSKARRAKKAKASSALVVCGGQG 958


>AB002292-1|BAA20754.2| 1405|Homo sapiens KIAA0294 protein.
          Length = 1405

 Score = 30.3 bits (65), Expect = 7.2
 Identities = 18/58 (31%), Positives = 31/58 (53%), Gaps = 1/58 (1%)
 Frame = -3

Query: 706  SSTSGSTPVKHTNQGLPLQPHQGMVWLNLKEP-STAARSLNFRKLPASIALLQVGAKG 536
            SS+SGS  + H +  L  +     ++  LK+P S  +++   +K  AS AL+  G +G
Sbjct: 1318 SSSSGSLSLSHGSSSLEHRSEDSTIYDLLKDPVSLRSKARRAKKAKASSALVVCGGQG 1375


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 91,683,748
Number of Sequences: 237096
Number of extensions: 1671915
Number of successful extensions: 3131
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 3053
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3131
length of database: 76,859,062
effective HSP length: 88
effective length of database: 55,994,614
effective search space used: 8399192100
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).