SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30047
         (794 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U21938-1|AAA64309.1|  278|Homo sapiens alpha-tocopherol transfer...    39   0.024
D49488-1|BAA08449.1|  278|Homo sapiens alpha-tocopherol transfer...    39   0.024
BC058000-1|AAH58000.1|  278|Homo sapiens tocopherol (alpha) tran...    39   0.024
Z97053-6|CAI19686.1|  342|Homo sapiens chromosome 20 open readin...    36   0.22 
Z97053-5|CAI19685.1|  279|Homo sapiens chromosome 20 open readin...    36   0.22 
Z97053-4|CAO03543.1|  154|Homo sapiens chromosome 20 open readin...    36   0.22 
BC003071-1|AAH03071.2|  342|Homo sapiens chromosome 20 open read...    36   0.22 
AL132772-9|CAI18861.1|  342|Homo sapiens chromosome 20 open read...    36   0.22 
AL132772-8|CAI18860.1|  279|Homo sapiens chromosome 20 open read...    36   0.22 
AL132772-7|CAO03334.1|  154|Homo sapiens chromosome 20 open read...    36   0.22 
AF031324-1|AAC67490.1|  119|Homo sapiens alpha-tocopherol transf...    33   0.90 
BC128578-1|AAI28579.1|  751|Homo sapiens RRBP1 protein protein.        32   2.7  
AL132765-6|CAC10587.1|  977|Homo sapiens ribosome binding protei...    32   2.7  
AL132765-4|CAH74034.1| 1410|Homo sapiens ribosome binding protei...    32   2.7  
AF006751-1|AAC25977.1|  977|Homo sapiens ES/130 protein.               32   2.7  
AB287347-1|BAF73807.1| 1540|Homo sapiens p180/ribosome receptor ...    32   2.7  

>U21938-1|AAA64309.1|  278|Homo sapiens alpha-tocopherol transfer
           protein protein.
          Length = 278

 Score = 38.7 bits (86), Expect = 0.024
 Identities = 44/173 (25%), Positives = 71/173 (41%)
 Frame = +3

Query: 252 FLRGCSFSLEKCKKKLDMYFTMRAACPEFFANRDVTRPELMDLLNRAQGPTLPGLTPQGR 431
           FLR   F L+   + L  Y+  RA CPE  A  D+    ++ LL       L    P G 
Sbjct: 55  FLRARDFDLDLAWRLLKNYYKWRAECPEISA--DLHPRSIIGLLKAGYHGVLRSRDPTGS 112

Query: 432 RVTIARALDKNLDTNQLNDVFKLAMISEM*DCVKKSRE*AGDVYVLDASILMPSHLRQDF 611
           +V I R    +       DVF++++I+      +   +  G   + D      SH  Q  
Sbjct: 113 KVLIYRIAHWDPKVFTAYDVFRVSLITSELIVQEVETQRNGIKAIFDLEGWQFSHAFQ-I 171

Query: 612 TSSAEEILSFVYRKLIQ*NWKEIHVYQRISPFVGWSYFNIGKTHSLKEKIEEK 770
           T S  + ++ V         + IH+     P +  + F++ K   L EKI+E+
Sbjct: 172 TPSVAKKIAAVLTDSFPLKVRGIHLIN--EPVIFHAVFSMIKPF-LTEKIKER 221


>D49488-1|BAA08449.1|  278|Homo sapiens alpha-tocopherol transfer
           protein protein.
          Length = 278

 Score = 38.7 bits (86), Expect = 0.024
 Identities = 44/173 (25%), Positives = 71/173 (41%)
 Frame = +3

Query: 252 FLRGCSFSLEKCKKKLDMYFTMRAACPEFFANRDVTRPELMDLLNRAQGPTLPGLTPQGR 431
           FLR   F L+   + L  Y+  RA CPE  A  D+    ++ LL       L    P G 
Sbjct: 55  FLRARDFDLDLAWRLLKNYYKWRAECPEISA--DLHPRSIIGLLKAGYHGVLRSRDPTGS 112

Query: 432 RVTIARALDKNLDTNQLNDVFKLAMISEM*DCVKKSRE*AGDVYVLDASILMPSHLRQDF 611
           +V I R    +       DVF++++I+      +   +  G   + D      SH  Q  
Sbjct: 113 KVLIYRIAHWDPKVFTAYDVFRVSLITSELIVQEVETQRNGIKAIFDLEGWQFSHAFQ-I 171

Query: 612 TSSAEEILSFVYRKLIQ*NWKEIHVYQRISPFVGWSYFNIGKTHSLKEKIEEK 770
           T S  + ++ V         + IH+     P +  + F++ K   L EKI+E+
Sbjct: 172 TPSVAKKIAAVLTDSFPLKVRGIHLIN--EPVIFHAVFSMIKPF-LTEKIKER 221


>BC058000-1|AAH58000.1|  278|Homo sapiens tocopherol (alpha)
           transfer protein protein.
          Length = 278

 Score = 38.7 bits (86), Expect = 0.024
 Identities = 44/173 (25%), Positives = 71/173 (41%)
 Frame = +3

Query: 252 FLRGCSFSLEKCKKKLDMYFTMRAACPEFFANRDVTRPELMDLLNRAQGPTLPGLTPQGR 431
           FLR   F L+   + L  Y+  RA CPE  A  D+    ++ LL       L    P G 
Sbjct: 55  FLRARDFDLDLAWRLLKNYYKWRAECPEISA--DLHPRSIIGLLKAGYHGVLRSRDPTGS 112

Query: 432 RVTIARALDKNLDTNQLNDVFKLAMISEM*DCVKKSRE*AGDVYVLDASILMPSHLRQDF 611
           +V I R    +       DVF++++I+      +   +  G   + D      SH  Q  
Sbjct: 113 KVLIYRIAHWDPKVFTAYDVFRVSLITSELIVQEVETQRNGIKAIFDLEGWQFSHAFQ-I 171

Query: 612 TSSAEEILSFVYRKLIQ*NWKEIHVYQRISPFVGWSYFNIGKTHSLKEKIEEK 770
           T S  + ++ V         + IH+     P +  + F++ K   L EKI+E+
Sbjct: 172 TPSVAKKIAAVLTDSFPLKVRGIHLIN--EPVIFHAVFSMIKPF-LTEKIKER 221


>Z97053-6|CAI19686.1|  342|Homo sapiens chromosome 20 open reading
           frame 121 protein.
          Length = 342

 Score = 35.5 bits (78), Expect = 0.22
 Identities = 19/50 (38%), Positives = 30/50 (60%), Gaps = 1/50 (2%)
 Frame = +1

Query: 118 ELWKKIREELNEDVNTRAQDLAAIKEWLRKQ-PHLPDEWEDACLMTFSEA 264
           +L  K REEL E    R +D+ A+++ +RK+ P+L    +DA L+ F  A
Sbjct: 38  DLVTKAREELQEKPEWRLRDVQALRDMVRKEYPNLSTSLDDAFLLRFLRA 87


>Z97053-5|CAI19685.1|  279|Homo sapiens chromosome 20 open reading
           frame 121 protein.
          Length = 279

 Score = 35.5 bits (78), Expect = 0.22
 Identities = 19/50 (38%), Positives = 30/50 (60%), Gaps = 1/50 (2%)
 Frame = +1

Query: 118 ELWKKIREELNEDVNTRAQDLAAIKEWLRKQ-PHLPDEWEDACLMTFSEA 264
           +L  K REEL E    R +D+ A+++ +RK+ P+L    +DA L+ F  A
Sbjct: 38  DLVTKAREELQEKPEWRLRDVQALRDMVRKEYPNLSTSLDDAFLLRFLRA 87


>Z97053-4|CAO03543.1|  154|Homo sapiens chromosome 20 open reading
           frame 121 protein.
          Length = 154

 Score = 35.5 bits (78), Expect = 0.22
 Identities = 19/50 (38%), Positives = 30/50 (60%), Gaps = 1/50 (2%)
 Frame = +1

Query: 118 ELWKKIREELNEDVNTRAQDLAAIKEWLRKQ-PHLPDEWEDACLMTFSEA 264
           +L  K REEL E    R +D+ A+++ +RK+ P+L    +DA L+ F  A
Sbjct: 38  DLVTKAREELQEKPEWRLRDVQALRDMVRKEYPNLSTSLDDAFLLRFLRA 87


>BC003071-1|AAH03071.2|  342|Homo sapiens chromosome 20 open reading
           frame 121 protein.
          Length = 342

 Score = 35.5 bits (78), Expect = 0.22
 Identities = 19/50 (38%), Positives = 30/50 (60%), Gaps = 1/50 (2%)
 Frame = +1

Query: 118 ELWKKIREELNEDVNTRAQDLAAIKEWLRKQ-PHLPDEWEDACLMTFSEA 264
           +L  K REEL E    R +D+ A+++ +RK+ P+L    +DA L+ F  A
Sbjct: 38  DLVTKAREELQEKPEWRLRDVQALRDMVRKEYPNLSTSLDDAFLLRFLRA 87


>AL132772-9|CAI18861.1|  342|Homo sapiens chromosome 20 open reading
           frame 121 protein.
          Length = 342

 Score = 35.5 bits (78), Expect = 0.22
 Identities = 19/50 (38%), Positives = 30/50 (60%), Gaps = 1/50 (2%)
 Frame = +1

Query: 118 ELWKKIREELNEDVNTRAQDLAAIKEWLRKQ-PHLPDEWEDACLMTFSEA 264
           +L  K REEL E    R +D+ A+++ +RK+ P+L    +DA L+ F  A
Sbjct: 38  DLVTKAREELQEKPEWRLRDVQALRDMVRKEYPNLSTSLDDAFLLRFLRA 87


>AL132772-8|CAI18860.1|  279|Homo sapiens chromosome 20 open reading
           frame 121 protein.
          Length = 279

 Score = 35.5 bits (78), Expect = 0.22
 Identities = 19/50 (38%), Positives = 30/50 (60%), Gaps = 1/50 (2%)
 Frame = +1

Query: 118 ELWKKIREELNEDVNTRAQDLAAIKEWLRKQ-PHLPDEWEDACLMTFSEA 264
           +L  K REEL E    R +D+ A+++ +RK+ P+L    +DA L+ F  A
Sbjct: 38  DLVTKAREELQEKPEWRLRDVQALRDMVRKEYPNLSTSLDDAFLLRFLRA 87


>AL132772-7|CAO03334.1|  154|Homo sapiens chromosome 20 open reading
           frame 121 protein.
          Length = 154

 Score = 35.5 bits (78), Expect = 0.22
 Identities = 19/50 (38%), Positives = 30/50 (60%), Gaps = 1/50 (2%)
 Frame = +1

Query: 118 ELWKKIREELNEDVNTRAQDLAAIKEWLRKQ-PHLPDEWEDACLMTFSEA 264
           +L  K REEL E    R +D+ A+++ +RK+ P+L    +DA L+ F  A
Sbjct: 38  DLVTKAREELQEKPEWRLRDVQALRDMVRKEYPNLSTSLDDAFLLRFLRA 87


>AF031324-1|AAC67490.1|  119|Homo sapiens alpha-tocopherol transfer
           protein protein.
          Length = 119

 Score = 33.5 bits (73), Expect = 0.90
 Identities = 22/66 (33%), Positives = 29/66 (43%)
 Frame = +3

Query: 252 FLRGCSFSLEKCKKKLDMYFTMRAACPEFFANRDVTRPELMDLLNRAQGPTLPGLTPQGR 431
           FLR   F L+   + L  Y+  RA CPE  A  D+    ++ LL       L    P G 
Sbjct: 55  FLRARDFDLDLAWRLLKNYYKWRAECPEISA--DLHPRSIIGLLKAGYHGVLRSRDPTGS 112

Query: 432 RVTIAR 449
           +V I R
Sbjct: 113 KVLIYR 118


>BC128578-1|AAI28579.1|  751|Homo sapiens RRBP1 protein protein.
          Length = 751

 Score = 31.9 bits (69), Expect = 2.7
 Identities = 23/79 (29%), Positives = 34/79 (43%), Gaps = 1/79 (1%)
 Frame = -1

Query: 467 QVLVQCSGDGYSSTLRRQARECRSLG-SIQQVH*LWSGYVSVREELWASSPHREVHIKFL 291
           Q  +Q   D Y S L       R L  S+++   +W   V   EE    S     H++ +
Sbjct: 462 QSTLQAECDQYRSILAETEGMLRDLQKSVEEEEQVWRAKVGAAEEELQKSRVTVKHLEEI 521

Query: 290 FTFLKGEATASEKVIRHAS 234
              LKGE  +S++V  H S
Sbjct: 522 VEKLKGELESSDQVREHTS 540


>AL132765-6|CAC10587.1|  977|Homo sapiens ribosome binding protein 1
           homolog 180kDa (dog) protein.
          Length = 977

 Score = 31.9 bits (69), Expect = 2.7
 Identities = 23/79 (29%), Positives = 34/79 (43%), Gaps = 1/79 (1%)
 Frame = -1

Query: 467 QVLVQCSGDGYSSTLRRQARECRSLG-SIQQVH*LWSGYVSVREELWASSPHREVHIKFL 291
           Q  +Q   D Y S L       R L  S+++   +W   V   EE    S     H++ +
Sbjct: 688 QSTLQAECDQYRSILAETEGMLRDLQKSVEEEEQVWRAKVGAAEEELQKSRVTVKHLEEI 747

Query: 290 FTFLKGEATASEKVIRHAS 234
              LKGE  +S++V  H S
Sbjct: 748 VEKLKGELESSDQVREHTS 766


>AL132765-4|CAH74034.1| 1410|Homo sapiens ribosome binding protein 1
            homolog 180kDa (dog) protein.
          Length = 1410

 Score = 31.9 bits (69), Expect = 2.7
 Identities = 23/79 (29%), Positives = 34/79 (43%), Gaps = 1/79 (1%)
 Frame = -1

Query: 467  QVLVQCSGDGYSSTLRRQARECRSLG-SIQQVH*LWSGYVSVREELWASSPHREVHIKFL 291
            Q  +Q   D Y S L       R L  S+++   +W   V   EE    S     H++ +
Sbjct: 1121 QSTLQAECDQYRSILAETEGMLRDLQKSVEEEEQVWRAKVGAAEEELQKSRVTVKHLEEI 1180

Query: 290  FTFLKGEATASEKVIRHAS 234
               LKGE  +S++V  H S
Sbjct: 1181 VEKLKGELESSDQVREHTS 1199


>AF006751-1|AAC25977.1|  977|Homo sapiens ES/130 protein.
          Length = 977

 Score = 31.9 bits (69), Expect = 2.7
 Identities = 23/79 (29%), Positives = 34/79 (43%), Gaps = 1/79 (1%)
 Frame = -1

Query: 467 QVLVQCSGDGYSSTLRRQARECRSLG-SIQQVH*LWSGYVSVREELWASSPHREVHIKFL 291
           Q  +Q   D Y S L       R L  S+++   +W   V   EE    S     H++ +
Sbjct: 688 QSTLQAECDQYRSILAETEGMLRDLQKSVEEEEQVWRAKVGAAEEELQKSRVTVKHLEEI 747

Query: 290 FTFLKGEATASEKVIRHAS 234
              LKGE  +S++V  H S
Sbjct: 748 VEKLKGELESSDQVREHTS 766


>AB287347-1|BAF73807.1| 1540|Homo sapiens p180/ribosome receptor
            protein.
          Length = 1540

 Score = 31.9 bits (69), Expect = 2.7
 Identities = 23/79 (29%), Positives = 34/79 (43%), Gaps = 1/79 (1%)
 Frame = -1

Query: 467  QVLVQCSGDGYSSTLRRQARECRSLG-SIQQVH*LWSGYVSVREELWASSPHREVHIKFL 291
            Q  +Q   D Y S L       R L  S+++   +W   V   EE    S     H++ +
Sbjct: 1251 QSTLQAECDQYRSILAETEGMLRDLQKSVEEEEQVWRAKVGAAEEELQKSRVTVKHLEEI 1310

Query: 290  FTFLKGEATASEKVIRHAS 234
               LKGE  +S++V  H S
Sbjct: 1311 VEKLKGELESSDQVREHTS 1329


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 125,466,699
Number of Sequences: 237096
Number of extensions: 2910909
Number of successful extensions: 6131
Number of sequences better than 10.0: 16
Number of HSP's better than 10.0 without gapping: 5869
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6129
length of database: 76,859,062
effective HSP length: 89
effective length of database: 55,757,518
effective search space used: 9757565650
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).