SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30038
         (661 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

X04098-1|CAA27723.1|  375|Homo sapiens gamma-actin protein.           186   8e-47
X00351-1|CAA25099.1|  375|Homo sapiens protein ( Human mRNA for ...   186   8e-47
M19283-1|AAA51579.1|  375|Homo sapiens ACTG1 protein.                 186   8e-47
M10277-1|AAA51567.1|  375|Homo sapiens protein ( Human cytoplasm...   186   8e-47
DQ471327-1|ABF01018.1|  375|Homo sapiens PS1TP5-binding protein ...   186   8e-47
BT019856-1|AAV38659.1|  375|Homo sapiens actin, gamma 1 protein.      186   8e-47
BC053572-1|AAH53572.1|  375|Homo sapiens actin, gamma 1 protein.      186   8e-47
BC018774-1|AAH18774.1|  375|Homo sapiens ACTG1 protein protein.       186   8e-47
BC017450-1|AAH17450.1|  363|Homo sapiens Unknown (protein for IM...   186   8e-47
BC015779-1|AAH15779.1|  375|Homo sapiens ACTG1 protein protein.       186   8e-47
BC015695-1|AAH15695.1|  375|Homo sapiens actin, gamma 1 protein.      186   8e-47
BC015005-1|AAH15005.1|  375|Homo sapiens ACTG1 protein protein.       186   8e-47
BC014861-1|AAH14861.1|  375|Homo sapiens actin, beta protein.         186   8e-47
BC013380-1|AAH13380.1|  375|Homo sapiens actin, beta protein.         186   8e-47
BC012050-1|AAH12050.1|  375|Homo sapiens actin, gamma 1 protein.      186   8e-47
BC010999-1|AAH10999.1|  375|Homo sapiens actin, gamma 1 protein.      186   8e-47
BC009848-1|AAH09848.1|  375|Homo sapiens actin, gamma 1 protein.      186   8e-47
BC008633-1|AAH08633.1|  368|Homo sapiens actin, beta protein.         186   8e-47
BC007442-1|AAH07442.1|  375|Homo sapiens actin, gamma 1 protein.      186   8e-47
BC004251-1|AAH04251.1|  375|Homo sapiens actin, beta protein.         186   8e-47
BC002409-1|AAH02409.1|  375|Homo sapiens actin, beta protein.         186   8e-47
BC001920-1|AAH01920.1|  375|Homo sapiens ACTG1 protein protein.       186   8e-47
BC001301-1|AAH01301.1|  375|Homo sapiens actin, beta protein.         186   8e-47
BC000292-1|AAH00292.1|  375|Homo sapiens actin, gamma 1 protein.      186   8e-47
AY582799-1|AAS79319.1|  375|Homo sapiens actin, beta protein.         186   8e-47
AK223055-1|BAD96775.1|  375|Homo sapiens beta actin variant prot...   186   8e-47
AK223032-1|BAD96752.1|  375|Homo sapiens beta actin variant prot...   186   8e-47
AK222925-1|BAD96645.1|  375|Homo sapiens beta actin variant prot...   186   8e-47
AC006483-1|AAP22343.1|  375|Homo sapiens unknown protein.             186   8e-47
X63432-1|CAA45026.1|  375|Homo sapiens mutant beta-actin  (beta'...   184   2e-46
BC016045-1|AAH16045.1|  375|Homo sapiens actin, beta protein.         184   3e-46
BC012854-1|AAH12854.1|  360|Homo sapiens ACTB protein protein.        183   6e-46
M20543-1|AAA60296.1|  377|Homo sapiens ACTA1 protein.                 182   1e-45
J00073-1|AAB59619.1|  377|Homo sapiens alpha-cardiac actin protein.   182   1e-45
J00068-1|AAB59376.1|  377|Homo sapiens ACTA1 protein.                 182   1e-45
CR541796-1|CAG46595.1|  377|Homo sapiens ACTA1 protein.               182   1e-45
CR541795-1|CAG46594.1|  377|Homo sapiens ACTC protein.                182   1e-45
CR536516-1|CAG38754.1|  377|Homo sapiens ACTA1 protein.               182   1e-45
BC012597-1|AAH12597.1|  377|Homo sapiens actin, alpha 1, skeleta...   182   1e-45
BC009978-1|AAH09978.1|  377|Homo sapiens actin, alpha, cardiac m...   182   1e-45
AY280960-1|AAP37280.1|  254|Homo sapiens actin alpha 1 skeletal ...   182   1e-45
AL160004-6|CAI19050.1|  377|Homo sapiens actin, alpha 1, skeleta...   182   1e-45
AF182035-1|AAF02694.1|  377|Homo sapiens skeletal muscle alpha-a...   182   1e-45
X16940-1|CAA34814.1|  376|Homo sapiens protein ( Human mRNA for ...   180   4e-45
X13839-1|CAA32064.1|  377|Homo sapiens protein ( Human mRNA for ...   180   4e-45
K01747-1|AAA51586.1|  330|Homo sapiens ACTA2 protein.                 180   4e-45
J05192-1|AAA51577.1|  377|Homo sapiens ACTA3 protein.                 180   4e-45
D00654-1|BAA00546.1|  376|Homo sapiens enteric smooth muscle gam...   180   4e-45
CR541794-1|CAG46593.1|  376|Homo sapiens ACTG2 protein.               180   4e-45
CR536518-1|CAG38756.1|  377|Homo sapiens ACTA2 protein.               180   4e-45
BC094877-1|AAH94877.1|  376|Homo sapiens ACTG2 protein protein.       180   4e-45
BC093052-1|AAH93052.1|  377|Homo sapiens actin, alpha 2, smooth ...   180   4e-45
BC017554-1|AAH17554.1|  377|Homo sapiens actin, alpha 2, smooth ...   180   4e-45
BC012617-1|AAH12617.1|  376|Homo sapiens actin, gamma 2, smooth ...   180   4e-45
AY692464-1|AAW29811.1|  377|Homo sapiens growth-inhibiting gene ...   180   4e-45
AL157394-6|CAI13864.1|  377|Homo sapiens actin, alpha 2, smooth ...   180   4e-45
AC073046-2|AAX88909.1|  376|Homo sapiens unknown protein.             180   4e-45
EF523384-1|ABP57734.1| 1075|Homo sapiens POTE-2 alpha-actin prot...   180   5e-45
CR536515-1|CAG38753.1|  376|Homo sapiens ACTG2 protein.               179   7e-45
AL157394-7|CAI13865.1|  151|Homo sapiens actin, alpha 2, smooth ...   177   3e-44
AY129015-1|AAM98758.1|  109|Homo sapiens unknown protein.             155   2e-37
EF095209-1|ABL01513.1|  121|Homo sapiens beta-actin protein.          149   1e-35
AY970501-1|AAX82307.1|  103|Homo sapiens actin-like protein prot...   146   6e-35
AY970499-1|AAX82305.1|  103|Homo sapiens actin-like protein prot...   146   6e-35
AY970498-1|AAX82304.1|  103|Homo sapiens actin-like protein prot...   146   6e-35
AY970497-1|AAX82303.1|  103|Homo sapiens actin-like protein prot...   146   6e-35
AY970495-1|AAX82301.1|  103|Homo sapiens actin-like protein prot...   146   6e-35
AY970494-1|AAX82300.1|  103|Homo sapiens actin-like protein prot...   146   6e-35
AY970493-1|AAX82299.1|  103|Homo sapiens actin-like protein prot...   146   6e-35
AY970491-1|AAX82297.1|  103|Homo sapiens actin-like protein prot...   146   6e-35
AY970489-1|AAX82295.1|  103|Homo sapiens actin-like protein prot...   146   6e-35
AY970488-1|AAX82294.1|  103|Homo sapiens actin-like protein prot...   146   6e-35
AY970487-1|AAX82293.1|  103|Homo sapiens actin-like protein prot...   146   6e-35
AY970486-1|AAX82292.1|  103|Homo sapiens actin-like protein prot...   146   6e-35
AY970478-1|AAX82284.1|  103|Homo sapiens actin-like protein prot...   146   6e-35
AY970477-1|AAX82283.1|  103|Homo sapiens actin-like protein prot...   146   6e-35
AY970476-1|AAX82282.1|  103|Homo sapiens actin-like protein prot...   146   6e-35
AY970474-1|AAX82280.1|  103|Homo sapiens actin-like protein prot...   146   6e-35
AY970473-1|AAX82279.1|  103|Homo sapiens actin-like protein prot...   146   6e-35
AY970472-1|AAX82278.1|  103|Homo sapiens actin-like protein prot...   146   6e-35
AY970471-1|AAX82277.1|  103|Homo sapiens actin-like protein prot...   146   6e-35
AY970470-1|AAX82276.1|  103|Homo sapiens actin-like protein prot...   146   6e-35
AY970469-1|AAX82275.1|  103|Homo sapiens actin-like protein prot...   146   6e-35
AY970468-1|AAX82274.1|  103|Homo sapiens actin-like protein prot...   146   6e-35
AY970443-1|AAX82252.1|  103|Homo sapiens actin-like protein prot...   146   6e-35
AY970441-1|AAX82250.1|  103|Homo sapiens actin-like protein prot...   146   6e-35
AY970419-1|AAX82228.1|  103|Homo sapiens actin-like protein prot...   146   6e-35
AY970418-1|AAX82227.1|  103|Homo sapiens actin-like protein prot...   146   6e-35
AY970417-1|AAX82226.1|  103|Homo sapiens actin-like protein prot...   146   6e-35
AY970416-1|AAX82225.1|  103|Homo sapiens actin-like protein prot...   146   6e-35
AY970415-1|AAX82224.1|  103|Homo sapiens actin-like protein prot...   146   6e-35
AY970414-1|AAX82223.1|  103|Homo sapiens actin-like protein prot...   146   6e-35
AY970413-1|AAX82222.1|  103|Homo sapiens actin-like protein prot...   146   6e-35
AY970412-1|AAX82221.1|  103|Homo sapiens actin-like protein prot...   146   6e-35
AY970411-1|AAX82220.1|  103|Homo sapiens actin-like protein prot...   146   6e-35
AY970410-1|AAX82219.1|  103|Homo sapiens actin-like protein prot...   146   6e-35
AY970409-1|AAX82218.1|  103|Homo sapiens actin-like protein prot...   146   6e-35
AY970408-1|AAX82217.1|  103|Homo sapiens actin-like protein prot...   146   6e-35
AY970406-1|AAX82215.1|  103|Homo sapiens actin-like protein prot...   146   6e-35
AY970405-1|AAX82214.1|  103|Homo sapiens actin-like protein prot...   146   6e-35
AY970404-1|AAX82213.1|  103|Homo sapiens actin-like protein prot...   146   6e-35
AY970403-1|AAX82212.1|  103|Homo sapiens actin-like protein prot...   146   6e-35
AY970402-1|AAX82211.1|  103|Homo sapiens actin-like protein prot...   146   6e-35
AY970383-1|AAX82192.1|  103|Homo sapiens actin-like protein prot...   146   6e-35
AY970382-1|AAX82191.1|  103|Homo sapiens actin-like protein prot...   146   6e-35
AY970381-1|AAX82190.1|  103|Homo sapiens actin-like protein prot...   146   6e-35
AY970380-1|AAX82189.1|  103|Homo sapiens actin-like protein prot...   146   6e-35
AY970377-1|AAX82186.1|  103|Homo sapiens actin-like protein prot...   146   6e-35
AY970376-1|AAX82185.1|  103|Homo sapiens actin-like protein prot...   146   6e-35
AY970375-1|AAX82184.1|  103|Homo sapiens actin-like protein prot...   146   6e-35
AY970372-1|AAX82182.1|  103|Homo sapiens actin-like protein prot...   146   6e-35
AY970371-1|AAX82181.1|  103|Homo sapiens actin-like protein prot...   146   6e-35
AY970370-1|AAX82180.1|  103|Homo sapiens actin-like protein prot...   146   6e-35
AY970369-1|AAX82179.1|  103|Homo sapiens actin-like protein prot...   146   6e-35
AY970368-1|AAX82178.1|  103|Homo sapiens actin-like protein prot...   146   6e-35
AY970366-1|AAX82176.1|  103|Homo sapiens actin-like protein prot...   146   6e-35
AY970364-1|AAX82174.1|  103|Homo sapiens actin-like protein prot...   146   6e-35
AY970363-1|AAX82173.1|  103|Homo sapiens actin-like protein prot...   146   6e-35
AY970421-1|AAX82230.1|  103|Homo sapiens actin-like protein prot...   146   8e-35
AY970492-1|AAX82298.1|  103|Homo sapiens actin-like protein prot...   145   1e-34
AY970490-1|AAX82296.1|  103|Homo sapiens actin-like protein prot...   144   2e-34
AY970479-1|AAX82285.1|  103|Homo sapiens actin-like protein prot...   144   2e-34
AY970444-1|AAX82253.1|  103|Homo sapiens actin-like protein prot...   144   2e-34
AY970502-1|AAX82308.1|  103|Homo sapiens actin-like protein prot...   144   2e-34
AY970500-1|AAX82306.1|  103|Homo sapiens actin-like protein prot...   144   2e-34
AY970480-1|AAX82286.1|  103|Homo sapiens actin-like protein prot...   144   2e-34
AY970464-1|AAX82271.1|  103|Homo sapiens actin-like protein prot...   144   2e-34
AY970460-1|AAX82267.1|  103|Homo sapiens actin-like protein prot...   144   2e-34
AY970457-1|AAX82264.1|  103|Homo sapiens actin-like protein prot...   144   2e-34
AY970446-1|AAX82255.1|  103|Homo sapiens actin-like protein prot...   144   2e-34
AY970442-1|AAX82251.1|  103|Homo sapiens actin-like protein prot...   144   2e-34
AY970431-1|AAX82240.1|  103|Homo sapiens actin-like protein prot...   144   2e-34
AY970430-1|AAX82239.1|  103|Homo sapiens actin-like protein prot...   144   2e-34
AY970428-1|AAX82237.1|  103|Homo sapiens actin-like protein prot...   144   2e-34
AY970390-1|AAX82199.1|  103|Homo sapiens actin-like protein prot...   144   2e-34
AY970389-1|AAX82198.1|  103|Homo sapiens actin-like protein prot...   144   2e-34
AY970386-1|AAX82195.1|  103|Homo sapiens actin-like protein prot...   144   2e-34
AY970378-1|AAX82187.1|  103|Homo sapiens actin-like protein prot...   144   2e-34
AY970374-1|AAX82183.1|  103|Homo sapiens actin-like protein prot...   144   3e-34
AY970485-1|AAX82291.1|  103|Homo sapiens actin-like protein prot...   143   4e-34
AY970365-1|AAX82175.1|  103|Homo sapiens actin-like protein prot...   143   4e-34
AY970496-1|AAX82302.1|  103|Homo sapiens actin-like protein prot...   143   6e-34
AY970420-1|AAX82229.1|  103|Homo sapiens actin-like protein prot...   143   6e-34
AY970367-1|AAX82177.1|  103|Homo sapiens actin-like protein prot...   143   6e-34
AY970458-1|AAX82265.1|  103|Homo sapiens actin-like protein prot...   142   8e-34
AY970456-1|AAX82263.1|  103|Homo sapiens actin-like protein prot...   142   8e-34
AY970429-1|AAX82238.1|  103|Homo sapiens actin-like protein prot...   142   8e-34
AY970388-1|AAX82197.1|  103|Homo sapiens actin-like protein prot...   142   8e-34
AY970387-1|AAX82196.1|  103|Homo sapiens actin-like protein prot...   142   8e-34
AY970463-1|AAX82270.1|  103|Homo sapiens actin-like protein prot...   142   1e-33
AY970392-1|AAX82201.1|  103|Homo sapiens actin-like protein prot...   142   1e-33
AY970385-1|AAX82194.1|  103|Homo sapiens actin-like protein prot...   142   1e-33
AY970391-1|AAX82200.1|  103|Homo sapiens actin-like protein prot...   142   1e-33
AY970462-1|AAX82269.1|  103|Homo sapiens actin-like protein prot...   141   2e-33
AY970426-1|AAX82235.1|  103|Homo sapiens actin-like protein prot...   141   2e-33
AY970454-1|AAX82261.1|  103|Homo sapiens actin-like protein prot...   141   2e-33
AY970440-1|AAX82249.1|  103|Homo sapiens actin-like protein prot...   141   2e-33
AY970439-1|AAX82248.1|  103|Homo sapiens actin-like protein prot...   141   2e-33
AY970475-1|AAX82281.1|  103|Homo sapiens actin-like protein prot...   140   3e-33
AY970455-1|AAX82262.1|  103|Homo sapiens actin-like protein prot...   140   3e-33
AY970483-1|AAX82289.1|  103|Homo sapiens actin-like protein prot...   140   4e-33
AY970432-1|AAX82241.1|  103|Homo sapiens actin-like protein prot...   140   4e-33
AY970407-1|AAX82216.1|  103|Homo sapiens actin-like protein prot...   139   7e-33
AY970461-1|AAX82268.1|  103|Homo sapiens actin-like protein prot...   139   9e-33
AY970451-1|AAX82259.1|  103|Homo sapiens actin-like protein prot...   138   2e-32
AY970384-1|AAX82193.1|  103|Homo sapiens actin-like protein prot...   138   2e-32
AY970424-1|AAX82233.1|  103|Homo sapiens actin-like protein prot...   137   3e-32
AY970427-1|AAX82236.1|  103|Homo sapiens actin-like protein prot...   137   4e-32
AY970452-1|AAX82260.1|  103|Homo sapiens actin-like protein prot...   136   5e-32
AY970433-1|AAX82242.1|  103|Homo sapiens actin-like protein prot...   136   9e-32
AY970447-1|AAX82256.1|  103|Homo sapiens actin-like protein prot...   135   2e-31
AY970425-1|AAX82234.1|  103|Homo sapiens actin-like protein prot...   134   3e-31
AY970481-1|AAX82287.1|  103|Homo sapiens actin-like protein prot...   132   8e-31
AY970459-1|AAX82266.1|  103|Homo sapiens actin-like protein prot...   132   8e-31
AY970398-1|AAX82207.1|  103|Homo sapiens actin-like protein prot...   131   2e-30
AL160004-5|CAI19052.1|  342|Homo sapiens actin, alpha 1, skeleta...   131   2e-30
AL160004-4|CAI19051.1|  287|Homo sapiens actin, alpha 1, skeleta...   131   2e-30
AY970400-1|AAX82209.1|  103|Homo sapiens actin-like protein prot...   129   1e-29
AY970396-1|AAX82205.1|  103|Homo sapiens actin-like protein prot...   129   1e-29
AY970448-1|AAX82257.1|  103|Homo sapiens actin-like protein prot...   128   1e-29
AY970467-1|AAX82273.1|  103|Homo sapiens actin-like protein prot...   127   3e-29
AY970422-1|AAX82231.1|  103|Homo sapiens actin-like protein prot...   127   3e-29
AY970401-1|AAX82210.1|  103|Homo sapiens actin-like protein prot...   127   3e-29
AY970445-1|AAX82254.1|  103|Homo sapiens actin-like protein prot...   126   5e-29
AY970423-1|AAX82232.1|  103|Homo sapiens actin-like protein prot...   126   9e-29
Z14978-1|CAA78701.1|  376|Homo sapiens actin-related protein pro...   125   1e-28
X82206-1|CAA57690.1|  376|Homo sapiens alpha-centractin protein.      125   1e-28
BC026016-1|AAH26016.1|  376|Homo sapiens ARP1 actin-related prot...   125   1e-28
BC000693-1|AAH00693.1|  376|Homo sapiens ARP1 actin-related prot...   125   1e-28
AL121928-12|CAC08404.1|  376|Homo sapiens ARP1 actin-related pro...   125   1e-28
X82208-1|CAA57692.1|  329|Homo sapiens beta-centractin protein.       125   2e-28
X82207-1|CAA57691.1|  376|Homo sapiens beta-centracetin protein.      125   2e-28
BC010090-1|AAH10090.1|  376|Homo sapiens ARP1 actin-related prot...   125   2e-28
BC006372-1|AAH06372.1|  376|Homo sapiens ARP1 actin-related prot...   125   2e-28
BC004374-1|AAH04374.1|  376|Homo sapiens ARP1 actin-related prot...   125   2e-28
AC017099-2|AAY24280.1|  376|Homo sapiens unknown protein.             125   2e-28
AY970395-1|AAX82204.1|  103|Homo sapiens actin-like protein prot...   124   3e-28
AY970438-1|AAX82247.1|  103|Homo sapiens actin-like protein prot...   121   2e-27
AY970379-1|AAX82188.1|  103|Homo sapiens actin-like protein prot...   121   2e-27
AY970503-1|AAX82309.1|  103|Homo sapiens actin-like protein prot...   121   3e-27
AY970465-1|AAX82272.1|  103|Homo sapiens actin-like protein prot...   121   3e-27
AY970437-1|AAX82246.1|  103|Homo sapiens actin-like protein prot...   121   3e-27
AY970484-1|AAX82290.1|  103|Homo sapiens actin-like protein prot...   118   2e-26
AY970394-1|AAX82203.1|  103|Homo sapiens actin-like protein prot...   118   2e-26
AY970450-1|AAX82258.1|  102|Homo sapiens actin-like protein prot...   117   4e-26
AY970436-1|AAX82245.1|  103|Homo sapiens actin-like protein prot...   116   6e-26
AY970397-1|AAX82206.1|  103|Homo sapiens actin-like protein prot...   116   7e-26
AY970482-1|AAX82288.1|  103|Homo sapiens actin-like protein prot...   114   2e-25
AY970434-1|AAX82243.1|  103|Homo sapiens actin-like protein prot...   114   3e-25
AY970435-1|AAX82244.1|  103|Homo sapiens actin-like protein prot...   113   7e-25
AY970393-1|AAX82202.1|  103|Homo sapiens actin-like protein prot...   111   3e-24
Z74696-1|CAI42428.1|  376|Homo sapiens actin-related protein T1 ...   109   1e-23
BC014597-1|AAH14597.1|  376|Homo sapiens actin-related protein T...   109   1e-23
AF440739-1|AAM00432.1|  376|Homo sapiens actin-related protein T...   109   1e-23
BC014610-1|AAH14610.1|  435|Homo sapiens actin-like 7A protein.       108   2e-23
AL359692-4|CAI40571.1|  435|Homo sapiens actin-like 7A protein.       108   2e-23
AF113526-1|AAD44109.1|  435|Homo sapiens actin-like-7-alpha prot...   108   2e-23
AB284520-1|BAF41971.1|  435|Homo sapiens human t-actin 2 protein.     108   2e-23
BC029499-1|AAH29499.1|  376|Homo sapiens actin-related protein T...   105   1e-22
AL356984-1|CAH72587.1|  377|Homo sapiens actin-related protein M...   105   1e-22
AK058153-1|BAB71690.1|  328|Homo sapiens protein ( Homo sapiens ...   105   1e-22
AF440740-1|AAM00433.1|  377|Homo sapiens actin-related protein T...   105   1e-22
AB057364-1|BAB85862.1|  377|Homo sapiens actin-related protein h...   105   1e-22
BC033789-1|AAH33789.1|  415|Homo sapiens actin-like 7B protein.       102   1e-21
AL359692-3|CAI40570.1|  415|Homo sapiens actin-like 7B protein.       102   1e-21
AF113527-1|AAD44110.1|  415|Homo sapiens actin-like-7-beta protein.   102   1e-21
AB284521-1|BAF41972.1|  415|Homo sapiens t-actin 1 protein.           102   1e-21
AK055346-1|BAB70906.1|  372|Homo sapiens protein ( Homo sapiens ...   101   2e-21
AB049117-1|BAB39481.1|  372|Homo sapiens actin related protein p...   101   2e-21
BC036253-1|AAH36253.1|  339|Homo sapiens ACTR2 protein protein.       101   2e-21
AF006082-1|AAB64187.1|  394|Homo sapiens Arp2 protein.                101   2e-21
BC014546-1|AAH14546.1|  394|Homo sapiens ARP2 actin-related prot...   101   3e-21
BC045752-1|AAH45752.1|  416|Homo sapiens hypothetical protein MG...    99   1e-20
BC024028-1|AAH24028.1|  416|Homo sapiens hypothetical protein MG...    99   1e-20
M16247-1|AAA51580.1|  232|Homo sapiens ACTG1 protein.                  97   4e-20
BC113036-1|AAI13037.1|  103|Homo sapiens ACTB protein protein.         97   4e-20
BC023548-1|AAH23548.1|  263|Homo sapiens ACTG1 protein protein.        97   4e-20
AY970399-1|AAX82208.1|   97|Homo sapiens actin-like protein prot...    97   5e-20
BC007289-1|AAH07289.1|  372|Homo sapiens actin related protein M...    97   6e-20
BC044590-1|AAH44590.1|  418|Homo sapiens ARP3 actin-related prot...    94   3e-19
AF127773-1|AAD51904.1|  418|Homo sapiens unknown protein.              94   3e-19
AF006083-1|AAB64188.1|  418|Homo sapiens Arp3 protein.                 94   3e-19
AC110769-1|AAX93226.1|  418|Homo sapiens unknown protein.              94   3e-19
AB209353-1|BAD92590.1|  369|Homo sapiens ARP3 actin-related prot...    94   3e-19
BC015207-1|AAH15207.1|  348|Homo sapiens ARP3 actin-related prot...    94   5e-19
BC008682-1|AAH08682.1|  418|Homo sapiens ARP3 actin-related prot...    94   5e-19
AF086920-1|AAP97150.1|  402|Homo sapiens actin related protein A...    94   5e-19
AF023453-1|AAC98904.1|  418|Homo sapiens actin-related protein 3...    94   5e-19
BC020944-1|AAH20944.1|  426|Homo sapiens actin-like 6B protein.        88   3e-17
AF053356-5|AAC78795.1|  475|Homo sapiens actin like gene protein.      88   3e-17
AF041475-1|AAD54678.1|  426|Homo sapiens BAF53b protein.               88   3e-17
AC099394-1|AAP21874.1|  426|Homo sapiens unknown protein.              88   3e-17
AB015906-1|BAA74576.1|  426|Homo sapiens actin-related protein h...    88   3e-17
BC036371-1|AAH36371.1|  429|Homo sapiens actin-like 6A protein.        87   4e-17
BC001391-1|AAH01391.1|  429|Homo sapiens actin-like 6A protein.        87   4e-17
BC000949-1|AAH00949.1|  387|Homo sapiens actin-like 6A protein.        87   4e-17
AK223212-1|BAD96932.1|  429|Homo sapiens actin-like 6A isoform 1...    87   4e-17
AF041474-1|AAC94991.1|  429|Homo sapiens BAF53a protein.               87   4e-17
AB061315-1|BAB87848.1|  387|Homo sapiens hArpNbeta-s protein.          87   4e-17
AB060168-1|BAB87844.1|  387|Homo sapiens hArpNbeta-s protein.          87   4e-17
AB015907-1|BAA74577.1|  429|Homo sapiens actin-related protein h...    87   4e-17
CR533529-1|CAG38560.1|  429|Homo sapiens BAF53A protein.               87   7e-17
BC028909-1|AAH28909.1|  366|Homo sapiens actin-like 8 protein.         77   4e-14
AL136529-1|CAC15940.1|  366|Homo sapiens actin-like 8 protein.         77   4e-14
AK057339-1|BAB71434.1|  366|Homo sapiens protein ( Homo sapiens ...    77   4e-14
AB209174-1|BAD92411.1|  282|Homo sapiens actin-related protein 3...    55   3e-07
AB039791-1|BAB21501.1|  210|Homo sapiens actin-related protein A...    55   3e-07
BC038402-1|AAH38402.1|  607|Homo sapiens ARP5 actin-related prot...    50   7e-06
AY211911-1|AAO65164.1|  280|Homo sapiens sarcoma antigen NY-SAR-...    50   7e-06
AL133519-2|CAD37358.1|  607|Homo sapiens ARP5 actin-related prot...    50   7e-06
AK022847-1|BAB14270.1|  607|Homo sapiens protein ( Homo sapiens ...    50   7e-06
BC092424-1|AAH92424.1|  219|Homo sapiens Unknown (protein for MG...    49   1e-05
U20582-1|AAA62476.1|  302|Homo sapiens protein ( Human actin-lik...    43   8e-04
BC015107-1|AAH15107.1|  396|Homo sapiens ARP6 actin-related prot...    40   0.008
AK222959-1|BAD96679.1|  396|Homo sapiens ARP6 actin-related prot...    40   0.008
AK023495-1|BAB14588.1|  396|Homo sapiens protein ( Homo sapiens ...    40   0.008
AF212251-1|AAK14934.1|  396|Homo sapiens CDA12 protein.                40   0.008
AB038229-1|BAB20762.1|  396|Homo sapiens hARPX protein.                40   0.008
BC011997-1|AAH11997.1|  417|Homo sapiens actin-related protein 1...    39   0.018
BC005208-1|AAH05208.1|  339|Homo sapiens Unknown (protein for IM...    39   0.018
AK222702-1|BAD96422.1|  417|Homo sapiens uncharacterized hypotha...    39   0.018
AK222624-1|BAD96344.1|  417|Homo sapiens uncharacterized hypotha...    39   0.018
AK022534-1|BAB14083.1|  417|Homo sapiens protein ( Homo sapiens ...    39   0.018
AK000544-1|BAA91243.1|  417|Homo sapiens protein ( Homo sapiens ...    39   0.018
AF220190-1|AAF67655.1|  417|Homo sapiens uncharacterized hypotha...    39   0.018
BC020234-1|AAH20234.1|  195|Homo sapiens Unknown (protein for MG...    38   0.024
K00790-1|AAA51578.1|   17|Homo sapiens ACTB protein.                   34   0.39 
BC042553-1|AAH42553.1|  172|Homo sapiens Unknown (protein for IM...    33   0.90 
BC065199-1|AAH65199.1|  453|Homo sapiens family with sequence si...    32   2.1  
BC037572-1|AAH37572.1|  453|Homo sapiens family with sequence si...    32   2.1  
BC004223-1|AAH04223.2|   32|Homo sapiens ACTG1 protein protein.        32   2.1  
AF123073-1|AAK01477.1|  453|Homo sapiens C/EBP-induced protein p...    32   2.1  
BC113562-1|AAI13563.1|  416|Homo sapiens hepatocyte cell adhesio...    31   2.8  
BC104831-1|AAI04832.1|  416|Homo sapiens hepatocyte cell adhesio...    31   2.8  
AY047587-1|AAQ93018.1|  416|Homo sapiens hypothetical protein pr...    31   2.8  
AL834419-1|CAD39081.1|  165|Homo sapiens hypothetical protein pr...    31   2.8  
AK098396-1|BAC05297.1|  416|Homo sapiens protein ( Homo sapiens ...    31   2.8  
X67334-1|CAA47749.1|  892|Homo sapiens polypeptide BM28 protein.       31   3.6  
AK056190-1|BAB71117.1|  345|Homo sapiens protein ( Homo sapiens ...    30   8.4  

>X04098-1|CAA27723.1|  375|Homo sapiens gamma-actin protein.
          Length = 375

 Score =  186 bits (452), Expect = 8e-47
 Identities = 84/85 (98%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET
Sbjct: 67  LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 126

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FNTPAMYVAIQAVLSLYASGRTTG+
Sbjct: 127 FNTPAMYVAIQAVLSLYASGRTTGI 151



 Score =  138 bits (333), Expect = 2e-32
 Identities = 63/69 (91%), Positives = 66/69 (95%)
 Frame = +1

Query: 61  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 240
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 241 RGILTSNTP 267
           RGILT   P
Sbjct: 62  RGILTLKYP 70



 Score = 97.5 bits (232), Expect = 4e-20
 Identities = 44/46 (95%), Positives = 46/46 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           V+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG
Sbjct: 152 VMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 197


>X00351-1|CAA25099.1|  375|Homo sapiens protein ( Human mRNA for
           beta-actin. ).
          Length = 375

 Score =  186 bits (452), Expect = 8e-47
 Identities = 84/85 (98%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET
Sbjct: 67  LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 126

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FNTPAMYVAIQAVLSLYASGRTTG+
Sbjct: 127 FNTPAMYVAIQAVLSLYASGRTTGI 151



 Score =  137 bits (332), Expect = 3e-32
 Identities = 63/69 (91%), Positives = 66/69 (95%)
 Frame = +1

Query: 61  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 240
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 241 RGILTSNTP 267
           RGILT   P
Sbjct: 62  RGILTLKYP 70



 Score = 97.5 bits (232), Expect = 4e-20
 Identities = 44/46 (95%), Positives = 46/46 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           V+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG
Sbjct: 152 VMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 197


>M19283-1|AAA51579.1|  375|Homo sapiens ACTG1 protein.
          Length = 375

 Score =  186 bits (452), Expect = 8e-47
 Identities = 84/85 (98%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET
Sbjct: 67  LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 126

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FNTPAMYVAIQAVLSLYASGRTTG+
Sbjct: 127 FNTPAMYVAIQAVLSLYASGRTTGI 151



 Score =  138 bits (333), Expect = 2e-32
 Identities = 63/69 (91%), Positives = 66/69 (95%)
 Frame = +1

Query: 61  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 240
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 241 RGILTSNTP 267
           RGILT   P
Sbjct: 62  RGILTLKYP 70



 Score = 97.5 bits (232), Expect = 4e-20
 Identities = 44/46 (95%), Positives = 46/46 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           V+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG
Sbjct: 152 VMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 197


>M10277-1|AAA51567.1|  375|Homo sapiens protein ( Human cytoplasmic
           beta-actin gene, complete cds. ).
          Length = 375

 Score =  186 bits (452), Expect = 8e-47
 Identities = 84/85 (98%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET
Sbjct: 67  LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 126

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FNTPAMYVAIQAVLSLYASGRTTG+
Sbjct: 127 FNTPAMYVAIQAVLSLYASGRTTGI 151



 Score =  137 bits (332), Expect = 3e-32
 Identities = 63/69 (91%), Positives = 66/69 (95%)
 Frame = +1

Query: 61  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 240
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 241 RGILTSNTP 267
           RGILT   P
Sbjct: 62  RGILTLKYP 70



 Score = 97.5 bits (232), Expect = 4e-20
 Identities = 44/46 (95%), Positives = 46/46 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           V+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG
Sbjct: 152 VMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 197


>DQ471327-1|ABF01018.1|  375|Homo sapiens PS1TP5-binding protein 1
           protein.
          Length = 375

 Score =  186 bits (452), Expect = 8e-47
 Identities = 84/85 (98%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET
Sbjct: 67  LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 126

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FNTPAMYVAIQAVLSLYASGRTTG+
Sbjct: 127 FNTPAMYVAIQAVLSLYASGRTTGI 151



 Score =  137 bits (332), Expect = 3e-32
 Identities = 63/69 (91%), Positives = 66/69 (95%)
 Frame = +1

Query: 61  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 240
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 241 RGILTSNTP 267
           RGILT   P
Sbjct: 62  RGILTLKYP 70



 Score = 97.5 bits (232), Expect = 4e-20
 Identities = 44/46 (95%), Positives = 46/46 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           V+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG
Sbjct: 152 VMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 197


>BT019856-1|AAV38659.1|  375|Homo sapiens actin, gamma 1 protein.
          Length = 375

 Score =  186 bits (452), Expect = 8e-47
 Identities = 84/85 (98%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET
Sbjct: 67  LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 126

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FNTPAMYVAIQAVLSLYASGRTTG+
Sbjct: 127 FNTPAMYVAIQAVLSLYASGRTTGI 151



 Score =  138 bits (333), Expect = 2e-32
 Identities = 63/69 (91%), Positives = 66/69 (95%)
 Frame = +1

Query: 61  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 240
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 241 RGILTSNTP 267
           RGILT   P
Sbjct: 62  RGILTLKYP 70



 Score = 97.5 bits (232), Expect = 4e-20
 Identities = 44/46 (95%), Positives = 46/46 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           V+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG
Sbjct: 152 VMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 197


>BC053572-1|AAH53572.1|  375|Homo sapiens actin, gamma 1 protein.
          Length = 375

 Score =  186 bits (452), Expect = 8e-47
 Identities = 84/85 (98%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET
Sbjct: 67  LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 126

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FNTPAMYVAIQAVLSLYASGRTTG+
Sbjct: 127 FNTPAMYVAIQAVLSLYASGRTTGI 151



 Score =  138 bits (333), Expect = 2e-32
 Identities = 63/69 (91%), Positives = 66/69 (95%)
 Frame = +1

Query: 61  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 240
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 241 RGILTSNTP 267
           RGILT   P
Sbjct: 62  RGILTLKYP 70



 Score = 97.5 bits (232), Expect = 4e-20
 Identities = 44/46 (95%), Positives = 46/46 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           V+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG
Sbjct: 152 VMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 197


>BC018774-1|AAH18774.1|  375|Homo sapiens ACTG1 protein protein.
          Length = 375

 Score =  186 bits (452), Expect = 8e-47
 Identities = 84/85 (98%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET
Sbjct: 67  LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 126

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FNTPAMYVAIQAVLSLYASGRTTG+
Sbjct: 127 FNTPAMYVAIQAVLSLYASGRTTGI 151



 Score =  138 bits (333), Expect = 2e-32
 Identities = 63/69 (91%), Positives = 66/69 (95%)
 Frame = +1

Query: 61  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 240
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 241 RGILTSNTP 267
           RGILT   P
Sbjct: 62  RGILTLKYP 70



 Score = 97.5 bits (232), Expect = 4e-20
 Identities = 44/46 (95%), Positives = 46/46 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           V+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG
Sbjct: 152 VMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 197


>BC017450-1|AAH17450.1|  363|Homo sapiens Unknown (protein for
           IMAGE:3538275) protein.
          Length = 363

 Score =  186 bits (452), Expect = 8e-47
 Identities = 84/85 (98%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET
Sbjct: 55  LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 114

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FNTPAMYVAIQAVLSLYASGRTTG+
Sbjct: 115 FNTPAMYVAIQAVLSLYASGRTTGI 139



 Score =  107 bits (257), Expect = 3e-23
 Identities = 50/53 (94%), Positives = 50/53 (94%)
 Frame = +1

Query: 109 KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTSNTP 267
           KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILT   P
Sbjct: 6   KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYP 58



 Score = 97.5 bits (232), Expect = 4e-20
 Identities = 44/46 (95%), Positives = 46/46 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           V+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG
Sbjct: 140 VMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 185


>BC015779-1|AAH15779.1|  375|Homo sapiens ACTG1 protein protein.
          Length = 375

 Score =  186 bits (452), Expect = 8e-47
 Identities = 84/85 (98%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET
Sbjct: 67  LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 126

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FNTPAMYVAIQAVLSLYASGRTTG+
Sbjct: 127 FNTPAMYVAIQAVLSLYASGRTTGI 151



 Score =  138 bits (333), Expect = 2e-32
 Identities = 63/69 (91%), Positives = 66/69 (95%)
 Frame = +1

Query: 61  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 240
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 241 RGILTSNTP 267
           RGILT   P
Sbjct: 62  RGILTLKYP 70



 Score = 97.5 bits (232), Expect = 4e-20
 Identities = 44/46 (95%), Positives = 46/46 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           V+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG
Sbjct: 152 VMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 197


>BC015695-1|AAH15695.1|  375|Homo sapiens actin, gamma 1 protein.
          Length = 375

 Score =  186 bits (452), Expect = 8e-47
 Identities = 84/85 (98%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET
Sbjct: 67  LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 126

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FNTPAMYVAIQAVLSLYASGRTTG+
Sbjct: 127 FNTPAMYVAIQAVLSLYASGRTTGI 151



 Score =  138 bits (333), Expect = 2e-32
 Identities = 63/69 (91%), Positives = 66/69 (95%)
 Frame = +1

Query: 61  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 240
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 241 RGILTSNTP 267
           RGILT   P
Sbjct: 62  RGILTLKYP 70



 Score = 97.5 bits (232), Expect = 4e-20
 Identities = 44/46 (95%), Positives = 46/46 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           V+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG
Sbjct: 152 VMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 197


>BC015005-1|AAH15005.1|  375|Homo sapiens ACTG1 protein protein.
          Length = 375

 Score =  186 bits (452), Expect = 8e-47
 Identities = 84/85 (98%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET
Sbjct: 67  LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 126

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FNTPAMYVAIQAVLSLYASGRTTG+
Sbjct: 127 FNTPAMYVAIQAVLSLYASGRTTGI 151



 Score =  138 bits (333), Expect = 2e-32
 Identities = 63/69 (91%), Positives = 66/69 (95%)
 Frame = +1

Query: 61  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 240
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 241 RGILTSNTP 267
           RGILT   P
Sbjct: 62  RGILTLKYP 70



 Score = 97.5 bits (232), Expect = 4e-20
 Identities = 44/46 (95%), Positives = 46/46 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           V+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG
Sbjct: 152 VMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 197


>BC014861-1|AAH14861.1|  375|Homo sapiens actin, beta protein.
          Length = 375

 Score =  186 bits (452), Expect = 8e-47
 Identities = 84/85 (98%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET
Sbjct: 67  LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 126

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FNTPAMYVAIQAVLSLYASGRTTG+
Sbjct: 127 FNTPAMYVAIQAVLSLYASGRTTGI 151



 Score =  137 bits (332), Expect = 3e-32
 Identities = 63/69 (91%), Positives = 66/69 (95%)
 Frame = +1

Query: 61  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 240
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 241 RGILTSNTP 267
           RGILT   P
Sbjct: 62  RGILTLKYP 70



 Score = 97.5 bits (232), Expect = 4e-20
 Identities = 44/46 (95%), Positives = 46/46 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           V+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG
Sbjct: 152 VMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 197


>BC013380-1|AAH13380.1|  375|Homo sapiens actin, beta protein.
          Length = 375

 Score =  186 bits (452), Expect = 8e-47
 Identities = 84/85 (98%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET
Sbjct: 67  LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 126

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FNTPAMYVAIQAVLSLYASGRTTG+
Sbjct: 127 FNTPAMYVAIQAVLSLYASGRTTGI 151



 Score =  137 bits (332), Expect = 3e-32
 Identities = 63/69 (91%), Positives = 66/69 (95%)
 Frame = +1

Query: 61  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 240
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 241 RGILTSNTP 267
           RGILT   P
Sbjct: 62  RGILTLKYP 70



 Score = 97.5 bits (232), Expect = 4e-20
 Identities = 44/46 (95%), Positives = 46/46 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           V+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG
Sbjct: 152 VMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 197


>BC012050-1|AAH12050.1|  375|Homo sapiens actin, gamma 1 protein.
          Length = 375

 Score =  186 bits (452), Expect = 8e-47
 Identities = 84/85 (98%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET
Sbjct: 67  LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 126

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FNTPAMYVAIQAVLSLYASGRTTG+
Sbjct: 127 FNTPAMYVAIQAVLSLYASGRTTGI 151



 Score =  138 bits (333), Expect = 2e-32
 Identities = 63/69 (91%), Positives = 66/69 (95%)
 Frame = +1

Query: 61  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 240
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 241 RGILTSNTP 267
           RGILT   P
Sbjct: 62  RGILTLKYP 70



 Score = 97.5 bits (232), Expect = 4e-20
 Identities = 44/46 (95%), Positives = 46/46 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           V+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG
Sbjct: 152 VMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 197


>BC010999-1|AAH10999.1|  375|Homo sapiens actin, gamma 1 protein.
          Length = 375

 Score =  186 bits (452), Expect = 8e-47
 Identities = 84/85 (98%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET
Sbjct: 67  LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 126

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FNTPAMYVAIQAVLSLYASGRTTG+
Sbjct: 127 FNTPAMYVAIQAVLSLYASGRTTGI 151



 Score =  138 bits (333), Expect = 2e-32
 Identities = 63/69 (91%), Positives = 66/69 (95%)
 Frame = +1

Query: 61  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 240
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 241 RGILTSNTP 267
           RGILT   P
Sbjct: 62  RGILTLKYP 70



 Score = 97.5 bits (232), Expect = 4e-20
 Identities = 44/46 (95%), Positives = 46/46 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           V+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG
Sbjct: 152 VMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 197


>BC009848-1|AAH09848.1|  375|Homo sapiens actin, gamma 1 protein.
          Length = 375

 Score =  186 bits (452), Expect = 8e-47
 Identities = 84/85 (98%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET
Sbjct: 67  LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 126

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FNTPAMYVAIQAVLSLYASGRTTG+
Sbjct: 127 FNTPAMYVAIQAVLSLYASGRTTGI 151



 Score =  138 bits (333), Expect = 2e-32
 Identities = 63/69 (91%), Positives = 66/69 (95%)
 Frame = +1

Query: 61  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 240
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 241 RGILTSNTP 267
           RGILT   P
Sbjct: 62  RGILTLKYP 70



 Score = 97.5 bits (232), Expect = 4e-20
 Identities = 44/46 (95%), Positives = 46/46 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           V+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG
Sbjct: 152 VMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 197


>BC008633-1|AAH08633.1|  368|Homo sapiens actin, beta protein.
          Length = 368

 Score =  186 bits (452), Expect = 8e-47
 Identities = 84/85 (98%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET
Sbjct: 60  LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 119

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FNTPAMYVAIQAVLSLYASGRTTG+
Sbjct: 120 FNTPAMYVAIQAVLSLYASGRTTGI 144



 Score =  129 bits (311), Expect = 1e-29
 Identities = 60/63 (95%), Positives = 60/63 (95%)
 Frame = +1

Query: 79  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTS 258
           LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILT 
Sbjct: 1   LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTL 60

Query: 259 NTP 267
             P
Sbjct: 61  KYP 63



 Score = 97.5 bits (232), Expect = 4e-20
 Identities = 44/46 (95%), Positives = 46/46 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           V+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG
Sbjct: 145 VMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 190


>BC007442-1|AAH07442.1|  375|Homo sapiens actin, gamma 1 protein.
          Length = 375

 Score =  186 bits (452), Expect = 8e-47
 Identities = 84/85 (98%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET
Sbjct: 67  LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 126

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FNTPAMYVAIQAVLSLYASGRTTG+
Sbjct: 127 FNTPAMYVAIQAVLSLYASGRTTGI 151



 Score =  138 bits (333), Expect = 2e-32
 Identities = 63/69 (91%), Positives = 66/69 (95%)
 Frame = +1

Query: 61  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 240
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 241 RGILTSNTP 267
           RGILT   P
Sbjct: 62  RGILTLKYP 70



 Score = 97.5 bits (232), Expect = 4e-20
 Identities = 44/46 (95%), Positives = 46/46 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           V+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG
Sbjct: 152 VMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 197


>BC004251-1|AAH04251.1|  375|Homo sapiens actin, beta protein.
          Length = 375

 Score =  186 bits (452), Expect = 8e-47
 Identities = 84/85 (98%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET
Sbjct: 67  LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 126

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FNTPAMYVAIQAVLSLYASGRTTG+
Sbjct: 127 FNTPAMYVAIQAVLSLYASGRTTGI 151



 Score =  137 bits (332), Expect = 3e-32
 Identities = 63/69 (91%), Positives = 66/69 (95%)
 Frame = +1

Query: 61  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 240
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 241 RGILTSNTP 267
           RGILT   P
Sbjct: 62  RGILTLKYP 70



 Score = 97.5 bits (232), Expect = 4e-20
 Identities = 44/46 (95%), Positives = 46/46 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           V+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG
Sbjct: 152 VMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 197


>BC002409-1|AAH02409.1|  375|Homo sapiens actin, beta protein.
          Length = 375

 Score =  186 bits (452), Expect = 8e-47
 Identities = 84/85 (98%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET
Sbjct: 67  LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 126

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FNTPAMYVAIQAVLSLYASGRTTG+
Sbjct: 127 FNTPAMYVAIQAVLSLYASGRTTGI 151



 Score =  137 bits (332), Expect = 3e-32
 Identities = 63/69 (91%), Positives = 66/69 (95%)
 Frame = +1

Query: 61  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 240
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 241 RGILTSNTP 267
           RGILT   P
Sbjct: 62  RGILTLKYP 70



 Score = 97.5 bits (232), Expect = 4e-20
 Identities = 44/46 (95%), Positives = 46/46 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           V+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG
Sbjct: 152 VMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 197


>BC001920-1|AAH01920.1|  375|Homo sapiens ACTG1 protein protein.
          Length = 375

 Score =  186 bits (452), Expect = 8e-47
 Identities = 84/85 (98%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET
Sbjct: 67  LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 126

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FNTPAMYVAIQAVLSLYASGRTTG+
Sbjct: 127 FNTPAMYVAIQAVLSLYASGRTTGI 151



 Score =  138 bits (333), Expect = 2e-32
 Identities = 63/69 (91%), Positives = 66/69 (95%)
 Frame = +1

Query: 61  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 240
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 241 RGILTSNTP 267
           RGILT   P
Sbjct: 62  RGILTLKYP 70



 Score = 97.5 bits (232), Expect = 4e-20
 Identities = 44/46 (95%), Positives = 46/46 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           V+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG
Sbjct: 152 VMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 197


>BC001301-1|AAH01301.1|  375|Homo sapiens actin, beta protein.
          Length = 375

 Score =  186 bits (452), Expect = 8e-47
 Identities = 84/85 (98%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET
Sbjct: 67  LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 126

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FNTPAMYVAIQAVLSLYASGRTTG+
Sbjct: 127 FNTPAMYVAIQAVLSLYASGRTTGI 151



 Score =  137 bits (332), Expect = 3e-32
 Identities = 63/69 (91%), Positives = 66/69 (95%)
 Frame = +1

Query: 61  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 240
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 241 RGILTSNTP 267
           RGILT   P
Sbjct: 62  RGILTLKYP 70



 Score = 97.5 bits (232), Expect = 4e-20
 Identities = 44/46 (95%), Positives = 46/46 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           V+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG
Sbjct: 152 VMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 197


>BC000292-1|AAH00292.1|  375|Homo sapiens actin, gamma 1 protein.
          Length = 375

 Score =  186 bits (452), Expect = 8e-47
 Identities = 84/85 (98%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET
Sbjct: 67  LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 126

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FNTPAMYVAIQAVLSLYASGRTTG+
Sbjct: 127 FNTPAMYVAIQAVLSLYASGRTTGI 151



 Score =  138 bits (333), Expect = 2e-32
 Identities = 63/69 (91%), Positives = 66/69 (95%)
 Frame = +1

Query: 61  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 240
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 241 RGILTSNTP 267
           RGILT   P
Sbjct: 62  RGILTLKYP 70



 Score = 97.5 bits (232), Expect = 4e-20
 Identities = 44/46 (95%), Positives = 46/46 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           V+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG
Sbjct: 152 VMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 197


>AY582799-1|AAS79319.1|  375|Homo sapiens actin, beta protein.
          Length = 375

 Score =  186 bits (452), Expect = 8e-47
 Identities = 84/85 (98%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET
Sbjct: 67  LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 126

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FNTPAMYVAIQAVLSLYASGRTTG+
Sbjct: 127 FNTPAMYVAIQAVLSLYASGRTTGI 151



 Score =  137 bits (332), Expect = 3e-32
 Identities = 63/69 (91%), Positives = 66/69 (95%)
 Frame = +1

Query: 61  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 240
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 241 RGILTSNTP 267
           RGILT   P
Sbjct: 62  RGILTLKYP 70



 Score = 97.5 bits (232), Expect = 4e-20
 Identities = 44/46 (95%), Positives = 46/46 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           V+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG
Sbjct: 152 VMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 197


>AK223055-1|BAD96775.1|  375|Homo sapiens beta actin variant
           protein.
          Length = 375

 Score =  186 bits (452), Expect = 8e-47
 Identities = 84/85 (98%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET
Sbjct: 67  LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 126

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FNTPAMYVAIQAVLSLYASGRTTG+
Sbjct: 127 FNTPAMYVAIQAVLSLYASGRTTGI 151



 Score =  137 bits (332), Expect = 3e-32
 Identities = 63/69 (91%), Positives = 66/69 (95%)
 Frame = +1

Query: 61  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 240
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 241 RGILTSNTP 267
           RGILT   P
Sbjct: 62  RGILTLKYP 70



 Score = 97.5 bits (232), Expect = 4e-20
 Identities = 44/46 (95%), Positives = 46/46 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           V+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG
Sbjct: 152 VMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 197


>AK223032-1|BAD96752.1|  375|Homo sapiens beta actin variant
           protein.
          Length = 375

 Score =  186 bits (452), Expect = 8e-47
 Identities = 84/85 (98%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET
Sbjct: 67  LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 126

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FNTPAMYVAIQAVLSLYASGRTTG+
Sbjct: 127 FNTPAMYVAIQAVLSLYASGRTTGI 151



 Score =  137 bits (332), Expect = 3e-32
 Identities = 63/69 (91%), Positives = 66/69 (95%)
 Frame = +1

Query: 61  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 240
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 241 RGILTSNTP 267
           RGILT   P
Sbjct: 62  RGILTLKYP 70



 Score = 97.5 bits (232), Expect = 4e-20
 Identities = 44/46 (95%), Positives = 46/46 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           V+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG
Sbjct: 152 VMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 197


>AK222925-1|BAD96645.1|  375|Homo sapiens beta actin variant
           protein.
          Length = 375

 Score =  186 bits (452), Expect = 8e-47
 Identities = 84/85 (98%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET
Sbjct: 67  LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 126

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FNTPAMYVAIQAVLSLYASGRTTG+
Sbjct: 127 FNTPAMYVAIQAVLSLYASGRTTGI 151



 Score =  137 bits (332), Expect = 3e-32
 Identities = 63/69 (91%), Positives = 66/69 (95%)
 Frame = +1

Query: 61  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 240
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 241 RGILTSNTP 267
           RGILT   P
Sbjct: 62  RGILTLKYP 70



 Score = 97.5 bits (232), Expect = 4e-20
 Identities = 44/46 (95%), Positives = 46/46 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           V+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG
Sbjct: 152 VMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 197


>AC006483-1|AAP22343.1|  375|Homo sapiens unknown protein.
          Length = 375

 Score =  186 bits (452), Expect = 8e-47
 Identities = 84/85 (98%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET
Sbjct: 67  LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 126

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FNTPAMYVAIQAVLSLYASGRTTG+
Sbjct: 127 FNTPAMYVAIQAVLSLYASGRTTGI 151



 Score =  137 bits (332), Expect = 3e-32
 Identities = 63/69 (91%), Positives = 66/69 (95%)
 Frame = +1

Query: 61  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 240
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 241 RGILTSNTP 267
           RGILT   P
Sbjct: 62  RGILTLKYP 70



 Score = 97.5 bits (232), Expect = 4e-20
 Identities = 44/46 (95%), Positives = 46/46 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           V+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG
Sbjct: 152 VMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 197


>X63432-1|CAA45026.1|  375|Homo sapiens mutant beta-actin
           (beta'-actin) protein.
          Length = 375

 Score =  184 bits (449), Expect = 2e-46
 Identities = 83/85 (97%), Positives = 85/85 (100%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET
Sbjct: 67  LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 126

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FNTPAMYVAIQA+LSLYASGRTTG+
Sbjct: 127 FNTPAMYVAIQAMLSLYASGRTTGI 151



 Score =  137 bits (332), Expect = 3e-32
 Identities = 63/69 (91%), Positives = 66/69 (95%)
 Frame = +1

Query: 61  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 240
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 241 RGILTSNTP 267
           RGILT   P
Sbjct: 62  RGILTLKYP 70



 Score = 97.5 bits (232), Expect = 4e-20
 Identities = 44/46 (95%), Positives = 46/46 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           V+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG
Sbjct: 152 VMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 197


>BC016045-1|AAH16045.1|  375|Homo sapiens actin, beta protein.
          Length = 375

 Score =  184 bits (447), Expect = 3e-46
 Identities = 83/85 (97%), Positives = 84/85 (98%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGIVTNWDDMEKIWHHTFYNELRV PEEHPVLLTEAPLNPKANREKMTQIMFET
Sbjct: 67  LKYPIEHGIVTNWDDMEKIWHHTFYNELRVPPEEHPVLLTEAPLNPKANREKMTQIMFET 126

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FNTPAMYVAIQAVLSLYASGRTTG+
Sbjct: 127 FNTPAMYVAIQAVLSLYASGRTTGI 151



 Score =  137 bits (332), Expect = 3e-32
 Identities = 63/69 (91%), Positives = 66/69 (95%)
 Frame = +1

Query: 61  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 240
           D+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   DDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 241 RGILTSNTP 267
           RGILT   P
Sbjct: 62  RGILTLKYP 70



 Score = 97.5 bits (232), Expect = 4e-20
 Identities = 44/46 (95%), Positives = 46/46 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           V+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG
Sbjct: 152 VMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 197


>BC012854-1|AAH12854.1|  360|Homo sapiens ACTB protein protein.
          Length = 360

 Score =  183 bits (445), Expect = 6e-46
 Identities = 83/85 (97%), Positives = 84/85 (98%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKAN EKMTQIMFET
Sbjct: 52  LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANLEKMTQIMFET 111

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FNTPAMYVAIQAVLSLYASGRTTG+
Sbjct: 112 FNTPAMYVAIQAVLSLYASGRTTGI 136



 Score =  113 bits (271), Expect = 7e-25
 Identities = 52/55 (94%), Positives = 52/55 (94%)
 Frame = +1

Query: 103 MCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTSNTP 267
           MCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILT   P
Sbjct: 1   MCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYP 55



 Score = 97.5 bits (232), Expect = 4e-20
 Identities = 44/46 (95%), Positives = 46/46 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           V+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG
Sbjct: 137 VMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 182


>M20543-1|AAA60296.1|  377|Homo sapiens ACTA1 protein.
          Length = 377

 Score =  182 bits (442), Expect = 1e-45
 Identities = 81/85 (95%), Positives = 83/85 (97%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHP LLTEAPLNPKANREKMTQIMFET
Sbjct: 69  LKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFET 128

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FN PAMYVAIQAVLSLYASGRTTG+
Sbjct: 129 FNVPAMYVAIQAVLSLYASGRTTGI 153



 Score =  131 bits (316), Expect = 2e-30
 Identities = 63/72 (87%), Positives = 64/72 (88%), Gaps = 1/72 (1%)
 Frame = +1

Query: 55  MCDE-EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 231
           MCDE E  ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
Sbjct: 1   MCDEDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 232 QSKRGILTSNTP 267
           QSKRGILT   P
Sbjct: 61  QSKRGILTLKYP 72



 Score = 95.5 bits (227), Expect = 1e-19
 Identities = 43/46 (93%), Positives = 45/46 (97%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGV+H VPIYEGYALPHAI+RLDLAGRDLTDYLMKILTERG
Sbjct: 154 VLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERG 199


>J00073-1|AAB59619.1|  377|Homo sapiens alpha-cardiac actin protein.
          Length = 377

 Score =  182 bits (442), Expect = 1e-45
 Identities = 81/85 (95%), Positives = 83/85 (97%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHP LLTEAPLNPKANREKMTQIMFET
Sbjct: 69  LKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFET 128

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FN PAMYVAIQAVLSLYASGRTTG+
Sbjct: 129 FNVPAMYVAIQAVLSLYASGRTTGI 153



 Score =  131 bits (316), Expect = 2e-30
 Identities = 63/72 (87%), Positives = 64/72 (88%), Gaps = 1/72 (1%)
 Frame = +1

Query: 55  MCD-EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 231
           MCD EE  ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
Sbjct: 1   MCDDEETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 232 QSKRGILTSNTP 267
           QSKRGILT   P
Sbjct: 61  QSKRGILTLKYP 72



 Score = 95.5 bits (227), Expect = 1e-19
 Identities = 43/46 (93%), Positives = 45/46 (97%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGV+H VPIYEGYALPHAI+RLDLAGRDLTDYLMKILTERG
Sbjct: 154 VLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERG 199


>J00068-1|AAB59376.1|  377|Homo sapiens ACTA1 protein.
          Length = 377

 Score =  182 bits (442), Expect = 1e-45
 Identities = 81/85 (95%), Positives = 83/85 (97%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHP LLTEAPLNPKANREKMTQIMFET
Sbjct: 69  LKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFET 128

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FN PAMYVAIQAVLSLYASGRTTG+
Sbjct: 129 FNVPAMYVAIQAVLSLYASGRTTGI 153



 Score =  131 bits (316), Expect = 2e-30
 Identities = 63/72 (87%), Positives = 64/72 (88%), Gaps = 1/72 (1%)
 Frame = +1

Query: 55  MCDE-EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 231
           MCDE E  ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
Sbjct: 1   MCDEDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 232 QSKRGILTSNTP 267
           QSKRGILT   P
Sbjct: 61  QSKRGILTLKYP 72



 Score = 95.5 bits (227), Expect = 1e-19
 Identities = 43/46 (93%), Positives = 45/46 (97%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGV+H VPIYEGYALPHAI+RLDLAGRDLTDYLMKILTERG
Sbjct: 154 VLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERG 199


>CR541796-1|CAG46595.1|  377|Homo sapiens ACTA1 protein.
          Length = 377

 Score =  182 bits (442), Expect = 1e-45
 Identities = 81/85 (95%), Positives = 83/85 (97%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHP LLTEAPLNPKANREKMTQIMFET
Sbjct: 69  LKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFET 128

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FN PAMYVAIQAVLSLYASGRTTG+
Sbjct: 129 FNVPAMYVAIQAVLSLYASGRTTGI 153



 Score =  131 bits (316), Expect = 2e-30
 Identities = 63/72 (87%), Positives = 64/72 (88%), Gaps = 1/72 (1%)
 Frame = +1

Query: 55  MCDE-EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 231
           MCDE E  ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
Sbjct: 1   MCDEDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 232 QSKRGILTSNTP 267
           QSKRGILT   P
Sbjct: 61  QSKRGILTLKYP 72



 Score = 95.5 bits (227), Expect = 1e-19
 Identities = 43/46 (93%), Positives = 45/46 (97%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGV+H VPIYEGYALPHAI+RLDLAGRDLTDYLMKILTERG
Sbjct: 154 VLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERG 199


>CR541795-1|CAG46594.1|  377|Homo sapiens ACTC protein.
          Length = 377

 Score =  182 bits (442), Expect = 1e-45
 Identities = 81/85 (95%), Positives = 83/85 (97%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHP LLTEAPLNPKANREKMTQIMFET
Sbjct: 69  LKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFET 128

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FN PAMYVAIQAVLSLYASGRTTG+
Sbjct: 129 FNVPAMYVAIQAVLSLYASGRTTGI 153



 Score =  131 bits (316), Expect = 2e-30
 Identities = 63/72 (87%), Positives = 64/72 (88%), Gaps = 1/72 (1%)
 Frame = +1

Query: 55  MCD-EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 231
           MCD EE  ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
Sbjct: 1   MCDDEETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 232 QSKRGILTSNTP 267
           QSKRGILT   P
Sbjct: 61  QSKRGILTLKYP 72



 Score = 95.5 bits (227), Expect = 1e-19
 Identities = 43/46 (93%), Positives = 45/46 (97%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGV+H VPIYEGYALPHAI+RLDLAGRDLTDYLMKILTERG
Sbjct: 154 VLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERG 199


>CR536516-1|CAG38754.1|  377|Homo sapiens ACTA1 protein.
          Length = 377

 Score =  182 bits (442), Expect = 1e-45
 Identities = 81/85 (95%), Positives = 83/85 (97%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHP LLTEAPLNPKANREKMTQIMFET
Sbjct: 69  LKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFET 128

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FN PAMYVAIQAVLSLYASGRTTG+
Sbjct: 129 FNVPAMYVAIQAVLSLYASGRTTGI 153



 Score =  131 bits (316), Expect = 2e-30
 Identities = 63/72 (87%), Positives = 64/72 (88%), Gaps = 1/72 (1%)
 Frame = +1

Query: 55  MCDE-EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 231
           MCDE E  ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
Sbjct: 1   MCDEDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 232 QSKRGILTSNTP 267
           QSKRGILT   P
Sbjct: 61  QSKRGILTLKYP 72



 Score = 95.5 bits (227), Expect = 1e-19
 Identities = 43/46 (93%), Positives = 45/46 (97%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGV+H VPIYEGYALPHAI+RLDLAGRDLTDYLMKILTERG
Sbjct: 154 VLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERG 199


>BC012597-1|AAH12597.1|  377|Homo sapiens actin, alpha 1, skeletal
           muscle protein.
          Length = 377

 Score =  182 bits (442), Expect = 1e-45
 Identities = 81/85 (95%), Positives = 83/85 (97%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHP LLTEAPLNPKANREKMTQIMFET
Sbjct: 69  LKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFET 128

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FN PAMYVAIQAVLSLYASGRTTG+
Sbjct: 129 FNVPAMYVAIQAVLSLYASGRTTGI 153



 Score =  131 bits (316), Expect = 2e-30
 Identities = 63/72 (87%), Positives = 64/72 (88%), Gaps = 1/72 (1%)
 Frame = +1

Query: 55  MCDE-EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 231
           MCDE E  ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
Sbjct: 1   MCDEDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 232 QSKRGILTSNTP 267
           QSKRGILT   P
Sbjct: 61  QSKRGILTLKYP 72



 Score = 95.5 bits (227), Expect = 1e-19
 Identities = 43/46 (93%), Positives = 45/46 (97%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGV+H VPIYEGYALPHAI+RLDLAGRDLTDYLMKILTERG
Sbjct: 154 VLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERG 199


>BC009978-1|AAH09978.1|  377|Homo sapiens actin, alpha, cardiac
           muscle 1 protein.
          Length = 377

 Score =  182 bits (442), Expect = 1e-45
 Identities = 81/85 (95%), Positives = 83/85 (97%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHP LLTEAPLNPKANREKMTQIMFET
Sbjct: 69  LKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFET 128

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FN PAMYVAIQAVLSLYASGRTTG+
Sbjct: 129 FNVPAMYVAIQAVLSLYASGRTTGI 153



 Score =  131 bits (316), Expect = 2e-30
 Identities = 63/72 (87%), Positives = 64/72 (88%), Gaps = 1/72 (1%)
 Frame = +1

Query: 55  MCD-EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 231
           MCD EE  ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
Sbjct: 1   MCDDEETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 232 QSKRGILTSNTP 267
           QSKRGILT   P
Sbjct: 61  QSKRGILTLKYP 72



 Score = 95.5 bits (227), Expect = 1e-19
 Identities = 43/46 (93%), Positives = 45/46 (97%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGV+H VPIYEGYALPHAI+RLDLAGRDLTDYLMKILTERG
Sbjct: 154 VLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERG 199


>AY280960-1|AAP37280.1|  254|Homo sapiens actin alpha 1 skeletal
           muscle protein protein.
          Length = 254

 Score =  182 bits (442), Expect = 1e-45
 Identities = 81/85 (95%), Positives = 83/85 (97%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHP LLTEAPLNPKANREKMTQIMFET
Sbjct: 69  LKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFET 128

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FN PAMYVAIQAVLSLYASGRTTG+
Sbjct: 129 FNVPAMYVAIQAVLSLYASGRTTGI 153



 Score =  131 bits (316), Expect = 2e-30
 Identities = 63/72 (87%), Positives = 64/72 (88%), Gaps = 1/72 (1%)
 Frame = +1

Query: 55  MCDE-EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 231
           MCDE E  ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
Sbjct: 1   MCDEDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 232 QSKRGILTSNTP 267
           QSKRGILT   P
Sbjct: 61  QSKRGILTLKYP 72


>AL160004-6|CAI19050.1|  377|Homo sapiens actin, alpha 1, skeletal
           muscle protein.
          Length = 377

 Score =  182 bits (442), Expect = 1e-45
 Identities = 81/85 (95%), Positives = 83/85 (97%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHP LLTEAPLNPKANREKMTQIMFET
Sbjct: 69  LKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFET 128

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FN PAMYVAIQAVLSLYASGRTTG+
Sbjct: 129 FNVPAMYVAIQAVLSLYASGRTTGI 153



 Score =  131 bits (316), Expect = 2e-30
 Identities = 63/72 (87%), Positives = 64/72 (88%), Gaps = 1/72 (1%)
 Frame = +1

Query: 55  MCDE-EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 231
           MCDE E  ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
Sbjct: 1   MCDEDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 232 QSKRGILTSNTP 267
           QSKRGILT   P
Sbjct: 61  QSKRGILTLKYP 72



 Score = 95.5 bits (227), Expect = 1e-19
 Identities = 43/46 (93%), Positives = 45/46 (97%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGV+H VPIYEGYALPHAI+RLDLAGRDLTDYLMKILTERG
Sbjct: 154 VLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERG 199


>AF182035-1|AAF02694.1|  377|Homo sapiens skeletal muscle
           alpha-actin precursor protein.
          Length = 377

 Score =  182 bits (442), Expect = 1e-45
 Identities = 81/85 (95%), Positives = 83/85 (97%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHP LLTEAPLNPKANREKMTQIMFET
Sbjct: 69  LKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFET 128

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FN PAMYVAIQAVLSLYASGRTTG+
Sbjct: 129 FNVPAMYVAIQAVLSLYASGRTTGI 153



 Score =  131 bits (316), Expect = 2e-30
 Identities = 63/72 (87%), Positives = 64/72 (88%), Gaps = 1/72 (1%)
 Frame = +1

Query: 55  MCDE-EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 231
           MCDE E  ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
Sbjct: 1   MCDEDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 232 QSKRGILTSNTP 267
           QSKRGILT   P
Sbjct: 61  QSKRGILTLKYP 72



 Score = 95.5 bits (227), Expect = 1e-19
 Identities = 43/46 (93%), Positives = 45/46 (97%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGV+H VPIYEGYALPHAI+RLDLAGRDLTDYLMKILTERG
Sbjct: 154 VLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERG 199


>X16940-1|CAA34814.1|  376|Homo sapiens protein ( Human mRNA for
           enteric smooth muscle gamma-actin. ).
          Length = 376

 Score =  180 bits (438), Expect = 4e-45
 Identities = 80/85 (94%), Positives = 83/85 (97%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEAPLNPKANREKMTQIMFET
Sbjct: 68  LKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFET 127

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FN PAMYVAIQAVLSLYASGRTTG+
Sbjct: 128 FNVPAMYVAIQAVLSLYASGRTTGI 152



 Score =  138 bits (333), Expect = 2e-32
 Identities = 63/71 (88%), Positives = 65/71 (91%)
 Frame = +1

Query: 55  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 234
           MC+EE  ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCEEETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 235 SKRGILTSNTP 267
           SKRGILT   P
Sbjct: 61  SKRGILTLKYP 71



 Score = 95.5 bits (227), Expect = 1e-19
 Identities = 43/46 (93%), Positives = 45/46 (97%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGV+H VPIYEGYALPHAI+RLDLAGRDLTDYLMKILTERG
Sbjct: 153 VLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERG 198


>X13839-1|CAA32064.1|  377|Homo sapiens protein ( Human mRNA for
           vascular smooth muscle alpha-actin. ).
          Length = 377

 Score =  180 bits (438), Expect = 4e-45
 Identities = 80/85 (94%), Positives = 83/85 (97%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEAPLNPKANREKMTQIMFET
Sbjct: 69  LKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFET 128

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FN PAMYVAIQAVLSLYASGRTTG+
Sbjct: 129 FNVPAMYVAIQAVLSLYASGRTTGI 153



 Score =  132 bits (320), Expect = 8e-31
 Identities = 63/72 (87%), Positives = 66/72 (91%), Gaps = 1/72 (1%)
 Frame = +1

Query: 55  MCDEEVA-ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 231
           MC+EE + ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
Sbjct: 1   MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 232 QSKRGILTSNTP 267
           QSKRGILT   P
Sbjct: 61  QSKRGILTLKYP 72



 Score = 95.5 bits (227), Expect = 1e-19
 Identities = 43/46 (93%), Positives = 45/46 (97%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGV+H VPIYEGYALPHAI+RLDLAGRDLTDYLMKILTERG
Sbjct: 154 VLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERG 199


>K01747-1|AAA51586.1|  330|Homo sapiens ACTA2 protein.
          Length = 330

 Score =  180 bits (438), Expect = 4e-45
 Identities = 80/85 (94%), Positives = 83/85 (97%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEAPLNPKANREKMTQIMFET
Sbjct: 69  LKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFET 128

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FN PAMYVAIQAVLSLYASGRTTG+
Sbjct: 129 FNVPAMYVAIQAVLSLYASGRTTGI 153



 Score =  130 bits (313), Expect = 6e-30
 Identities = 62/72 (86%), Positives = 65/72 (90%), Gaps = 1/72 (1%)
 Frame = +1

Query: 55  MCDEEVA-ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 231
           MC+EE + ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVG EA
Sbjct: 1   MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGHEA 60

Query: 232 QSKRGILTSNTP 267
           QSKRGILT   P
Sbjct: 61  QSKRGILTLKYP 72



 Score = 95.5 bits (227), Expect = 1e-19
 Identities = 43/46 (93%), Positives = 45/46 (97%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGV+H VPIYEGYALPHAI+RLDLAGRDLTDYLMKILTERG
Sbjct: 154 VLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERG 199


>J05192-1|AAA51577.1|  377|Homo sapiens ACTA3 protein.
          Length = 377

 Score =  180 bits (438), Expect = 4e-45
 Identities = 80/85 (94%), Positives = 83/85 (97%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEAPLNPKANREKMTQIMFET
Sbjct: 69  LKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFET 128

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FN PAMYVAIQAVLSLYASGRTTG+
Sbjct: 129 FNVPAMYVAIQAVLSLYASGRTTGI 153



 Score =  132 bits (320), Expect = 8e-31
 Identities = 63/72 (87%), Positives = 66/72 (91%), Gaps = 1/72 (1%)
 Frame = +1

Query: 55  MCDEEVA-ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 231
           MC+EE + ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
Sbjct: 1   MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 232 QSKRGILTSNTP 267
           QSKRGILT   P
Sbjct: 61  QSKRGILTLKYP 72



 Score = 95.5 bits (227), Expect = 1e-19
 Identities = 43/46 (93%), Positives = 45/46 (97%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGV+H VPIYEGYALPHAI+RLDLAGRDLTDYLMKILTERG
Sbjct: 154 VLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERG 199


>D00654-1|BAA00546.1|  376|Homo sapiens enteric smooth muscle
           gamma-actin protein.
          Length = 376

 Score =  180 bits (438), Expect = 4e-45
 Identities = 80/85 (94%), Positives = 83/85 (97%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEAPLNPKANREKMTQIMFET
Sbjct: 68  LKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFET 127

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FN PAMYVAIQAVLSLYASGRTTG+
Sbjct: 128 FNVPAMYVAIQAVLSLYASGRTTGI 152



 Score =  138 bits (333), Expect = 2e-32
 Identities = 63/71 (88%), Positives = 65/71 (91%)
 Frame = +1

Query: 55  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 234
           MC+EE  ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCEEETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 235 SKRGILTSNTP 267
           SKRGILT   P
Sbjct: 61  SKRGILTLKYP 71



 Score = 95.5 bits (227), Expect = 1e-19
 Identities = 43/46 (93%), Positives = 45/46 (97%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGV+H VPIYEGYALPHAI+RLDLAGRDLTDYLMKILTERG
Sbjct: 153 VLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERG 198


>CR541794-1|CAG46593.1|  376|Homo sapiens ACTG2 protein.
          Length = 376

 Score =  180 bits (438), Expect = 4e-45
 Identities = 80/85 (94%), Positives = 83/85 (97%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEAPLNPKANREKMTQIMFET
Sbjct: 68  LKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFET 127

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FN PAMYVAIQAVLSLYASGRTTG+
Sbjct: 128 FNVPAMYVAIQAVLSLYASGRTTGI 152



 Score =  138 bits (333), Expect = 2e-32
 Identities = 63/71 (88%), Positives = 65/71 (91%)
 Frame = +1

Query: 55  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 234
           MC+EE  ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCEEETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 235 SKRGILTSNTP 267
           SKRGILT   P
Sbjct: 61  SKRGILTLKYP 71



 Score = 95.5 bits (227), Expect = 1e-19
 Identities = 43/46 (93%), Positives = 45/46 (97%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGV+H VPIYEGYALPHAI+RLDLAGRDLTDYLMKILTERG
Sbjct: 153 VLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERG 198


>CR536518-1|CAG38756.1|  377|Homo sapiens ACTA2 protein.
          Length = 377

 Score =  180 bits (438), Expect = 4e-45
 Identities = 80/85 (94%), Positives = 83/85 (97%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEAPLNPKANREKMTQIMFET
Sbjct: 69  LKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFET 128

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FN PAMYVAIQAVLSLYASGRTTG+
Sbjct: 129 FNVPAMYVAIQAVLSLYASGRTTGI 153



 Score =  132 bits (320), Expect = 8e-31
 Identities = 63/72 (87%), Positives = 66/72 (91%), Gaps = 1/72 (1%)
 Frame = +1

Query: 55  MCDEEVA-ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 231
           MC+EE + ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
Sbjct: 1   MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 232 QSKRGILTSNTP 267
           QSKRGILT   P
Sbjct: 61  QSKRGILTLKYP 72



 Score = 95.5 bits (227), Expect = 1e-19
 Identities = 43/46 (93%), Positives = 45/46 (97%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGV+H VPIYEGYALPHAI+RLDLAGRDLTDYLMKILTERG
Sbjct: 154 VLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERG 199


>BC094877-1|AAH94877.1|  376|Homo sapiens ACTG2 protein protein.
          Length = 376

 Score =  180 bits (438), Expect = 4e-45
 Identities = 80/85 (94%), Positives = 83/85 (97%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEAPLNPKANREKMTQIMFET
Sbjct: 68  LKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFET 127

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FN PAMYVAIQAVLSLYASGRTTG+
Sbjct: 128 FNVPAMYVAIQAVLSLYASGRTTGI 152



 Score =  138 bits (333), Expect = 2e-32
 Identities = 63/71 (88%), Positives = 65/71 (91%)
 Frame = +1

Query: 55  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 234
           MC+EE  ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCEEETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 235 SKRGILTSNTP 267
           SKRGILT   P
Sbjct: 61  SKRGILTLKYP 71



 Score = 95.5 bits (227), Expect = 1e-19
 Identities = 43/46 (93%), Positives = 45/46 (97%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGV+H VPIYEGYALPHAI+RLDLAGRDLTDYLMKILTERG
Sbjct: 153 VLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERG 198


>BC093052-1|AAH93052.1|  377|Homo sapiens actin, alpha 2, smooth
           muscle, aorta protein.
          Length = 377

 Score =  180 bits (438), Expect = 4e-45
 Identities = 80/85 (94%), Positives = 83/85 (97%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEAPLNPKANREKMTQIMFET
Sbjct: 69  LKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFET 128

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FN PAMYVAIQAVLSLYASGRTTG+
Sbjct: 129 FNVPAMYVAIQAVLSLYASGRTTGI 153



 Score =  132 bits (320), Expect = 8e-31
 Identities = 63/72 (87%), Positives = 66/72 (91%), Gaps = 1/72 (1%)
 Frame = +1

Query: 55  MCDEEVA-ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 231
           MC+EE + ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
Sbjct: 1   MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 232 QSKRGILTSNTP 267
           QSKRGILT   P
Sbjct: 61  QSKRGILTLKYP 72



 Score = 95.5 bits (227), Expect = 1e-19
 Identities = 43/46 (93%), Positives = 45/46 (97%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGV+H VPIYEGYALPHAI+RLDLAGRDLTDYLMKILTERG
Sbjct: 154 VLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERG 199


>BC017554-1|AAH17554.1|  377|Homo sapiens actin, alpha 2, smooth
           muscle, aorta protein.
          Length = 377

 Score =  180 bits (438), Expect = 4e-45
 Identities = 80/85 (94%), Positives = 83/85 (97%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEAPLNPKANREKMTQIMFET
Sbjct: 69  LKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFET 128

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FN PAMYVAIQAVLSLYASGRTTG+
Sbjct: 129 FNVPAMYVAIQAVLSLYASGRTTGI 153



 Score =  132 bits (320), Expect = 8e-31
 Identities = 63/72 (87%), Positives = 66/72 (91%), Gaps = 1/72 (1%)
 Frame = +1

Query: 55  MCDEEVA-ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 231
           MC+EE + ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
Sbjct: 1   MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 232 QSKRGILTSNTP 267
           QSKRGILT   P
Sbjct: 61  QSKRGILTLKYP 72



 Score = 95.5 bits (227), Expect = 1e-19
 Identities = 43/46 (93%), Positives = 45/46 (97%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGV+H VPIYEGYALPHAI+RLDLAGRDLTDYLMKILTERG
Sbjct: 154 VLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERG 199


>BC012617-1|AAH12617.1|  376|Homo sapiens actin, gamma 2, smooth
           muscle, enteric protein.
          Length = 376

 Score =  180 bits (438), Expect = 4e-45
 Identities = 80/85 (94%), Positives = 83/85 (97%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEAPLNPKANREKMTQIMFET
Sbjct: 68  LKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFET 127

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FN PAMYVAIQAVLSLYASGRTTG+
Sbjct: 128 FNVPAMYVAIQAVLSLYASGRTTGI 152



 Score =  138 bits (333), Expect = 2e-32
 Identities = 63/71 (88%), Positives = 65/71 (91%)
 Frame = +1

Query: 55  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 234
           MC+EE  ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCEEETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 235 SKRGILTSNTP 267
           SKRGILT   P
Sbjct: 61  SKRGILTLKYP 71



 Score = 95.5 bits (227), Expect = 1e-19
 Identities = 43/46 (93%), Positives = 45/46 (97%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGV+H VPIYEGYALPHAI+RLDLAGRDLTDYLMKILTERG
Sbjct: 153 VLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERG 198


>AY692464-1|AAW29811.1|  377|Homo sapiens growth-inhibiting gene 46
           protein.
          Length = 377

 Score =  180 bits (438), Expect = 4e-45
 Identities = 80/85 (94%), Positives = 83/85 (97%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEAPLNPKANREKMTQIMFET
Sbjct: 69  LKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFET 128

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FN PAMYVAIQAVLSLYASGRTTG+
Sbjct: 129 FNVPAMYVAIQAVLSLYASGRTTGI 153



 Score =  132 bits (320), Expect = 8e-31
 Identities = 63/72 (87%), Positives = 66/72 (91%), Gaps = 1/72 (1%)
 Frame = +1

Query: 55  MCDEEVA-ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 231
           MC+EE + ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
Sbjct: 1   MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 232 QSKRGILTSNTP 267
           QSKRGILT   P
Sbjct: 61  QSKRGILTLKYP 72



 Score = 95.5 bits (227), Expect = 1e-19
 Identities = 43/46 (93%), Positives = 45/46 (97%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGV+H VPIYEGYALPHAI+RLDLAGRDLTDYLMKILTERG
Sbjct: 154 VLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERG 199


>AL157394-6|CAI13864.1|  377|Homo sapiens actin, alpha 2, smooth
           muscle, aorta protein.
          Length = 377

 Score =  180 bits (438), Expect = 4e-45
 Identities = 80/85 (94%), Positives = 83/85 (97%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEAPLNPKANREKMTQIMFET
Sbjct: 69  LKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFET 128

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FN PAMYVAIQAVLSLYASGRTTG+
Sbjct: 129 FNVPAMYVAIQAVLSLYASGRTTGI 153



 Score =  132 bits (320), Expect = 8e-31
 Identities = 63/72 (87%), Positives = 66/72 (91%), Gaps = 1/72 (1%)
 Frame = +1

Query: 55  MCDEEVA-ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 231
           MC+EE + ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
Sbjct: 1   MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 232 QSKRGILTSNTP 267
           QSKRGILT   P
Sbjct: 61  QSKRGILTLKYP 72



 Score = 95.5 bits (227), Expect = 1e-19
 Identities = 43/46 (93%), Positives = 45/46 (97%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGV+H VPIYEGYALPHAI+RLDLAGRDLTDYLMKILTERG
Sbjct: 154 VLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERG 199


>AC073046-2|AAX88909.1|  376|Homo sapiens unknown protein.
          Length = 376

 Score =  180 bits (438), Expect = 4e-45
 Identities = 80/85 (94%), Positives = 83/85 (97%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEAPLNPKANREKMTQIMFET
Sbjct: 68  LKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFET 127

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FN PAMYVAIQAVLSLYASGRTTG+
Sbjct: 128 FNVPAMYVAIQAVLSLYASGRTTGI 152



 Score =  138 bits (333), Expect = 2e-32
 Identities = 63/71 (88%), Positives = 65/71 (91%)
 Frame = +1

Query: 55  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 234
           MC+EE  ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCEEETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 235 SKRGILTSNTP 267
           SKRGILT   P
Sbjct: 61  SKRGILTLKYP 71



 Score = 95.5 bits (227), Expect = 1e-19
 Identities = 43/46 (93%), Positives = 45/46 (97%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGV+H VPIYEGYALPHAI+RLDLAGRDLTDYLMKILTERG
Sbjct: 153 VLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERG 198


>EF523384-1|ABP57734.1| 1075|Homo sapiens POTE-2 alpha-actin protein.
          Length = 1075

 Score =  180 bits (437), Expect = 5e-45
 Identities = 84/107 (78%), Positives = 90/107 (84%)
 Frame = +3

Query: 189  GRHGTERLVRRRRGTEQKRYPDLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVL 368
            G H  E  V +     ++    LKYP+EHGI+TNWDDMEKIWHHTFYNELRVAPEEHPVL
Sbjct: 746  GMHQKESYVGKE-AQSKRGILTLKYPMEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVL 804

Query: 369  LTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGM 509
            LTEA LNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY SGRTTG+
Sbjct: 805  LTEATLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYTSGRTTGI 851



 Score =  119 bits (287), Expect = 8e-27
 Identities = 55/69 (79%), Positives = 60/69 (86%)
 Frame = +1

Query: 61  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 240
           D++ A LV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPR QG+M GM QK+SYVG EAQSK
Sbjct: 702 DDDTAVLVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRQQGMMGGMHQKESYVGKEAQSK 761

Query: 241 RGILTSNTP 267
           RGILT   P
Sbjct: 762 RGILTLKYP 770



 Score = 87.0 bits (206), Expect = 5e-17
 Identities = 40/48 (83%), Positives = 43/48 (89%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGTR 652
           V+DSGDGV+HTVPIYEG ALPHA LRLDLAGR+L DYLMKILTE G R
Sbjct: 852 VMDSGDGVTHTVPIYEGNALPHATLRLDLAGRELPDYLMKILTEHGYR 899


>CR536515-1|CAG38753.1|  376|Homo sapiens ACTG2 protein.
          Length = 376

 Score =  179 bits (436), Expect = 7e-45
 Identities = 80/85 (94%), Positives = 83/85 (97%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEAPLNPKANREKMTQIMFET
Sbjct: 68  LKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFET 127

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FN PAMYVAIQAVLSLYASGRTTG+
Sbjct: 128 FNFPAMYVAIQAVLSLYASGRTTGI 152



 Score =  138 bits (333), Expect = 2e-32
 Identities = 63/71 (88%), Positives = 65/71 (91%)
 Frame = +1

Query: 55  MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 234
           MC+EE  ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCEEETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 235 SKRGILTSNTP 267
           SKRGILT   P
Sbjct: 61  SKRGILTLKYP 71



 Score = 95.5 bits (227), Expect = 1e-19
 Identities = 43/46 (93%), Positives = 45/46 (97%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGV+H VPIYEGYALPHAI+RLDLAGRDLTDYLMKILTERG
Sbjct: 153 VLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERG 198


>AL157394-7|CAI13865.1|  151|Homo sapiens actin, alpha 2, smooth
           muscle, aorta protein.
          Length = 151

 Score =  177 bits (431), Expect = 3e-44
 Identities = 79/83 (95%), Positives = 81/83 (97%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEAPLNPKANREKMTQIMFET
Sbjct: 69  LKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFET 128

Query: 435 FNTPAMYVAIQAVLSLYASGRTT 503
           FN PAMYVAIQAVLSLYASGRTT
Sbjct: 129 FNVPAMYVAIQAVLSLYASGRTT 151



 Score =  132 bits (320), Expect = 8e-31
 Identities = 63/72 (87%), Positives = 66/72 (91%), Gaps = 1/72 (1%)
 Frame = +1

Query: 55  MCDEEVA-ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 231
           MC+EE + ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
Sbjct: 1   MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 232 QSKRGILTSNTP 267
           QSKRGILT   P
Sbjct: 61  QSKRGILTLKYP 72


>AY129015-1|AAM98758.1|  109|Homo sapiens unknown protein.
          Length = 109

 Score =  155 bits (375), Expect = 2e-37
 Identities = 73/105 (69%), Positives = 79/105 (75%)
 Frame = +3

Query: 282 VTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVA 461
           +TNWDD+EKIWHHTFY  L +A EEH VLLTE PLN KANREKMTQIMF+TFNT AMYVA
Sbjct: 1   MTNWDDIEKIWHHTFYKGLHMALEEHLVLLTEDPLNLKANREKMTQIMFDTFNTLAMYVA 60

Query: 462 IQAVLSLYASGRTTGMCWTPATVSPTPYPSTRDTHSLTPSCVWTW 596
           IQA LSLY  G T  + W     SPT  PS R T SLTP C+WTW
Sbjct: 61  IQARLSLYTCGCTLALSWALEMGSPTWCPSIRATPSLTPFCIWTW 105


>EF095209-1|ABL01513.1|  121|Homo sapiens beta-actin protein.
          Length = 121

 Score =  149 bits (360), Expect = 1e-35
 Identities = 65/65 (100%), Positives = 65/65 (100%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET
Sbjct: 57  LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 116

Query: 435 FNTPA 449
           FNTPA
Sbjct: 117 FNTPA 121



 Score =  124 bits (299), Expect = 3e-28
 Identities = 57/60 (95%), Positives = 57/60 (95%)
 Frame = +1

Query: 88  DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTSNTP 267
           DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILT   P
Sbjct: 1   DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYP 60


>AY970501-1|AAX82307.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  146 bits (354), Expect = 6e-35
 Identities = 67/68 (98%), Positives = 68/68 (100%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 486 ASGRTTGM 509
           ASGRTTG+
Sbjct: 61  ASGRTTGI 68



 Score = 74.9 bits (176), Expect = 2e-13
 Identities = 33/35 (94%), Positives = 35/35 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 69  VMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970499-1|AAX82305.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  146 bits (354), Expect = 6e-35
 Identities = 67/68 (98%), Positives = 68/68 (100%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 486 ASGRTTGM 509
           ASGRTTG+
Sbjct: 61  ASGRTTGI 68



 Score = 66.5 bits (155), Expect = 8e-11
 Identities = 30/35 (85%), Positives = 32/35 (91%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+D GDGV+HTV IYEGYALPHAILRLDLAG DLT
Sbjct: 69  VMDFGDGVTHTVSIYEGYALPHAILRLDLAGLDLT 103


>AY970498-1|AAX82304.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  146 bits (354), Expect = 6e-35
 Identities = 67/68 (98%), Positives = 68/68 (100%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 486 ASGRTTGM 509
           ASGRTTG+
Sbjct: 61  ASGRTTGI 68



 Score = 74.9 bits (176), Expect = 2e-13
 Identities = 33/35 (94%), Positives = 35/35 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 69  VMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970497-1|AAX82303.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  146 bits (354), Expect = 6e-35
 Identities = 67/68 (98%), Positives = 68/68 (100%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 486 ASGRTTGM 509
           ASGRTTG+
Sbjct: 61  ASGRTTGI 68



 Score = 74.9 bits (176), Expect = 2e-13
 Identities = 33/35 (94%), Positives = 35/35 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 69  VMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970495-1|AAX82301.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  146 bits (354), Expect = 6e-35
 Identities = 67/68 (98%), Positives = 68/68 (100%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 486 ASGRTTGM 509
           ASGRTTG+
Sbjct: 61  ASGRTTGI 68



 Score = 74.9 bits (176), Expect = 2e-13
 Identities = 33/35 (94%), Positives = 35/35 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 69  VMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970494-1|AAX82300.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  146 bits (354), Expect = 6e-35
 Identities = 67/68 (98%), Positives = 68/68 (100%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 486 ASGRTTGM 509
           ASGRTTG+
Sbjct: 61  ASGRTTGI 68



 Score = 74.9 bits (176), Expect = 2e-13
 Identities = 33/35 (94%), Positives = 35/35 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 69  VMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970493-1|AAX82299.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  146 bits (354), Expect = 6e-35
 Identities = 67/68 (98%), Positives = 68/68 (100%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 486 ASGRTTGM 509
           ASGRTTG+
Sbjct: 61  ASGRTTGI 68



 Score = 74.9 bits (176), Expect = 2e-13
 Identities = 33/35 (94%), Positives = 35/35 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 69  VMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970491-1|AAX82297.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  146 bits (354), Expect = 6e-35
 Identities = 67/68 (98%), Positives = 68/68 (100%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 486 ASGRTTGM 509
           ASGRTTG+
Sbjct: 61  ASGRTTGI 68



 Score = 74.9 bits (176), Expect = 2e-13
 Identities = 33/35 (94%), Positives = 35/35 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 69  VMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970489-1|AAX82295.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  146 bits (354), Expect = 6e-35
 Identities = 67/68 (98%), Positives = 68/68 (100%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 486 ASGRTTGM 509
           ASGRTTG+
Sbjct: 61  ASGRTTGI 68



 Score = 74.9 bits (176), Expect = 2e-13
 Identities = 33/35 (94%), Positives = 35/35 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 69  VMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970488-1|AAX82294.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  146 bits (354), Expect = 6e-35
 Identities = 67/68 (98%), Positives = 68/68 (100%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 486 ASGRTTGM 509
           ASGRTTG+
Sbjct: 61  ASGRTTGI 68



 Score = 74.9 bits (176), Expect = 2e-13
 Identities = 33/35 (94%), Positives = 35/35 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 69  VMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970487-1|AAX82293.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  146 bits (354), Expect = 6e-35
 Identities = 67/68 (98%), Positives = 68/68 (100%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 486 ASGRTTGM 509
           ASGRTTG+
Sbjct: 61  ASGRTTGI 68



 Score = 74.9 bits (176), Expect = 2e-13
 Identities = 33/35 (94%), Positives = 35/35 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 69  VMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970486-1|AAX82292.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  146 bits (354), Expect = 6e-35
 Identities = 67/68 (98%), Positives = 68/68 (100%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 486 ASGRTTGM 509
           ASGRTTG+
Sbjct: 61  ASGRTTGI 68



 Score = 74.9 bits (176), Expect = 2e-13
 Identities = 33/35 (94%), Positives = 35/35 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 69  VMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970478-1|AAX82284.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  146 bits (354), Expect = 6e-35
 Identities = 67/68 (98%), Positives = 68/68 (100%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 486 ASGRTTGM 509
           ASGRTTG+
Sbjct: 61  ASGRTTGI 68



 Score = 74.9 bits (176), Expect = 2e-13
 Identities = 33/35 (94%), Positives = 35/35 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 69  VMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970477-1|AAX82283.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  146 bits (354), Expect = 6e-35
 Identities = 67/68 (98%), Positives = 68/68 (100%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 486 ASGRTTGM 509
           ASGRTTG+
Sbjct: 61  ASGRTTGI 68



 Score = 72.1 bits (169), Expect = 2e-12
 Identities = 32/35 (91%), Positives = 34/35 (97%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DSGDGV+HTVPIYEGYALPHAILRLDLAG DLT
Sbjct: 69  VMDSGDGVTHTVPIYEGYALPHAILRLDLAGPDLT 103


>AY970476-1|AAX82282.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  146 bits (354), Expect = 6e-35
 Identities = 67/68 (98%), Positives = 68/68 (100%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 486 ASGRTTGM 509
           ASGRTTG+
Sbjct: 61  ASGRTTGI 68



 Score = 74.9 bits (176), Expect = 2e-13
 Identities = 33/35 (94%), Positives = 35/35 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 69  VMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970474-1|AAX82280.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  146 bits (354), Expect = 6e-35
 Identities = 67/68 (98%), Positives = 68/68 (100%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 486 ASGRTTGM 509
           ASGRTTG+
Sbjct: 61  ASGRTTGI 68



 Score = 74.9 bits (176), Expect = 2e-13
 Identities = 33/35 (94%), Positives = 35/35 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 69  VMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970473-1|AAX82279.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  146 bits (354), Expect = 6e-35
 Identities = 67/68 (98%), Positives = 68/68 (100%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 486 ASGRTTGM 509
           ASGRTTG+
Sbjct: 61  ASGRTTGI 68



 Score = 74.9 bits (176), Expect = 2e-13
 Identities = 33/35 (94%), Positives = 35/35 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 69  VMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970472-1|AAX82278.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  146 bits (354), Expect = 6e-35
 Identities = 67/68 (98%), Positives = 68/68 (100%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 486 ASGRTTGM 509
           ASGRTTG+
Sbjct: 61  ASGRTTGI 68



 Score = 74.9 bits (176), Expect = 2e-13
 Identities = 33/35 (94%), Positives = 35/35 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 69  VMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970471-1|AAX82277.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  146 bits (354), Expect = 6e-35
 Identities = 67/68 (98%), Positives = 68/68 (100%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 486 ASGRTTGM 509
           ASGRTTG+
Sbjct: 61  ASGRTTGI 68



 Score = 74.9 bits (176), Expect = 2e-13
 Identities = 33/35 (94%), Positives = 35/35 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 69  VMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970470-1|AAX82276.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  146 bits (354), Expect = 6e-35
 Identities = 67/68 (98%), Positives = 68/68 (100%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 486 ASGRTTGM 509
           ASGRTTG+
Sbjct: 61  ASGRTTGI 68



 Score = 74.9 bits (176), Expect = 2e-13
 Identities = 33/35 (94%), Positives = 35/35 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 69  VMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970469-1|AAX82275.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  146 bits (354), Expect = 6e-35
 Identities = 67/68 (98%), Positives = 68/68 (100%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 486 ASGRTTGM 509
           ASGRTTG+
Sbjct: 61  ASGRTTGI 68



 Score = 74.9 bits (176), Expect = 2e-13
 Identities = 33/35 (94%), Positives = 35/35 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 69  VMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970468-1|AAX82274.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  146 bits (354), Expect = 6e-35
 Identities = 67/68 (98%), Positives = 68/68 (100%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 486 ASGRTTGM 509
           ASGRTTG+
Sbjct: 61  ASGRTTGI 68



 Score = 74.9 bits (176), Expect = 2e-13
 Identities = 33/35 (94%), Positives = 35/35 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 69  VMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970443-1|AAX82252.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  146 bits (354), Expect = 6e-35
 Identities = 67/68 (98%), Positives = 68/68 (100%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 486 ASGRTTGM 509
           ASGRTTG+
Sbjct: 61  ASGRTTGI 68



 Score = 74.9 bits (176), Expect = 2e-13
 Identities = 33/35 (94%), Positives = 35/35 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 69  VMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970441-1|AAX82250.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  146 bits (354), Expect = 6e-35
 Identities = 67/68 (98%), Positives = 68/68 (100%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 486 ASGRTTGM 509
           ASGRTTG+
Sbjct: 61  ASGRTTGI 68



 Score = 74.9 bits (176), Expect = 2e-13
 Identities = 33/35 (94%), Positives = 35/35 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 69  VMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970419-1|AAX82228.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  146 bits (354), Expect = 6e-35
 Identities = 67/68 (98%), Positives = 68/68 (100%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 486 ASGRTTGM 509
           ASGRTTG+
Sbjct: 61  ASGRTTGI 68



 Score = 74.9 bits (176), Expect = 2e-13
 Identities = 33/35 (94%), Positives = 35/35 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 69  VMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970418-1|AAX82227.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  146 bits (354), Expect = 6e-35
 Identities = 67/68 (98%), Positives = 68/68 (100%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 486 ASGRTTGM 509
           ASGRTTG+
Sbjct: 61  ASGRTTGI 68



 Score = 74.9 bits (176), Expect = 2e-13
 Identities = 33/35 (94%), Positives = 35/35 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 69  VMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970417-1|AAX82226.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  146 bits (354), Expect = 6e-35
 Identities = 67/68 (98%), Positives = 68/68 (100%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 486 ASGRTTGM 509
           ASGRTTG+
Sbjct: 61  ASGRTTGI 68



 Score = 74.9 bits (176), Expect = 2e-13
 Identities = 33/35 (94%), Positives = 35/35 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 69  VMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970416-1|AAX82225.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  146 bits (354), Expect = 6e-35
 Identities = 67/68 (98%), Positives = 68/68 (100%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 486 ASGRTTGM 509
           ASGRTTG+
Sbjct: 61  ASGRTTGI 68



 Score = 74.9 bits (176), Expect = 2e-13
 Identities = 33/35 (94%), Positives = 35/35 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 69  VMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970415-1|AAX82224.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  146 bits (354), Expect = 6e-35
 Identities = 67/68 (98%), Positives = 68/68 (100%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 486 ASGRTTGM 509
           ASGRTTG+
Sbjct: 61  ASGRTTGI 68



 Score = 74.9 bits (176), Expect = 2e-13
 Identities = 33/35 (94%), Positives = 35/35 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 69  VMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970414-1|AAX82223.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  146 bits (354), Expect = 6e-35
 Identities = 67/68 (98%), Positives = 68/68 (100%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 486 ASGRTTGM 509
           ASGRTTG+
Sbjct: 61  ASGRTTGI 68



 Score = 74.9 bits (176), Expect = 2e-13
 Identities = 33/35 (94%), Positives = 35/35 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 69  VMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970413-1|AAX82222.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  146 bits (354), Expect = 6e-35
 Identities = 67/68 (98%), Positives = 68/68 (100%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 486 ASGRTTGM 509
           ASGRTTG+
Sbjct: 61  ASGRTTGI 68



 Score = 74.9 bits (176), Expect = 2e-13
 Identities = 33/35 (94%), Positives = 35/35 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 69  VMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970412-1|AAX82221.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  146 bits (354), Expect = 6e-35
 Identities = 67/68 (98%), Positives = 68/68 (100%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 486 ASGRTTGM 509
           ASGRTTG+
Sbjct: 61  ASGRTTGI 68



 Score = 74.9 bits (176), Expect = 2e-13
 Identities = 33/35 (94%), Positives = 35/35 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 69  VMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970411-1|AAX82220.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  146 bits (354), Expect = 6e-35
 Identities = 67/68 (98%), Positives = 68/68 (100%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 486 ASGRTTGM 509
           ASGRTTG+
Sbjct: 61  ASGRTTGI 68



 Score = 74.9 bits (176), Expect = 2e-13
 Identities = 33/35 (94%), Positives = 35/35 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 69  VMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970410-1|AAX82219.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  146 bits (354), Expect = 6e-35
 Identities = 67/68 (98%), Positives = 68/68 (100%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 486 ASGRTTGM 509
           ASGRTTG+
Sbjct: 61  ASGRTTGI 68



 Score = 74.9 bits (176), Expect = 2e-13
 Identities = 33/35 (94%), Positives = 35/35 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 69  VMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970409-1|AAX82218.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  146 bits (354), Expect = 6e-35
 Identities = 67/68 (98%), Positives = 68/68 (100%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 486 ASGRTTGM 509
           ASGRTTG+
Sbjct: 61  ASGRTTGI 68



 Score = 74.9 bits (176), Expect = 2e-13
 Identities = 33/35 (94%), Positives = 35/35 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 69  VMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970408-1|AAX82217.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  146 bits (354), Expect = 6e-35
 Identities = 67/68 (98%), Positives = 68/68 (100%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 486 ASGRTTGM 509
           ASGRTTG+
Sbjct: 61  ASGRTTGI 68



 Score = 74.9 bits (176), Expect = 2e-13
 Identities = 33/35 (94%), Positives = 35/35 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 69  VMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970406-1|AAX82215.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  146 bits (354), Expect = 6e-35
 Identities = 67/68 (98%), Positives = 68/68 (100%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 486 ASGRTTGM 509
           ASGRTTG+
Sbjct: 61  ASGRTTGI 68



 Score = 74.9 bits (176), Expect = 2e-13
 Identities = 33/35 (94%), Positives = 35/35 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 69  VMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970405-1|AAX82214.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  146 bits (354), Expect = 6e-35
 Identities = 67/68 (98%), Positives = 68/68 (100%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 486 ASGRTTGM 509
           ASGRTTG+
Sbjct: 61  ASGRTTGI 68



 Score = 74.9 bits (176), Expect = 2e-13
 Identities = 33/35 (94%), Positives = 35/35 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 69  VMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970404-1|AAX82213.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  146 bits (354), Expect = 6e-35
 Identities = 67/68 (98%), Positives = 68/68 (100%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 486 ASGRTTGM 509
           ASGRTTG+
Sbjct: 61  ASGRTTGI 68



 Score = 74.9 bits (176), Expect = 2e-13
 Identities = 33/35 (94%), Positives = 35/35 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 69  VMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970403-1|AAX82212.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  146 bits (354), Expect = 6e-35
 Identities = 67/68 (98%), Positives = 68/68 (100%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 486 ASGRTTGM 509
           ASGRTTG+
Sbjct: 61  ASGRTTGI 68



 Score = 74.9 bits (176), Expect = 2e-13
 Identities = 33/35 (94%), Positives = 35/35 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 69  VMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970402-1|AAX82211.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  146 bits (354), Expect = 6e-35
 Identities = 67/68 (98%), Positives = 68/68 (100%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 486 ASGRTTGM 509
           ASGRTTG+
Sbjct: 61  ASGRTTGI 68



 Score = 74.9 bits (176), Expect = 2e-13
 Identities = 33/35 (94%), Positives = 35/35 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 69  VMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970383-1|AAX82192.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  146 bits (354), Expect = 6e-35
 Identities = 67/68 (98%), Positives = 68/68 (100%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 486 ASGRTTGM 509
           ASGRTTG+
Sbjct: 61  ASGRTTGI 68



 Score = 72.1 bits (169), Expect = 2e-12
 Identities = 32/35 (91%), Positives = 34/35 (97%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DSGDGV+HTVPIYEGYALPHAILRLDLAGRD T
Sbjct: 69  VMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDPT 103


>AY970382-1|AAX82191.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  146 bits (354), Expect = 6e-35
 Identities = 67/68 (98%), Positives = 68/68 (100%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 486 ASGRTTGM 509
           ASGRTTG+
Sbjct: 61  ASGRTTGI 68



 Score = 74.9 bits (176), Expect = 2e-13
 Identities = 33/35 (94%), Positives = 35/35 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 69  VMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970381-1|AAX82190.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  146 bits (354), Expect = 6e-35
 Identities = 67/68 (98%), Positives = 68/68 (100%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 486 ASGRTTGM 509
           ASGRTTG+
Sbjct: 61  ASGRTTGI 68



 Score = 74.9 bits (176), Expect = 2e-13
 Identities = 33/35 (94%), Positives = 35/35 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 69  VMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970380-1|AAX82189.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  146 bits (354), Expect = 6e-35
 Identities = 67/68 (98%), Positives = 68/68 (100%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 486 ASGRTTGM 509
           ASGRTTG+
Sbjct: 61  ASGRTTGI 68



 Score = 74.9 bits (176), Expect = 2e-13
 Identities = 33/35 (94%), Positives = 35/35 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 69  VMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970377-1|AAX82186.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  146 bits (354), Expect = 6e-35
 Identities = 67/68 (98%), Positives = 68/68 (100%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 486 ASGRTTGM 509
           ASGRTTG+
Sbjct: 61  ASGRTTGI 68



 Score = 74.9 bits (176), Expect = 2e-13
 Identities = 33/35 (94%), Positives = 35/35 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 69  VMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970376-1|AAX82185.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  146 bits (354), Expect = 6e-35
 Identities = 67/68 (98%), Positives = 68/68 (100%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 486 ASGRTTGM 509
           ASGRTTG+
Sbjct: 61  ASGRTTGI 68



 Score = 72.1 bits (169), Expect = 2e-12
 Identities = 32/35 (91%), Positives = 34/35 (97%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DSGDGV+HTVPIYEGYALPHAILR DLAGRDLT
Sbjct: 69  VMDSGDGVTHTVPIYEGYALPHAILRPDLAGRDLT 103


>AY970375-1|AAX82184.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  146 bits (354), Expect = 6e-35
 Identities = 67/68 (98%), Positives = 68/68 (100%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 486 ASGRTTGM 509
           ASGRTTG+
Sbjct: 61  ASGRTTGI 68



 Score = 74.9 bits (176), Expect = 2e-13
 Identities = 33/35 (94%), Positives = 35/35 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 69  VMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970372-1|AAX82182.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  146 bits (354), Expect = 6e-35
 Identities = 67/68 (98%), Positives = 68/68 (100%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 486 ASGRTTGM 509
           ASGRTTG+
Sbjct: 61  ASGRTTGI 68



 Score = 74.9 bits (176), Expect = 2e-13
 Identities = 33/35 (94%), Positives = 35/35 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 69  VMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970371-1|AAX82181.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  146 bits (354), Expect = 6e-35
 Identities = 67/68 (98%), Positives = 68/68 (100%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 486 ASGRTTGM 509
           ASGRTTG+
Sbjct: 61  ASGRTTGI 68



 Score = 74.9 bits (176), Expect = 2e-13
 Identities = 33/35 (94%), Positives = 35/35 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 69  VMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970370-1|AAX82180.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  146 bits (354), Expect = 6e-35
 Identities = 67/68 (98%), Positives = 68/68 (100%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 486 ASGRTTGM 509
           ASGRTTG+
Sbjct: 61  ASGRTTGI 68



 Score = 74.9 bits (176), Expect = 2e-13
 Identities = 33/35 (94%), Positives = 35/35 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 69  VMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970369-1|AAX82179.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  146 bits (354), Expect = 6e-35
 Identities = 67/68 (98%), Positives = 68/68 (100%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 486 ASGRTTGM 509
           ASGRTTG+
Sbjct: 61  ASGRTTGI 68



 Score = 74.9 bits (176), Expect = 2e-13
 Identities = 33/35 (94%), Positives = 35/35 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 69  VMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970368-1|AAX82178.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  146 bits (354), Expect = 6e-35
 Identities = 67/68 (98%), Positives = 68/68 (100%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 486 ASGRTTGM 509
           ASGRTTG+
Sbjct: 61  ASGRTTGI 68



 Score = 74.9 bits (176), Expect = 2e-13
 Identities = 33/35 (94%), Positives = 35/35 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 69  VMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970366-1|AAX82176.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  146 bits (354), Expect = 6e-35
 Identities = 67/68 (98%), Positives = 68/68 (100%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 486 ASGRTTGM 509
           ASGRTTG+
Sbjct: 61  ASGRTTGI 68



 Score = 74.9 bits (176), Expect = 2e-13
 Identities = 33/35 (94%), Positives = 35/35 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 69  VMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970364-1|AAX82174.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  146 bits (354), Expect = 6e-35
 Identities = 67/68 (98%), Positives = 68/68 (100%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 486 ASGRTTGM 509
           ASGRTTG+
Sbjct: 61  ASGRTTGI 68



 Score = 74.9 bits (176), Expect = 2e-13
 Identities = 33/35 (94%), Positives = 35/35 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 69  VMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970363-1|AAX82173.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  146 bits (354), Expect = 6e-35
 Identities = 67/68 (98%), Positives = 68/68 (100%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 486 ASGRTTGM 509
           ASGRTTG+
Sbjct: 61  ASGRTTGI 68



 Score = 74.9 bits (176), Expect = 2e-13
 Identities = 33/35 (94%), Positives = 35/35 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 69  VMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970421-1|AAX82230.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  146 bits (353), Expect = 8e-35
 Identities = 66/68 (97%), Positives = 68/68 (100%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 486 ASGRTTGM 509
           ASGRTTG+
Sbjct: 61  ASGRTTGI 68



 Score = 71.7 bits (168), Expect = 2e-12
 Identities = 32/35 (91%), Positives = 34/35 (97%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DSGDGV+HTVPIYEGYALPHAIL LDLAGRDLT
Sbjct: 69  VMDSGDGVTHTVPIYEGYALPHAILCLDLAGRDLT 103


>AY970492-1|AAX82298.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  145 bits (351), Expect = 1e-34
 Identities = 66/68 (97%), Positives = 68/68 (100%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFYNELRVAPEEHPVLLT+APLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTQAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 486 ASGRTTGM 509
           ASGRTTG+
Sbjct: 61  ASGRTTGI 68



 Score = 74.9 bits (176), Expect = 2e-13
 Identities = 33/35 (94%), Positives = 35/35 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 69  VMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970490-1|AAX82296.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  144 bits (350), Expect = 2e-34
 Identities = 66/68 (97%), Positives = 67/68 (98%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFYNELRV PEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVTPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 486 ASGRTTGM 509
           ASGRTTG+
Sbjct: 61  ASGRTTGI 68



 Score = 74.9 bits (176), Expect = 2e-13
 Identities = 33/35 (94%), Positives = 35/35 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 69  VMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970479-1|AAX82285.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  144 bits (350), Expect = 2e-34
 Identities = 66/68 (97%), Positives = 67/68 (98%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 486 ASGRTTGM 509
            SGRTTG+
Sbjct: 61  TSGRTTGI 68



 Score = 67.7 bits (158), Expect = 3e-11
 Identities = 30/35 (85%), Positives = 33/35 (94%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DSGDGV+HTVPIYEG ALPHA LRLDLAGR+LT
Sbjct: 69  VMDSGDGVTHTVPIYEGNALPHATLRLDLAGRELT 103


>AY970444-1|AAX82253.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  144 bits (350), Expect = 2e-34
 Identities = 66/68 (97%), Positives = 68/68 (100%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFYN+LRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNKLRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 486 ASGRTTGM 509
           ASGRTTG+
Sbjct: 61  ASGRTTGI 68



 Score = 74.9 bits (176), Expect = 2e-13
 Identities = 33/35 (94%), Positives = 35/35 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 69  VMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970502-1|AAX82308.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  144 bits (349), Expect = 2e-34
 Identities = 65/68 (95%), Positives = 67/68 (98%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 486 ASGRTTGM 509
            SGRTTG+
Sbjct: 61  TSGRTTGI 68



 Score = 71.3 bits (167), Expect = 3e-12
 Identities = 32/35 (91%), Positives = 34/35 (97%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DSGDGV+HTVPIYEG ALPHAILRLDLAGRDLT
Sbjct: 69  VMDSGDGVTHTVPIYEGNALPHAILRLDLAGRDLT 103


>AY970500-1|AAX82306.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  144 bits (349), Expect = 2e-34
 Identities = 66/68 (97%), Positives = 67/68 (98%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQ MFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQTMFETFNTPAMYVAIQAVLSLY 60

Query: 486 ASGRTTGM 509
           ASGRTTG+
Sbjct: 61  ASGRTTGI 68



 Score = 74.9 bits (176), Expect = 2e-13
 Identities = 33/35 (94%), Positives = 35/35 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 69  VMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970480-1|AAX82286.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  144 bits (349), Expect = 2e-34
 Identities = 65/68 (95%), Positives = 67/68 (98%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 486 ASGRTTGM 509
            SGRTTG+
Sbjct: 61  TSGRTTGI 68



 Score = 64.9 bits (151), Expect = 2e-10
 Identities = 29/35 (82%), Positives = 32/35 (91%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DSGDGV+HTVPIYEG ALPHA L LDLAGR+LT
Sbjct: 69  VMDSGDGVTHTVPIYEGNALPHATLPLDLAGRELT 103


>AY970464-1|AAX82271.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  144 bits (349), Expect = 2e-34
 Identities = 65/68 (95%), Positives = 67/68 (98%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 486 ASGRTTGM 509
            SGRTTG+
Sbjct: 61  TSGRTTGI 68



 Score = 65.7 bits (153), Expect = 1e-10
 Identities = 29/35 (82%), Positives = 32/35 (91%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DSGDG +HTVPIYEG ALPHA LRLDLAGR+LT
Sbjct: 69  VMDSGDGFTHTVPIYEGNALPHATLRLDLAGRELT 103


>AY970460-1|AAX82267.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  144 bits (349), Expect = 2e-34
 Identities = 65/68 (95%), Positives = 67/68 (98%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 486 ASGRTTGM 509
            SGRTTG+
Sbjct: 61  TSGRTTGI 68



 Score = 69.3 bits (162), Expect = 1e-11
 Identities = 31/35 (88%), Positives = 33/35 (94%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DSGDGV+HTVPIYEG ALPHA LRLDLAGRDLT
Sbjct: 69  VMDSGDGVTHTVPIYEGNALPHATLRLDLAGRDLT 103


>AY970457-1|AAX82264.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  144 bits (349), Expect = 2e-34
 Identities = 65/68 (95%), Positives = 67/68 (98%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 486 ASGRTTGM 509
            SGRTTG+
Sbjct: 61  TSGRTTGI 68



 Score = 67.7 bits (158), Expect = 3e-11
 Identities = 30/35 (85%), Positives = 33/35 (94%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DSGDGV+HTVPIYEG ALPHA LRLDLAGR+LT
Sbjct: 69  VMDSGDGVTHTVPIYEGNALPHATLRLDLAGRELT 103


>AY970446-1|AAX82255.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  144 bits (349), Expect = 2e-34
 Identities = 65/68 (95%), Positives = 67/68 (98%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 486 ASGRTTGM 509
            SGRTTG+
Sbjct: 61  TSGRTTGI 68



 Score = 67.3 bits (157), Expect = 5e-11
 Identities = 30/35 (85%), Positives = 33/35 (94%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DSGDGV+HTVPIYEG ALPHA LRLDLAGR+LT
Sbjct: 69  VMDSGDGVTHTVPIYEGDALPHATLRLDLAGRELT 103


>AY970442-1|AAX82251.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  144 bits (349), Expect = 2e-34
 Identities = 66/68 (97%), Positives = 67/68 (98%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKAN EKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANHEKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 486 ASGRTTGM 509
           ASGRTTG+
Sbjct: 61  ASGRTTGI 68



 Score = 74.9 bits (176), Expect = 2e-13
 Identities = 33/35 (94%), Positives = 35/35 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 69  VMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970431-1|AAX82240.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  144 bits (349), Expect = 2e-34
 Identities = 65/68 (95%), Positives = 67/68 (98%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 486 ASGRTTGM 509
            SGRTTG+
Sbjct: 61  TSGRTTGI 68



 Score = 67.7 bits (158), Expect = 3e-11
 Identities = 30/35 (85%), Positives = 33/35 (94%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DSGDGV+HTVPIYEG ALPHA LRLDLAGR+LT
Sbjct: 69  VMDSGDGVTHTVPIYEGNALPHATLRLDLAGRELT 103


>AY970430-1|AAX82239.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  144 bits (349), Expect = 2e-34
 Identities = 65/68 (95%), Positives = 67/68 (98%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 486 ASGRTTGM 509
            SGRTTG+
Sbjct: 61  TSGRTTGI 68



 Score = 67.7 bits (158), Expect = 3e-11
 Identities = 30/35 (85%), Positives = 33/35 (94%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DSGDGV+HTVPIYEG ALPHA LRLDLAGR+LT
Sbjct: 69  VMDSGDGVTHTVPIYEGNALPHATLRLDLAGRELT 103


>AY970428-1|AAX82237.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  144 bits (349), Expect = 2e-34
 Identities = 65/68 (95%), Positives = 67/68 (98%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 486 ASGRTTGM 509
            SGRTTG+
Sbjct: 61  TSGRTTGI 68



 Score = 67.7 bits (158), Expect = 3e-11
 Identities = 30/35 (85%), Positives = 33/35 (94%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DSGDGV+HTVPIYEG ALPHA LRLDLAGR+LT
Sbjct: 69  VMDSGDGVTHTVPIYEGNALPHATLRLDLAGRELT 103


>AY970390-1|AAX82199.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  144 bits (349), Expect = 2e-34
 Identities = 65/68 (95%), Positives = 67/68 (98%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 486 ASGRTTGM 509
            SGRTTG+
Sbjct: 61  TSGRTTGI 68



 Score = 71.3 bits (167), Expect = 3e-12
 Identities = 31/35 (88%), Positives = 34/35 (97%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DSGDGV+HTVPIYEGYALPHA LRLDLAGR+LT
Sbjct: 69  VMDSGDGVTHTVPIYEGYALPHATLRLDLAGRELT 103


>AY970389-1|AAX82198.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  144 bits (349), Expect = 2e-34
 Identities = 65/68 (95%), Positives = 67/68 (98%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 486 ASGRTTGM 509
            SGRTTG+
Sbjct: 61  TSGRTTGI 68



 Score = 67.7 bits (158), Expect = 3e-11
 Identities = 30/35 (85%), Positives = 33/35 (94%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DSGDGV+HTVPIYEG ALPHA LRLDLAGR+LT
Sbjct: 69  VMDSGDGVTHTVPIYEGNALPHATLRLDLAGRELT 103


>AY970386-1|AAX82195.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  144 bits (349), Expect = 2e-34
 Identities = 65/68 (95%), Positives = 67/68 (98%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 486 ASGRTTGM 509
            SGRTTG+
Sbjct: 61  TSGRTTGI 68



 Score = 67.3 bits (157), Expect = 5e-11
 Identities = 30/35 (85%), Positives = 33/35 (94%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DSGDGV+HTVPIYEG ALPHA LRL+LAGRDLT
Sbjct: 69  VMDSGDGVTHTVPIYEGNALPHATLRLNLAGRDLT 103


>AY970378-1|AAX82187.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  144 bits (349), Expect = 2e-34
 Identities = 65/68 (95%), Positives = 67/68 (98%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 486 ASGRTTGM 509
            SGRTTG+
Sbjct: 61  TSGRTTGI 68



 Score = 65.7 bits (153), Expect = 1e-10
 Identities = 29/35 (82%), Positives = 32/35 (91%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DSGDGV+HTVPIYEG ALPHA LRLDL GR+LT
Sbjct: 69  VMDSGDGVTHTVPIYEGNALPHATLRLDLPGRELT 103


>AY970374-1|AAX82183.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  144 bits (348), Expect = 3e-34
 Identities = 66/68 (97%), Positives = 67/68 (98%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFYNELRVAPEEHPVLLTEAPL PKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLTPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 486 ASGRTTGM 509
           ASGRTTG+
Sbjct: 61  ASGRTTGI 68



 Score = 74.9 bits (176), Expect = 2e-13
 Identities = 33/35 (94%), Positives = 35/35 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 69  VMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970485-1|AAX82291.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  143 bits (347), Expect = 4e-34
 Identities = 66/68 (97%), Positives = 67/68 (98%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMF TFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFGTFNTPAMYVAIQAVLSLY 60

Query: 486 ASGRTTGM 509
           ASGRTTG+
Sbjct: 61  ASGRTTGI 68



 Score = 74.9 bits (176), Expect = 2e-13
 Identities = 33/35 (94%), Positives = 35/35 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 69  VMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970365-1|AAX82175.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  143 bits (347), Expect = 4e-34
 Identities = 66/68 (97%), Positives = 67/68 (98%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFYNEL VAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELGVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 486 ASGRTTGM 509
           ASGRTTG+
Sbjct: 61  ASGRTTGI 68



 Score = 74.9 bits (176), Expect = 2e-13
 Identities = 33/35 (94%), Positives = 35/35 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 69  VMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970496-1|AAX82302.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  143 bits (346), Expect = 6e-34
 Identities = 66/68 (97%), Positives = 67/68 (98%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWH TFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHRTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 486 ASGRTTGM 509
           ASGRTTG+
Sbjct: 61  ASGRTTGI 68



 Score = 74.9 bits (176), Expect = 2e-13
 Identities = 33/35 (94%), Positives = 35/35 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 69  VMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970420-1|AAX82229.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  143 bits (346), Expect = 6e-34
 Identities = 66/68 (97%), Positives = 67/68 (98%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 486 ASGRTTGM 509
           ASG TTG+
Sbjct: 61  ASGCTTGI 68



 Score = 74.9 bits (176), Expect = 2e-13
 Identities = 33/35 (94%), Positives = 35/35 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 69  VMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970367-1|AAX82177.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  143 bits (346), Expect = 6e-34
 Identities = 66/68 (97%), Positives = 67/68 (98%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIW HTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWRHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 486 ASGRTTGM 509
           ASGRTTG+
Sbjct: 61  ASGRTTGI 68



 Score = 73.3 bits (172), Expect = 7e-13
 Identities = 32/35 (91%), Positives = 35/35 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DSGDGV+HTVPIY+GYALPHAILRLDLAGRDLT
Sbjct: 69  VMDSGDGVTHTVPIYKGYALPHAILRLDLAGRDLT 103


>AY970458-1|AAX82265.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  142 bits (345), Expect = 8e-34
 Identities = 67/79 (84%), Positives = 71/79 (89%), Gaps = 1/79 (1%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFYNELRVAPEEHP+LLTEAPL+PKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLSPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 486 ASGRTTGMCWTPA-TVSPT 539
            SGRTTG+       V+PT
Sbjct: 61  TSGRTTGIVMDSGDRVTPT 79



 Score = 60.5 bits (140), Expect = 5e-09
 Identities = 28/35 (80%), Positives = 31/35 (88%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DSGD V+ TVPIYEG ALPHA LRLDLAGR+LT
Sbjct: 69  VMDSGDRVTPTVPIYEGNALPHATLRLDLAGRELT 103


>AY970456-1|AAX82263.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  142 bits (345), Expect = 8e-34
 Identities = 64/68 (94%), Positives = 67/68 (98%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIMFETFNTPA+YVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAIYVAIQAVLSLY 60

Query: 486 ASGRTTGM 509
            SGRTTG+
Sbjct: 61  TSGRTTGI 68



 Score = 67.7 bits (158), Expect = 3e-11
 Identities = 30/35 (85%), Positives = 33/35 (94%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DSGDGV+HTVPIYEG ALPHA LRLDLAGR+LT
Sbjct: 69  VMDSGDGVTHTVPIYEGNALPHATLRLDLAGRELT 103


>AY970429-1|AAX82238.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  142 bits (345), Expect = 8e-34
 Identities = 64/68 (94%), Positives = 67/68 (98%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMT+IMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTRIMFETFNTPAMYVAIQAVLSLY 60

Query: 486 ASGRTTGM 509
            SGRTTG+
Sbjct: 61  TSGRTTGI 68



 Score = 67.7 bits (158), Expect = 3e-11
 Identities = 30/35 (85%), Positives = 33/35 (94%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DSGDGV+HTVPIYEG ALPHA LRLDLAGR+LT
Sbjct: 69  VMDSGDGVTHTVPIYEGNALPHATLRLDLAGRELT 103


>AY970388-1|AAX82197.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  142 bits (345), Expect = 8e-34
 Identities = 64/68 (94%), Positives = 66/68 (97%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIMFETFNTPAMYV IQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMYVTIQAVLSLY 60

Query: 486 ASGRTTGM 509
            SGRTTG+
Sbjct: 61  TSGRTTGI 68



 Score = 67.7 bits (158), Expect = 3e-11
 Identities = 30/35 (85%), Positives = 33/35 (94%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DSGDGV+HTVPIYEG ALPHA LRLDLAGR+LT
Sbjct: 69  VMDSGDGVTHTVPIYEGNALPHATLRLDLAGRELT 103


>AY970387-1|AAX82196.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  142 bits (345), Expect = 8e-34
 Identities = 64/68 (94%), Positives = 66/68 (97%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIMFETFNTPAMYV IQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMYVTIQAVLSLY 60

Query: 486 ASGRTTGM 509
            SGRTTG+
Sbjct: 61  TSGRTTGI 68



 Score = 67.7 bits (158), Expect = 3e-11
 Identities = 30/35 (85%), Positives = 33/35 (94%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DSGDGV+HTVPIYEG ALPHA LRLDLAGR+LT
Sbjct: 69  VMDSGDGVTHTVPIYEGNALPHATLRLDLAGRELT 103


>AY970463-1|AAX82270.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  142 bits (344), Expect = 1e-33
 Identities = 64/68 (94%), Positives = 67/68 (98%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFY+ELRVAPEEHP+LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYSELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 486 ASGRTTGM 509
            SGRTTG+
Sbjct: 61  TSGRTTGI 68



 Score = 65.7 bits (153), Expect = 1e-10
 Identities = 29/35 (82%), Positives = 32/35 (91%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DSGDG +HTVPIYEG ALPHA LRLDLAGR+LT
Sbjct: 69  VMDSGDGFTHTVPIYEGNALPHATLRLDLAGRELT 103


>AY970392-1|AAX82201.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  142 bits (344), Expect = 1e-33
 Identities = 64/68 (94%), Positives = 66/68 (97%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKAN EKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANHEKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 486 ASGRTTGM 509
            SGRTTG+
Sbjct: 61  TSGRTTGI 68



 Score = 65.7 bits (153), Expect = 1e-10
 Identities = 29/35 (82%), Positives = 33/35 (94%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DSGDGV+HTVPIYEG ALPHA LRL+LAGR+LT
Sbjct: 69  VMDSGDGVTHTVPIYEGNALPHATLRLNLAGRELT 103


>AY970385-1|AAX82194.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  142 bits (344), Expect = 1e-33
 Identities = 64/68 (94%), Positives = 66/68 (97%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKAN EKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANHEKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 486 ASGRTTGM 509
            SGRTTG+
Sbjct: 61  TSGRTTGI 68



 Score = 72.1 bits (169), Expect = 2e-12
 Identities = 31/35 (88%), Positives = 34/35 (97%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DSGDGV+H VPIYEGYALPHAI+RLDLAGRDLT
Sbjct: 69  VMDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLT 103


>AY970391-1|AAX82200.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  142 bits (343), Expect = 1e-33
 Identities = 64/68 (94%), Positives = 66/68 (97%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFYNELRVAPEEHP+LLTEAPLNP ANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPMANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 486 ASGRTTGM 509
            SGRTTG+
Sbjct: 61  TSGRTTGI 68



 Score = 63.7 bits (148), Expect = 6e-10
 Identities = 28/34 (82%), Positives = 31/34 (91%)
 Frame = +2

Query: 512 LDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           +DSGDGV+HT PIYEG ALPHA LRLDLAGR+LT
Sbjct: 70  MDSGDGVTHTAPIYEGNALPHAPLRLDLAGRELT 103


>AY970462-1|AAX82269.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  141 bits (342), Expect = 2e-33
 Identities = 64/68 (94%), Positives = 66/68 (97%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAV SLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVPSLY 60

Query: 486 ASGRTTGM 509
            SGRTTG+
Sbjct: 61  TSGRTTGI 68



 Score = 63.7 bits (148), Expect = 6e-10
 Identities = 28/34 (82%), Positives = 32/34 (94%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDL 610
           V+DSGDGV+HTVPIYEG ALPHA LRL+LAGR+L
Sbjct: 69  VMDSGDGVTHTVPIYEGNALPHATLRLNLAGREL 102


>AY970426-1|AAX82235.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  141 bits (342), Expect = 2e-33
 Identities = 64/68 (94%), Positives = 66/68 (97%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAV SLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVPSLY 60

Query: 486 ASGRTTGM 509
            SGRTTG+
Sbjct: 61  TSGRTTGI 68



 Score = 66.5 bits (155), Expect = 8e-11
 Identities = 29/35 (82%), Positives = 33/35 (94%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DSGDGV+HTVPIY+G ALPHA LRLDLAGR+LT
Sbjct: 69  VMDSGDGVTHTVPIYDGNALPHATLRLDLAGRELT 103


>AY970454-1|AAX82261.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  141 bits (341), Expect = 2e-33
 Identities = 64/68 (94%), Positives = 66/68 (97%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFYNELRVAPEEH +LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHSILLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 486 ASGRTTGM 509
            SGRTTG+
Sbjct: 61  TSGRTTGI 68



 Score = 67.7 bits (158), Expect = 3e-11
 Identities = 30/35 (85%), Positives = 33/35 (94%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DSGDGV+HTVPIYEG ALPHA LRLDLAGR+LT
Sbjct: 69  VMDSGDGVTHTVPIYEGNALPHATLRLDLAGRELT 103


>AY970440-1|AAX82249.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  141 bits (341), Expect = 2e-33
 Identities = 64/68 (94%), Positives = 66/68 (97%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHH+FYNELRVAPEEHP LLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLY
Sbjct: 1   KIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLY 60

Query: 486 ASGRTTGM 509
           ASGRTTG+
Sbjct: 61  ASGRTTGI 68



 Score = 72.9 bits (171), Expect = 9e-13
 Identities = 32/35 (91%), Positives = 34/35 (97%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           VLDSGDGV+H VPIYEGYALPHAI+RLDLAGRDLT
Sbjct: 69  VLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLT 103


>AY970439-1|AAX82248.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  141 bits (341), Expect = 2e-33
 Identities = 64/68 (94%), Positives = 66/68 (97%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHH+FYNELRVAPEEHP LLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLY
Sbjct: 1   KIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLY 60

Query: 486 ASGRTTGM 509
           ASGRTTG+
Sbjct: 61  ASGRTTGI 68



 Score = 72.9 bits (171), Expect = 9e-13
 Identities = 32/35 (91%), Positives = 34/35 (97%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           VLDSGDGV+H VPIYEGYALPHAI+RLDLAGRDLT
Sbjct: 69  VLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLT 103


>AY970475-1|AAX82281.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  140 bits (340), Expect = 3e-33
 Identities = 64/68 (94%), Positives = 67/68 (98%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHT YNELRVAPEEHPVLLTEAPLNPKANRE++TQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTLYNELRVAPEEHPVLLTEAPLNPKANREEITQIMFETFNTPAMYVAIQAVLSLY 60

Query: 486 ASGRTTGM 509
           ASGRTTG+
Sbjct: 61  ASGRTTGI 68



 Score = 74.9 bits (176), Expect = 2e-13
 Identities = 33/35 (94%), Positives = 35/35 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 69  VMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970455-1|AAX82262.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  140 bits (340), Expect = 3e-33
 Identities = 64/68 (94%), Positives = 66/68 (97%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIMFETFNTPAM VAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMCVAIQAVLSLY 60

Query: 486 ASGRTTGM 509
            SGRTTG+
Sbjct: 61  TSGRTTGI 68



 Score = 67.7 bits (158), Expect = 3e-11
 Identities = 30/35 (85%), Positives = 33/35 (94%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DSGDGV+HTVPIYEG ALPHA LRLDLAGR+LT
Sbjct: 69  VMDSGDGVTHTVPIYEGNALPHATLRLDLAGRELT 103


>AY970483-1|AAX82289.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  140 bits (339), Expect = 4e-33
 Identities = 64/68 (94%), Positives = 66/68 (97%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           +IWHHTFYNELRVAPEEHPVLLTEA LNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   RIWHHTFYNELRVAPEEHPVLLTEATLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 486 ASGRTTGM 509
            SGRTTG+
Sbjct: 61  TSGRTTGI 68



 Score = 74.9 bits (176), Expect = 2e-13
 Identities = 33/35 (94%), Positives = 35/35 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 69  VMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970432-1|AAX82241.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  140 bits (339), Expect = 4e-33
 Identities = 63/68 (92%), Positives = 65/68 (95%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKAN EKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANHEKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 486 ASGRTTGM 509
            SG TTG+
Sbjct: 61  TSGHTTGI 68



 Score = 68.5 bits (160), Expect = 2e-11
 Identities = 30/35 (85%), Positives = 33/35 (94%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DSGDGV+HTVPIYEG ALPHA LRLDLAGRD+T
Sbjct: 69  VMDSGDGVTHTVPIYEGNALPHATLRLDLAGRDMT 103


>AY970407-1|AAX82216.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  139 bits (337), Expect = 7e-33
 Identities = 65/68 (95%), Positives = 66/68 (97%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHT YNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAM VAIQAVLSLY
Sbjct: 1   KIWHHTSYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMCVAIQAVLSLY 60

Query: 486 ASGRTTGM 509
           ASGRTTG+
Sbjct: 61  ASGRTTGI 68



 Score = 73.7 bits (173), Expect = 5e-13
 Identities = 32/35 (91%), Positives = 35/35 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           ++DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 69  LMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970461-1|AAX82268.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  139 bits (336), Expect = 9e-33
 Identities = 64/68 (94%), Positives = 65/68 (95%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHT YNELRVAPEEHPVLLTEA LNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTLYNELRVAPEEHPVLLTEATLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 486 ASGRTTGM 509
            SGRTTG+
Sbjct: 61  TSGRTTGI 68



 Score = 64.5 bits (150), Expect = 3e-10
 Identities = 28/34 (82%), Positives = 32/34 (94%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDL 610
           V+DSGDGV+HTVPIY+G ALPHA LRLDLAGR+L
Sbjct: 69  VMDSGDGVTHTVPIYDGNALPHATLRLDLAGREL 102


>AY970451-1|AAX82259.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  138 bits (334), Expect = 2e-32
 Identities = 62/68 (91%), Positives = 66/68 (97%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIW+HTFYNELRVAP+EHP+LLTEAPLNPK NREKMTQIMFE FNTPAMYVAIQAVLSLY
Sbjct: 1   KIWYHTFYNELRVAPDEHPILLTEAPLNPKINREKMTQIMFEAFNTPAMYVAIQAVLSLY 60

Query: 486 ASGRTTGM 509
           ASGRTTG+
Sbjct: 61  ASGRTTGI 68



 Score = 68.1 bits (159), Expect = 3e-11
 Identities = 31/35 (88%), Positives = 33/35 (94%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DSGDGV+  VPIYEGYALPHAILRLDLAGRDLT
Sbjct: 69  VMDSGDGVTLIVPIYEGYALPHAILRLDLAGRDLT 103


>AY970384-1|AAX82193.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  138 bits (334), Expect = 2e-32
 Identities = 62/68 (91%), Positives = 66/68 (97%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIW+HTFYNELRVAP+EHP+LLTEAPLNPK NREKMTQIMFE FNTPAMYVAIQAVLSLY
Sbjct: 1   KIWYHTFYNELRVAPDEHPILLTEAPLNPKINREKMTQIMFEAFNTPAMYVAIQAVLSLY 60

Query: 486 ASGRTTGM 509
           ASGRTTG+
Sbjct: 61  ASGRTTGI 68



 Score = 74.9 bits (176), Expect = 2e-13
 Identities = 33/35 (94%), Positives = 35/35 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLT
Sbjct: 69  VMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLT 103


>AY970424-1|AAX82233.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  137 bits (332), Expect = 3e-32
 Identities = 62/68 (91%), Positives = 67/68 (98%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFYNELRVAP++HPVLLT+APLNPKANREKMTQIMFETFNT AMYVAIQA+LSLY
Sbjct: 1   KIWHHTFYNELRVAPKQHPVLLTKAPLNPKANREKMTQIMFETFNTAAMYVAIQALLSLY 60

Query: 486 ASGRTTGM 509
           ASGRTTG+
Sbjct: 61  ASGRTTGI 68



 Score = 61.7 bits (143), Expect = 2e-09
 Identities = 27/35 (77%), Positives = 31/35 (88%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           ++DSGD V+HTVP Y GYALPH+IL LDLAGRDLT
Sbjct: 69  MMDSGDEVTHTVPFYGGYALPHSILCLDLAGRDLT 103


>AY970427-1|AAX82236.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  137 bits (331), Expect = 4e-32
 Identities = 62/68 (91%), Positives = 65/68 (95%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIM ETFNTPAMYVA QA+LSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMSETFNTPAMYVANQAMLSLY 60

Query: 486 ASGRTTGM 509
            SGRTTG+
Sbjct: 61  TSGRTTGI 68



 Score = 64.5 bits (150), Expect = 3e-10
 Identities = 28/34 (82%), Positives = 32/34 (94%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDL 610
           V+DSGDGV+HTVPIY+G ALPHA LRLDLAGR+L
Sbjct: 69  VMDSGDGVTHTVPIYDGNALPHATLRLDLAGREL 102


>AY970452-1|AAX82260.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  136 bits (330), Expect = 5e-32
 Identities = 61/68 (89%), Positives = 65/68 (95%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIW+HTFYNELRVAP+EHP+LLTEAPLNPK NREKMTQIMFE FNTPAMY AIQAVLSLY
Sbjct: 1   KIWYHTFYNELRVAPDEHPILLTEAPLNPKINREKMTQIMFEAFNTPAMYAAIQAVLSLY 60

Query: 486 ASGRTTGM 509
           ASGRTTG+
Sbjct: 61  ASGRTTGI 68



 Score = 72.5 bits (170), Expect = 1e-12
 Identities = 32/35 (91%), Positives = 34/35 (97%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DSGDGV+H VPIYEGYALPHAILRLDLAGRDLT
Sbjct: 69  VMDSGDGVTHIVPIYEGYALPHAILRLDLAGRDLT 103


>AY970433-1|AAX82242.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  136 bits (328), Expect = 9e-32
 Identities = 61/68 (89%), Positives = 65/68 (95%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIW+HTFYNELRVAP+EHP+LLTEAPLNPK NREKM QIMFE FNTPAMYVAIQAVLSLY
Sbjct: 1   KIWYHTFYNELRVAPDEHPILLTEAPLNPKINREKMIQIMFEAFNTPAMYVAIQAVLSLY 60

Query: 486 ASGRTTGM 509
           ASGRTTG+
Sbjct: 61  ASGRTTGI 68



 Score = 72.5 bits (170), Expect = 1e-12
 Identities = 32/35 (91%), Positives = 34/35 (97%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DSGDGV+H VPIYEGYALPHAILRLDLAGRDLT
Sbjct: 69  VMDSGDGVTHIVPIYEGYALPHAILRLDLAGRDLT 103


>AY970447-1|AAX82256.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  135 bits (326), Expect = 2e-31
 Identities = 61/68 (89%), Positives = 64/68 (94%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMTQIM E F+ PAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMLEIFDRPAMYVAIQAVLSLY 60

Query: 486 ASGRTTGM 509
            SGRTTG+
Sbjct: 61  TSGRTTGI 68



 Score = 67.7 bits (158), Expect = 3e-11
 Identities = 30/35 (85%), Positives = 33/35 (94%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DSGDGV+HTVPIYEG ALPHA LRLDLAG+DLT
Sbjct: 69  VMDSGDGVTHTVPIYEGNALPHATLRLDLAGQDLT 103


>AY970425-1|AAX82234.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  134 bits (324), Expect = 3e-31
 Identities = 61/68 (89%), Positives = 65/68 (95%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFYNEL VA +EHP+LLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQA+LSLY
Sbjct: 1   KIWHHTFYNELCVAAKEHPMLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAMLSLY 60

Query: 486 ASGRTTGM 509
            SGRTTG+
Sbjct: 61  TSGRTTGI 68



 Score = 63.7 bits (148), Expect = 6e-10
 Identities = 28/35 (80%), Positives = 33/35 (94%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DSGDGV+HTVPIY+G ALPHAILR+ LAG+DLT
Sbjct: 69  VMDSGDGVTHTVPIYDGNALPHAILRVCLAGQDLT 103


>AY970481-1|AAX82287.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  132 bits (320), Expect = 8e-31
 Identities = 61/66 (92%), Positives = 62/66 (93%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIM E F+ PAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMLEIFDRPAMYVAIQAVLSLY 60

Query: 486 ASGRTT 503
            SGRTT
Sbjct: 61  TSGRTT 66



 Score = 60.1 bits (139), Expect = 7e-09
 Identities = 27/35 (77%), Positives = 31/35 (88%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+D  DGV+HTVPIYE YALPHAILR+ LAG+DLT
Sbjct: 69  VMDYDDGVTHTVPIYEEYALPHAILRVCLAGQDLT 103


>AY970459-1|AAX82266.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  132 bits (320), Expect = 8e-31
 Identities = 59/68 (86%), Positives = 66/68 (97%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHH F+NELRVAP++HP+LLT+APL+PKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHIFHNELRVAPKQHPMLLTKAPLDPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 486 ASGRTTGM 509
            SGRTTG+
Sbjct: 61  TSGRTTGI 68



 Score = 67.7 bits (158), Expect = 3e-11
 Identities = 30/35 (85%), Positives = 33/35 (94%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DSGDGV+HTVPIYEG ALPHA LRLDLAGR+LT
Sbjct: 69  VMDSGDGVTHTVPIYEGNALPHATLRLDLAGRELT 103


>AY970398-1|AAX82207.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  131 bits (316), Expect = 2e-30
 Identities = 59/68 (86%), Positives = 65/68 (95%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHH F+NELRVAP++HPVLLT+APLNPKANREKMT IMFETFNT AMYVAIQA+LSLY
Sbjct: 1   KIWHHIFHNELRVAPKQHPVLLTKAPLNPKANREKMTHIMFETFNTAAMYVAIQALLSLY 60

Query: 486 ASGRTTGM 509
           ASGRTTG+
Sbjct: 61  ASGRTTGI 68



 Score = 62.9 bits (146), Expect = 1e-09
 Identities = 28/35 (80%), Positives = 31/35 (88%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           ++DSGD V+HTVP Y GYALPHAIL LDLAGRDLT
Sbjct: 69  MMDSGDEVTHTVPFYGGYALPHAILCLDLAGRDLT 103


>AL160004-5|CAI19052.1|  342|Homo sapiens actin, alpha 1, skeletal
           muscle protein.
          Length = 342

 Score =  131 bits (316), Expect = 2e-30
 Identities = 63/72 (87%), Positives = 64/72 (88%), Gaps = 1/72 (1%)
 Frame = +1

Query: 55  MCDE-EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 231
           MCDE E  ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
Sbjct: 1   MCDEDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 232 QSKRGILTSNTP 267
           QSKRGILT   P
Sbjct: 61  QSKRGILTLKYP 72



 Score = 95.5 bits (227), Expect = 1e-19
 Identities = 43/46 (93%), Positives = 45/46 (97%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGV+H VPIYEGYALPHAI+RLDLAGRDLTDYLMKILTERG
Sbjct: 119 VLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERG 164



 Score = 78.6 bits (185), Expect = 2e-14
 Identities = 37/39 (94%), Positives = 38/39 (97%)
 Frame = +3

Query: 393 KANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGM 509
           KANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTG+
Sbjct: 80  KANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGI 118



 Score = 31.1 bits (67), Expect = 3.6
 Identities = 15/26 (57%), Positives = 18/26 (69%), Gaps = 2/26 (7%)
 Frame = +3

Query: 255 LKYPIEHGIVT--NWDDMEKIWHHTF 326
           LKYPIEHGI+T  N + M +I   TF
Sbjct: 69  LKYPIEHGIITKANREKMTQIMFETF 94


>AL160004-4|CAI19051.1|  287|Homo sapiens actin, alpha 1, skeletal
           muscle protein.
          Length = 287

 Score =  131 bits (316), Expect = 2e-30
 Identities = 63/72 (87%), Positives = 64/72 (88%), Gaps = 1/72 (1%)
 Frame = +1

Query: 55  MCDE-EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 231
           MCDE E  ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
Sbjct: 1   MCDEDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA 60

Query: 232 QSKRGILTSNTP 267
           QSKRGILT   P
Sbjct: 61  QSKRGILTLKYP 72



 Score =  118 bits (283), Expect = 2e-26
 Identities = 50/56 (89%), Positives = 52/56 (92%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQI 422
           LKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHP LLTEAPLNPKANRE +  I
Sbjct: 69  LKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREIVRDI 124


>AY970400-1|AAX82209.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  129 bits (311), Expect = 1e-29
 Identities = 58/68 (85%), Positives = 64/68 (94%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFYNELRVAPEE P+LL EAPLNPKAN +KMTQI+FETFNTPAMY+AIQ +LSLY
Sbjct: 1   KIWHHTFYNELRVAPEEQPMLLIEAPLNPKANCKKMTQIIFETFNTPAMYLAIQTMLSLY 60

Query: 486 ASGRTTGM 509
           ASGRTTG+
Sbjct: 61  ASGRTTGI 68



 Score = 62.5 bits (145), Expect = 1e-09
 Identities = 29/35 (82%), Positives = 30/35 (85%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           VLDS DGV+HTVPIYEGYALP AIL LDLAG D T
Sbjct: 69  VLDSSDGVTHTVPIYEGYALPQAILHLDLAGWDRT 103


>AY970396-1|AAX82205.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  129 bits (311), Expect = 1e-29
 Identities = 58/68 (85%), Positives = 64/68 (94%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFYN+L VAPEE+ VL+T+APLNPKANREKMTQIMFE FNTPAMY+AIQAVLSLY
Sbjct: 1   KIWHHTFYNKLHVAPEEYLVLMTKAPLNPKANREKMTQIMFEVFNTPAMYMAIQAVLSLY 60

Query: 486 ASGRTTGM 509
            SGRTTG+
Sbjct: 61  TSGRTTGI 68



 Score = 65.3 bits (152), Expect = 2e-10
 Identities = 29/35 (82%), Positives = 31/35 (88%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+D GDGV+HTVPIYEGY LPHAIL LDLAG DLT
Sbjct: 69  VMDFGDGVAHTVPIYEGYPLPHAILHLDLAGWDLT 103


>AY970448-1|AAX82257.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  128 bits (310), Expect = 1e-29
 Identities = 58/68 (85%), Positives = 61/68 (89%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFY E+RV PEEHPVL+TEA LNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYKEVRVVPEEHPVLVTEATLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 60

Query: 486 ASGRTTGM 509
             GR  G+
Sbjct: 61  TFGRNNGI 68



 Score = 66.5 bits (155), Expect = 8e-11
 Identities = 29/35 (82%), Positives = 33/35 (94%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DSGDGV+HTVPIY+G ALPHA LRLDLAGR+LT
Sbjct: 69  VMDSGDGVTHTVPIYDGNALPHATLRLDLAGRELT 103


>AY970467-1|AAX82273.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  127 bits (307), Expect = 3e-29
 Identities = 57/68 (83%), Positives = 64/68 (94%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFYNELRVAPEE P+LL EAPLNP+AN +KMTQI+FETFNTPAMY+AIQ +LSLY
Sbjct: 1   KIWHHTFYNELRVAPEEQPMLLFEAPLNPRANCKKMTQIIFETFNTPAMYLAIQTMLSLY 60

Query: 486 ASGRTTGM 509
           ASGRTTG+
Sbjct: 61  ASGRTTGI 68



 Score = 67.7 bits (158), Expect = 3e-11
 Identities = 31/35 (88%), Positives = 33/35 (94%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           VLDS DGV+HTVPIYEGYALP+AIL LDLAGRDLT
Sbjct: 69  VLDSSDGVTHTVPIYEGYALPNAILLLDLAGRDLT 103


>AY970422-1|AAX82231.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  127 bits (307), Expect = 3e-29
 Identities = 57/68 (83%), Positives = 64/68 (94%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFYNELRVAPEE P+LL EAPLNP+AN +KMTQI+FETFNTPAMY+AIQ +LSLY
Sbjct: 1   KIWHHTFYNELRVAPEEQPMLLFEAPLNPRANCKKMTQIIFETFNTPAMYLAIQTMLSLY 60

Query: 486 ASGRTTGM 509
           ASGRTTG+
Sbjct: 61  ASGRTTGI 68



 Score = 68.1 bits (159), Expect = 3e-11
 Identities = 31/35 (88%), Positives = 32/35 (91%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V DS DGV+HTVPIYEGYALPHAIL LDLAGRDLT
Sbjct: 69  VSDSSDGVTHTVPIYEGYALPHAILLLDLAGRDLT 103


>AY970401-1|AAX82210.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  127 bits (307), Expect = 3e-29
 Identities = 57/68 (83%), Positives = 64/68 (94%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFYNELRVAPEE P+LL EAPLNP+AN +KMTQI+FETFNTPAMY+AIQ +LSLY
Sbjct: 1   KIWHHTFYNELRVAPEEQPMLLFEAPLNPRANCKKMTQIIFETFNTPAMYLAIQTMLSLY 60

Query: 486 ASGRTTGM 509
           ASGRTTG+
Sbjct: 61  ASGRTTGI 68



 Score = 67.7 bits (158), Expect = 3e-11
 Identities = 31/35 (88%), Positives = 33/35 (94%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           VLDS DGV+HTVPIYEGYALP+AIL LDLAGRDLT
Sbjct: 69  VLDSSDGVTHTVPIYEGYALPNAILLLDLAGRDLT 103


>AY970445-1|AAX82254.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  126 bits (305), Expect = 5e-29
 Identities = 57/68 (83%), Positives = 64/68 (94%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHH F+NELRVAP++HPVLLT+APLNP+ANREKMT IMFETF T AMYVAIQA+LSLY
Sbjct: 1   KIWHHIFHNELRVAPKQHPVLLTKAPLNPRANREKMTHIMFETFYTAAMYVAIQALLSLY 60

Query: 486 ASGRTTGM 509
           ASGRTTG+
Sbjct: 61  ASGRTTGI 68



 Score = 59.7 bits (138), Expect = 9e-09
 Identities = 27/35 (77%), Positives = 30/35 (85%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           ++DSGD V+HTV  Y GYALPHAIL LDLAGRDLT
Sbjct: 69  MMDSGDEVTHTVAFYGGYALPHAILCLDLAGRDLT 103


>AY970423-1|AAX82232.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  126 bits (303), Expect = 9e-29
 Identities = 56/68 (82%), Positives = 64/68 (94%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           +IWHHTFYNELRVAPEE P+LL EAPLNP+AN +KMTQI+FETFNTPAMY+AIQ +LSLY
Sbjct: 1   EIWHHTFYNELRVAPEEQPMLLFEAPLNPRANCKKMTQIIFETFNTPAMYLAIQTMLSLY 60

Query: 486 ASGRTTGM 509
           ASGRTTG+
Sbjct: 61  ASGRTTGI 68



 Score = 67.7 bits (158), Expect = 3e-11
 Identities = 31/35 (88%), Positives = 33/35 (94%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           VLDS DGV+HTVPIYEGYALP+AIL LDLAGRDLT
Sbjct: 69  VLDSSDGVTHTVPIYEGYALPNAILLLDLAGRDLT 103


>Z14978-1|CAA78701.1|  376|Homo sapiens actin-related protein
           protein.
          Length = 376

 Score =  125 bits (302), Expect = 1e-28
 Identities = 52/96 (54%), Positives = 76/96 (79%), Gaps = 1/96 (1%)
 Frame = +3

Query: 225 RGTEQKRYPDLKYPIEHGIVTNWDDMEKIWHHTFY-NELRVAPEEHPVLLTEAPLNPKAN 401
           +  E +    ++YP+EHGIV +W+DME+IW + +  ++L+   EEHPVLLTEAPLNP+ N
Sbjct: 61  KAEEHRGLLSIRYPMEHGIVKDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPRKN 120

Query: 402 REKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGM 509
           RE+  ++ FETFN PA+++++QAVLSLYA+GRTTG+
Sbjct: 121 RERAAEVFFETFNVPALFISMQAVLSLYATGRTTGV 156



 Score = 72.9 bits (171), Expect = 9e-13
 Identities = 31/63 (49%), Positives = 44/63 (69%)
 Frame = +1

Query: 79  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTS 258
           +V+DNGSG+ KAGFAGD  P+  FP+ VGRP+H  VM G  + D ++G +A+  RG+L+ 
Sbjct: 12  VVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHVRVMAGALEGDIFIGPKAEEHRGLLSI 71

Query: 259 NTP 267
             P
Sbjct: 72  RYP 74



 Score = 69.3 bits (162), Expect = 1e-11
 Identities = 28/46 (60%), Positives = 39/46 (84%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGV+H VPIYEG+A+PH+I+R+D+AGRD++ +L   L + G
Sbjct: 157 VLDSGDGVTHAVPIYEGFAMPHSIMRIDIAGRDVSRFLRLYLRKEG 202


>X82206-1|CAA57690.1|  376|Homo sapiens alpha-centractin protein.
          Length = 376

 Score =  125 bits (302), Expect = 1e-28
 Identities = 52/96 (54%), Positives = 76/96 (79%), Gaps = 1/96 (1%)
 Frame = +3

Query: 225 RGTEQKRYPDLKYPIEHGIVTNWDDMEKIWHHTFY-NELRVAPEEHPVLLTEAPLNPKAN 401
           +  E +    ++YP+EHGIV +W+DME+IW + +  ++L+   EEHPVLLTEAPLNP+ N
Sbjct: 61  KAEEHRGLLSIRYPMEHGIVKDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPRKN 120

Query: 402 REKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGM 509
           RE+  ++ FETFN PA+++++QAVLSLYA+GRTTG+
Sbjct: 121 RERAAEVFFETFNVPALFISMQAVLSLYATGRTTGV 156



 Score = 72.9 bits (171), Expect = 9e-13
 Identities = 31/63 (49%), Positives = 44/63 (69%)
 Frame = +1

Query: 79  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTS 258
           +V+DNGSG+ KAGFAGD  P+  FP+ VGRP+H  VM G  + D ++G +A+  RG+L+ 
Sbjct: 12  VVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHVRVMAGALEGDIFIGPKAEEHRGLLSI 71

Query: 259 NTP 267
             P
Sbjct: 72  RYP 74



 Score = 69.3 bits (162), Expect = 1e-11
 Identities = 28/46 (60%), Positives = 39/46 (84%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGV+H VPIYEG+A+PH+I+R+D+AGRD++ +L   L + G
Sbjct: 157 VLDSGDGVTHAVPIYEGFAMPHSIMRIDIAGRDVSRFLRLYLRKEG 202


>BC026016-1|AAH26016.1|  376|Homo sapiens ARP1 actin-related protein
           1 homolog A, centractin alpha (yeast) protein.
          Length = 376

 Score =  125 bits (302), Expect = 1e-28
 Identities = 52/96 (54%), Positives = 76/96 (79%), Gaps = 1/96 (1%)
 Frame = +3

Query: 225 RGTEQKRYPDLKYPIEHGIVTNWDDMEKIWHHTFY-NELRVAPEEHPVLLTEAPLNPKAN 401
           +  E +    ++YP+EHGIV +W+DME+IW + +  ++L+   EEHPVLLTEAPLNP+ N
Sbjct: 61  KAEEHRGLLSIRYPMEHGIVKDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPRKN 120

Query: 402 REKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGM 509
           RE+  ++ FETFN PA+++++QAVLSLYA+GRTTG+
Sbjct: 121 RERAAEVFFETFNVPALFISMQAVLSLYATGRTTGV 156



 Score = 72.9 bits (171), Expect = 9e-13
 Identities = 31/63 (49%), Positives = 44/63 (69%)
 Frame = +1

Query: 79  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTS 258
           +V+DNGSG+ KAGFAGD  P+  FP+ VGRP+H  VM G  + D ++G +A+  RG+L+ 
Sbjct: 12  VVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHVRVMAGALEGDIFIGPKAEEHRGLLSI 71

Query: 259 NTP 267
             P
Sbjct: 72  RYP 74



 Score = 69.3 bits (162), Expect = 1e-11
 Identities = 28/46 (60%), Positives = 39/46 (84%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGV+H VPIYEG+A+PH+I+R+D+AGRD++ +L   L + G
Sbjct: 157 VLDSGDGVTHAVPIYEGFAMPHSIMRIDIAGRDVSRFLRLYLRKEG 202


>BC000693-1|AAH00693.1|  376|Homo sapiens ARP1 actin-related protein
           1 homolog A, centractin alpha (yeast) protein.
          Length = 376

 Score =  125 bits (302), Expect = 1e-28
 Identities = 52/96 (54%), Positives = 76/96 (79%), Gaps = 1/96 (1%)
 Frame = +3

Query: 225 RGTEQKRYPDLKYPIEHGIVTNWDDMEKIWHHTFY-NELRVAPEEHPVLLTEAPLNPKAN 401
           +  E +    ++YP+EHGIV +W+DME+IW + +  ++L+   EEHPVLLTEAPLNP+ N
Sbjct: 61  KAEEHRGLLSIRYPMEHGIVKDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPRKN 120

Query: 402 REKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGM 509
           RE+  ++ FETFN PA+++++QAVLSLYA+GRTTG+
Sbjct: 121 RERAAEVFFETFNVPALFISMQAVLSLYATGRTTGV 156



 Score = 72.9 bits (171), Expect = 9e-13
 Identities = 31/63 (49%), Positives = 44/63 (69%)
 Frame = +1

Query: 79  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTS 258
           +V+DNGSG+ KAGFAGD  P+  FP+ VGRP+H  VM G  + D ++G +A+  RG+L+ 
Sbjct: 12  VVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHVRVMAGALEGDIFIGPKAEEHRGLLSI 71

Query: 259 NTP 267
             P
Sbjct: 72  RYP 74



 Score = 69.3 bits (162), Expect = 1e-11
 Identities = 28/46 (60%), Positives = 39/46 (84%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGV+H VPIYEG+A+PH+I+R+D+AGRD++ +L   L + G
Sbjct: 157 VLDSGDGVTHAVPIYEGFAMPHSIMRIDIAGRDVSRFLRLYLRKEG 202


>AL121928-12|CAC08404.1|  376|Homo sapiens ARP1 actin-related
           protein 1 homolog A, centractin alpha (yeast) protein.
          Length = 376

 Score =  125 bits (302), Expect = 1e-28
 Identities = 52/96 (54%), Positives = 76/96 (79%), Gaps = 1/96 (1%)
 Frame = +3

Query: 225 RGTEQKRYPDLKYPIEHGIVTNWDDMEKIWHHTFY-NELRVAPEEHPVLLTEAPLNPKAN 401
           +  E +    ++YP+EHGIV +W+DME+IW + +  ++L+   EEHPVLLTEAPLNP+ N
Sbjct: 61  KAEEHRGLLSIRYPMEHGIVKDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPRKN 120

Query: 402 REKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGM 509
           RE+  ++ FETFN PA+++++QAVLSLYA+GRTTG+
Sbjct: 121 RERAAEVFFETFNVPALFISMQAVLSLYATGRTTGV 156



 Score = 72.9 bits (171), Expect = 9e-13
 Identities = 31/63 (49%), Positives = 44/63 (69%)
 Frame = +1

Query: 79  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTS 258
           +V+DNGSG+ KAGFAGD  P+  FP+ VGRP+H  VM G  + D ++G +A+  RG+L+ 
Sbjct: 12  VVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHVRVMAGALEGDIFIGPKAEEHRGLLSI 71

Query: 259 NTP 267
             P
Sbjct: 72  RYP 74



 Score = 69.3 bits (162), Expect = 1e-11
 Identities = 28/46 (60%), Positives = 39/46 (84%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGV+H VPIYEG+A+PH+I+R+D+AGRD++ +L   L + G
Sbjct: 157 VLDSGDGVTHAVPIYEGFAMPHSIMRIDIAGRDVSRFLRLYLRKEG 202


>X82208-1|CAA57692.1|  329|Homo sapiens beta-centractin protein.
          Length = 329

 Score =  125 bits (301), Expect = 2e-28
 Identities = 52/96 (54%), Positives = 75/96 (78%), Gaps = 1/96 (1%)
 Frame = +3

Query: 225 RGTEQKRYPDLKYPIEHGIVTNWDDMEKIWHHTFY-NELRVAPEEHPVLLTEAPLNPKAN 401
           +  E +    ++YP+EHG+V +W+DME+IW + +  ++L+   EEHPVLLTEAPLNP  N
Sbjct: 31  KAEEHRGLLTIRYPMEHGVVRDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPSKN 90

Query: 402 REKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGM 509
           REK  ++ FETFN PA+++++QAVLSLYA+GRTTG+
Sbjct: 91  REKAAEVFFETFNVPALFISMQAVLSLYATGRTTGV 126



 Score = 71.7 bits (168), Expect = 2e-12
 Identities = 29/46 (63%), Positives = 40/46 (86%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGV+H VPIYEG+A+PH+I+R+D+AGRD++ YL  +L + G
Sbjct: 127 VLDSGDGVTHAVPIYEGFAMPHSIMRVDIAGRDVSRYLRLLLRKEG 172



 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 19/44 (43%), Positives = 28/44 (63%)
 Frame = +1

Query: 136 PRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTSNTP 267
           P+  FP+ VGRP+H  VM G  + D ++G +A+  RG+LT   P
Sbjct: 1   PKYCFPNYVGRPKHMRVMAGALEGDLFIGPKAEEHRGLLTIRYP 44


>X82207-1|CAA57691.1|  376|Homo sapiens beta-centracetin protein.
          Length = 376

 Score =  125 bits (301), Expect = 2e-28
 Identities = 52/96 (54%), Positives = 75/96 (78%), Gaps = 1/96 (1%)
 Frame = +3

Query: 225 RGTEQKRYPDLKYPIEHGIVTNWDDMEKIWHHTFY-NELRVAPEEHPVLLTEAPLNPKAN 401
           +  E +    ++YP+EHG+V +W+DME+IW + +  ++L+   EEHPVLLTEAPLNP  N
Sbjct: 61  KAEEHRGLLTIRYPMEHGVVRDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPSKN 120

Query: 402 REKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGM 509
           REK  ++ FETFN PA+++++QAVLSLYA+GRTTG+
Sbjct: 121 REKAAEVFFETFNVPALFISMQAVLSLYATGRTTGV 156



 Score = 75.4 bits (177), Expect = 2e-13
 Identities = 32/63 (50%), Positives = 44/63 (69%)
 Frame = +1

Query: 79  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTS 258
           +V+DNGSG+ KAGFAGD  P+  FP+ VGRP+H  VM G  + D ++G +A+  RG+LT 
Sbjct: 12  VVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHMRVMAGALEGDLFIGPKAEEHRGLLTI 71

Query: 259 NTP 267
             P
Sbjct: 72  RYP 74



 Score = 71.7 bits (168), Expect = 2e-12
 Identities = 29/46 (63%), Positives = 40/46 (86%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGV+H VPIYEG+A+PH+I+R+D+AGRD++ YL  +L + G
Sbjct: 157 VLDSGDGVTHAVPIYEGFAMPHSIMRVDIAGRDVSRYLRLLLRKEG 202


>BC010090-1|AAH10090.1|  376|Homo sapiens ARP1 actin-related protein
           1 homolog B, centractin beta (yeast) protein.
          Length = 376

 Score =  125 bits (301), Expect = 2e-28
 Identities = 52/96 (54%), Positives = 75/96 (78%), Gaps = 1/96 (1%)
 Frame = +3

Query: 225 RGTEQKRYPDLKYPIEHGIVTNWDDMEKIWHHTFY-NELRVAPEEHPVLLTEAPLNPKAN 401
           +  E +    ++YP+EHG+V +W+DME+IW + +  ++L+   EEHPVLLTEAPLNP  N
Sbjct: 61  KAEEHRGLLTIRYPMEHGVVRDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPSKN 120

Query: 402 REKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGM 509
           REK  ++ FETFN PA+++++QAVLSLYA+GRTTG+
Sbjct: 121 REKAAEVFFETFNVPALFISMQAVLSLYATGRTTGV 156



 Score = 75.4 bits (177), Expect = 2e-13
 Identities = 32/63 (50%), Positives = 44/63 (69%)
 Frame = +1

Query: 79  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTS 258
           +V+DNGSG+ KAGFAGD  P+  FP+ VGRP+H  VM G  + D ++G +A+  RG+LT 
Sbjct: 12  VVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHMRVMAGALEGDLFIGPKAEEHRGLLTI 71

Query: 259 NTP 267
             P
Sbjct: 72  RYP 74



 Score = 71.7 bits (168), Expect = 2e-12
 Identities = 29/46 (63%), Positives = 40/46 (86%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGV+H VPIYEG+A+PH+I+R+D+AGRD++ YL  +L + G
Sbjct: 157 VLDSGDGVTHAVPIYEGFAMPHSIMRVDIAGRDVSRYLRLLLRKEG 202


>BC006372-1|AAH06372.1|  376|Homo sapiens ARP1 actin-related protein
           1 homolog B, centractin beta (yeast) protein.
          Length = 376

 Score =  125 bits (301), Expect = 2e-28
 Identities = 52/96 (54%), Positives = 75/96 (78%), Gaps = 1/96 (1%)
 Frame = +3

Query: 225 RGTEQKRYPDLKYPIEHGIVTNWDDMEKIWHHTFY-NELRVAPEEHPVLLTEAPLNPKAN 401
           +  E +    ++YP+EHG+V +W+DME+IW + +  ++L+   EEHPVLLTEAPLNP  N
Sbjct: 61  KAEEHRGLLTIRYPMEHGVVRDWNDMERIWQYAYSKDQLQTFSEEHPVLLTEAPLNPSKN 120

Query: 402 REKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGM 509
           REK  ++ FETFN PA+++++QAVLSLYA+GRTTG+
Sbjct: 121 REKAAEVFFETFNVPALFISMQAVLSLYATGRTTGV 156



 Score = 75.4 bits (177), Expect = 2e-13
 Identities = 32/63 (50%), Positives = 44/63 (69%)
 Frame = +1

Query: 79  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTS 258
           +V+DNGSG+ KAGFAGD  P+  FP+ VGRP+H  VM G  + D ++G +A+  RG+LT 
Sbjct: 12  VVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHMRVMAGALEGDLFIGPKAEEHRGLLTI 71

Query: 259 NTP 267
             P
Sbjct: 72  RYP 74



 Score = 71.7 bits (168), Expect = 2e-12
 Identities = 29/46 (63%), Positives = 40/46 (86%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGV+H VPIYEG+A+PH+I+R+D+AGRD++ YL  +L + G
Sbjct: 157 VLDSGDGVTHAVPIYEGFAMPHSIMRVDIAGRDVSRYLRLLLRKEG 202


>BC004374-1|AAH04374.1|  376|Homo sapiens ARP1 actin-related protein
           1 homolog B, centractin beta (yeast) protein.
          Length = 376

 Score =  125 bits (301), Expect = 2e-28
 Identities = 52/96 (54%), Positives = 75/96 (78%), Gaps = 1/96 (1%)
 Frame = +3

Query: 225 RGTEQKRYPDLKYPIEHGIVTNWDDMEKIWHHTFY-NELRVAPEEHPVLLTEAPLNPKAN 401
           +  E +    ++YP+EHG+V +W+DME+IW + +  ++L+   EEHPVLLTEAPLNP  N
Sbjct: 61  KAEEHRGLLTIRYPMEHGVVRDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPSKN 120

Query: 402 REKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGM 509
           REK  ++ FETFN PA+++++QAVLSLYA+GRTTG+
Sbjct: 121 REKAAEVFFETFNVPALFISMQAVLSLYATGRTTGV 156



 Score = 75.4 bits (177), Expect = 2e-13
 Identities = 32/63 (50%), Positives = 44/63 (69%)
 Frame = +1

Query: 79  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTS 258
           +V+DNGSG+ KAGFAGD  P+  FP+ VGRP+H  VM G  + D ++G +A+  RG+LT 
Sbjct: 12  VVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHMRVMAGALEGDLFIGPKAEEHRGLLTI 71

Query: 259 NTP 267
             P
Sbjct: 72  RYP 74



 Score = 71.7 bits (168), Expect = 2e-12
 Identities = 29/46 (63%), Positives = 40/46 (86%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGV+H VPIYEG+A+PH+I+R+D+AGRD++ YL  +L + G
Sbjct: 157 VLDSGDGVTHAVPIYEGFAMPHSIMRVDIAGRDVSRYLRLLLRKEG 202


>AC017099-2|AAY24280.1|  376|Homo sapiens unknown protein.
          Length = 376

 Score =  125 bits (301), Expect = 2e-28
 Identities = 52/96 (54%), Positives = 75/96 (78%), Gaps = 1/96 (1%)
 Frame = +3

Query: 225 RGTEQKRYPDLKYPIEHGIVTNWDDMEKIWHHTFY-NELRVAPEEHPVLLTEAPLNPKAN 401
           +  E +    ++YP+EHG+V +W+DME+IW + +  ++L+   EEHPVLLTEAPLNP  N
Sbjct: 61  KAEEHRGLLTIRYPMEHGVVRDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPSKN 120

Query: 402 REKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGM 509
           REK  ++ FETFN PA+++++QAVLSLYA+GRTTG+
Sbjct: 121 REKAAEVFFETFNVPALFISMQAVLSLYATGRTTGV 156



 Score = 75.4 bits (177), Expect = 2e-13
 Identities = 32/63 (50%), Positives = 44/63 (69%)
 Frame = +1

Query: 79  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTS 258
           +V+DNGSG+ KAGFAGD  P+  FP+ VGRP+H  VM G  + D ++G +A+  RG+LT 
Sbjct: 12  VVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHMRVMAGALEGDLFIGPKAEEHRGLLTI 71

Query: 259 NTP 267
             P
Sbjct: 72  RYP 74



 Score = 71.7 bits (168), Expect = 2e-12
 Identities = 29/46 (63%), Positives = 40/46 (86%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGV+H VPIYEG+A+PH+I+R+D+AGRD++ YL  +L + G
Sbjct: 157 VLDSGDGVTHAVPIYEGFAMPHSIMRVDIAGRDVSRYLRLLLRKEG 202


>AY970395-1|AAX82204.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  124 bits (299), Expect = 3e-28
 Identities = 57/68 (83%), Positives = 63/68 (92%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHH FYN LRVAPEE  VLLTEAPLNP+ANREKMTQIMF+TFNTPAMYVAIQAVL+L+
Sbjct: 1   KIWHHVFYNVLRVAPEEQVVLLTEAPLNPRANREKMTQIMFKTFNTPAMYVAIQAVLTLH 60

Query: 486 ASGRTTGM 509
           +SG TTG+
Sbjct: 61  SSGCTTGI 68



 Score = 62.1 bits (144), Expect = 2e-09
 Identities = 27/35 (77%), Positives = 31/35 (88%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DSGDGV+HTVPIYE + LPH IL LDLAG+DLT
Sbjct: 69  VMDSGDGVTHTVPIYERHHLPHTILHLDLAGQDLT 103


>AY970438-1|AAX82247.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  121 bits (292), Expect = 2e-27
 Identities = 57/68 (83%), Positives = 62/68 (91%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIW H FYNEL VAPEE  VLLTEAPLNP+ANREKMTQIMF+TFNTPAMYVAIQAVLSL+
Sbjct: 1   KIWDHVFYNELWVAPEEQVVLLTEAPLNPRANREKMTQIMFKTFNTPAMYVAIQAVLSLH 60

Query: 486 ASGRTTGM 509
           +SG TTG+
Sbjct: 61  SSGCTTGI 68



 Score = 62.9 bits (146), Expect = 1e-09
 Identities = 27/35 (77%), Positives = 31/35 (88%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DSGDGV+HTVPIYE + LPH IL LDLAG+DLT
Sbjct: 69  VMDSGDGVTHTVPIYERHTLPHTILHLDLAGQDLT 103


>AY970379-1|AAX82188.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  121 bits (292), Expect = 2e-27
 Identities = 54/68 (79%), Positives = 61/68 (89%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFYNEL VAP+EH +LLTE PLNPKAN +KMTQIMFETFNTPA+Y+AIQA+LSLY
Sbjct: 1   KIWHHTFYNELHVAPKEHRMLLTEVPLNPKANHKKMTQIMFETFNTPAVYMAIQAMLSLY 60

Query: 486 ASGRTTGM 509
             G TTG+
Sbjct: 61  TYGCTTGI 68



 Score = 64.9 bits (151), Expect = 2e-10
 Identities = 29/35 (82%), Positives = 32/35 (91%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DS DGV+HTVPIYEGYALP AIL LD+AGRDLT
Sbjct: 69  VMDSSDGVTHTVPIYEGYALPRAILCLDVAGRDLT 103


>AY970503-1|AAX82309.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  121 bits (291), Expect = 3e-27
 Identities = 55/68 (80%), Positives = 61/68 (89%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFYNEL VA +EHP+LLT+ PL+PKANREKMTQIM E F+ PAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELCVAAKEHPMLLTKVPLSPKANREKMTQIMLEIFDRPAMYVAIQAVLSLY 60

Query: 486 ASGRTTGM 509
            SGRTTG+
Sbjct: 61  TSGRTTGI 68



 Score = 60.1 bits (139), Expect = 7e-09
 Identities = 27/35 (77%), Positives = 31/35 (88%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+D  DGV+HTVPIYE YALPHAILR+ LAG+DLT
Sbjct: 69  VMDYDDGVTHTVPIYEEYALPHAILRVCLAGQDLT 103


>AY970465-1|AAX82272.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  121 bits (291), Expect = 3e-27
 Identities = 61/70 (87%), Positives = 64/70 (91%), Gaps = 2/70 (2%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETF-NTPAMYVAIQA-VLS 479
           KIWHHTFYNELRVAPEEHPVLLTEAPLNPKAN  KMTQI FETF NTPA+Y+AIQA VLS
Sbjct: 1   KIWHHTFYNELRVAPEEHPVLLTEAPLNPKAN-HKMTQITFETFSNTPAIYMAIQAVVLS 59

Query: 480 LYASGRTTGM 509
           LYASG TTG+
Sbjct: 60  LYASGLTTGI 69



 Score = 58.0 bits (134), Expect = 3e-08
 Identities = 28/35 (80%), Positives = 31/35 (88%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DSG+GV+HT  IYE YALPHAILRLDLAG DLT
Sbjct: 70  VMDSGNGVTHTA-IYEWYALPHAILRLDLAGLDLT 103


>AY970437-1|AAX82246.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  121 bits (291), Expect = 3e-27
 Identities = 58/68 (85%), Positives = 61/68 (89%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIW HTFYNEL VA EEHPVLL EA  NPKANREKMTQIMFETFN+PAMYVAIQ VLSLY
Sbjct: 1   KIWDHTFYNELCVALEEHPVLLIEACPNPKANREKMTQIMFETFNSPAMYVAIQPVLSLY 60

Query: 486 ASGRTTGM 509
           ASGRT+G+
Sbjct: 61  ASGRTSGI 68



 Score = 59.3 bits (137), Expect = 1e-08
 Identities = 28/35 (80%), Positives = 30/35 (85%), Gaps = 2/35 (5%)
 Frame = +2

Query: 509 VLDSGDGV--SHTVPIYEGYALPHAILRLDLAGRD 607
           V DSGDGV  +HTVPIY GYALPHA+L LDLAGRD
Sbjct: 69  VRDSGDGVRVTHTVPIYVGYALPHAVLHLDLAGRD 103


>AY970484-1|AAX82290.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  118 bits (284), Expect = 2e-26
 Identities = 53/68 (77%), Positives = 60/68 (88%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFYNEL VAP+EH +LLTE PLN KAN +KMTQIMFETFNTPA+Y+AIQA+LSLY
Sbjct: 1   KIWHHTFYNELHVAPKEHRMLLTEVPLNSKANHKKMTQIMFETFNTPAVYMAIQAMLSLY 60

Query: 486 ASGRTTGM 509
             G TTG+
Sbjct: 61  TYGCTTGI 68



 Score = 64.9 bits (151), Expect = 2e-10
 Identities = 29/35 (82%), Positives = 32/35 (91%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DS DGV+HTVPIYEGYALP AIL LD+AGRDLT
Sbjct: 69  VMDSSDGVTHTVPIYEGYALPRAILCLDVAGRDLT 103


>AY970394-1|AAX82203.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  118 bits (283), Expect = 2e-26
 Identities = 54/66 (81%), Positives = 59/66 (89%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFYNEL VA +EHP+LLT+APL+PKAN EKMTQIM E F+ PAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELCVAAKEHPMLLTKAPLSPKANHEKMTQIMLEIFSRPAMYVAIQAVLSLY 60

Query: 486 ASGRTT 503
            SGRTT
Sbjct: 61  TSGRTT 66



 Score = 59.7 bits (138), Expect = 9e-09
 Identities = 26/35 (74%), Positives = 30/35 (85%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+D  DGV+HTVPIY+G ALPHA LRLDL GR+LT
Sbjct: 69  VMDYDDGVTHTVPIYDGNALPHATLRLDLGGRELT 103


>AY970450-1|AAX82258.1|  102|Homo sapiens actin-like protein
           protein.
          Length = 102

 Score =  117 bits (281), Expect = 4e-26
 Identities = 53/68 (77%), Positives = 60/68 (88%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFYNEL VAP+EHPVLLT+ PLNPKAN EK+ QIMFETFN PAMY+AI  +LS+Y
Sbjct: 1   KIWHHTFYNEL-VAPKEHPVLLTKVPLNPKANHEKIAQIMFETFNIPAMYMAIWVMLSVY 59

Query: 486 ASGRTTGM 509
           ASG TTG+
Sbjct: 60  ASGHTTGI 67



 Score = 35.1 bits (77), Expect = 0.22
 Identities = 19/35 (54%), Positives = 24/35 (68%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DS    +++V I E YAL +AIL  DLA RDLT
Sbjct: 68  VMDSSGRFTYSVLISEDYALLYAILHPDLACRDLT 102


>AY970436-1|AAX82245.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  116 bits (280), Expect = 6e-26
 Identities = 55/68 (80%), Positives = 61/68 (89%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHH FYNEL VA EE  VLLTEAPLNP+ANREKMTQIMF+TFNT AMYVAIQAVL+L+
Sbjct: 1   KIWHHVFYNELCVALEEQVVLLTEAPLNPRANREKMTQIMFKTFNTQAMYVAIQAVLTLH 60

Query: 486 ASGRTTGM 509
           +SG TTG+
Sbjct: 61  SSGCTTGI 68



 Score = 62.9 bits (146), Expect = 1e-09
 Identities = 27/35 (77%), Positives = 31/35 (88%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DSGDGV+HTVPIYE + LPH IL LDLAG+DLT
Sbjct: 69  VMDSGDGVTHTVPIYERHTLPHTILHLDLAGQDLT 103


>AY970397-1|AAX82206.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  116 bits (279), Expect = 7e-26
 Identities = 54/68 (79%), Positives = 60/68 (88%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFYN+L VAPEE+ VL+T+APL  KANRE MTQIMFE FNT AMY+AIQAVLSLY
Sbjct: 1   KIWHHTFYNKLHVAPEEYLVLMTKAPLMTKANREMMTQIMFEVFNTLAMYMAIQAVLSLY 60

Query: 486 ASGRTTGM 509
            SGRTTG+
Sbjct: 61  TSGRTTGI 68



 Score = 66.5 bits (155), Expect = 8e-11
 Identities = 29/34 (85%), Positives = 31/34 (91%)
 Frame = +2

Query: 512 LDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           +DSGDGV+HTVPIYEGY LPHAIL LDLAG DLT
Sbjct: 70  MDSGDGVAHTVPIYEGYTLPHAILHLDLAGWDLT 103


>AY970482-1|AAX82288.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  114 bits (275), Expect = 2e-25
 Identities = 52/66 (78%), Positives = 58/66 (87%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHHTFYNEL VA +EHP+LLT+ PL+PKAN +KMTQIM E F+ PAMYVAIQAVLSLY
Sbjct: 1   KIWHHTFYNELCVAAKEHPMLLTKVPLSPKANHKKMTQIMLEIFDRPAMYVAIQAVLSLY 60

Query: 486 ASGRTT 503
            SGRTT
Sbjct: 61  TSGRTT 66



 Score = 60.1 bits (139), Expect = 7e-09
 Identities = 27/35 (77%), Positives = 31/35 (88%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+D  DGV+HTVPIYE YALPHAILR+ LAG+DLT
Sbjct: 69  VMDYDDGVTHTVPIYEEYALPHAILRVCLAGQDLT 103


>AY970434-1|AAX82243.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  114 bits (274), Expect = 3e-25
 Identities = 54/68 (79%), Positives = 60/68 (88%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHH FYNEL VA EE  VLLTEAPL P+ANREKMTQIMF+TFNT AMYVAIQAVL+L+
Sbjct: 1   KIWHHVFYNELCVALEEQVVLLTEAPLKPRANREKMTQIMFKTFNTQAMYVAIQAVLTLH 60

Query: 486 ASGRTTGM 509
           +SG TTG+
Sbjct: 61  SSGWTTGI 68



 Score = 62.9 bits (146), Expect = 1e-09
 Identities = 27/35 (77%), Positives = 31/35 (88%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DSGDGV+HTVPIYE + LPH IL LDLAG+DLT
Sbjct: 69  VMDSGDGVTHTVPIYERHTLPHTILHLDLAGQDLT 103


>AY970435-1|AAX82244.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  113 bits (271), Expect = 7e-25
 Identities = 53/68 (77%), Positives = 60/68 (88%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIWHH FYNEL VA EE  VLLTE PLNP+ANREKMTQIMF+TFNT AMYVAI+AVL+L+
Sbjct: 1   KIWHHVFYNELCVALEEQVVLLTEPPLNPRANREKMTQIMFKTFNTQAMYVAIRAVLTLH 60

Query: 486 ASGRTTGM 509
           +SG TTG+
Sbjct: 61  SSGCTTGI 68



 Score = 62.9 bits (146), Expect = 1e-09
 Identities = 27/35 (77%), Positives = 31/35 (88%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           V+DSGDGV+HTVPIYE + LPH IL LDLAG+DLT
Sbjct: 69  VMDSGDGVTHTVPIYERHTLPHTILHLDLAGQDLT 103


>AY970393-1|AAX82202.1|  103|Homo sapiens actin-like protein
           protein.
          Length = 103

 Score =  111 bits (266), Expect = 3e-24
 Identities = 55/70 (78%), Positives = 62/70 (88%), Gaps = 2/70 (2%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETF-NTPAMYVAIQA-VLS 479
           KIWHHTFYN+L + PEEHP+LLT+APLNPKAN  KMTQI FETF NTPA+Y+AIQA VLS
Sbjct: 1   KIWHHTFYNKLCMTPEEHPMLLTQAPLNPKAN-HKMTQITFETFSNTPAIYMAIQAVVLS 59

Query: 480 LYASGRTTGM 509
           LYASG TTG+
Sbjct: 60  LYASGLTTGI 69



 Score = 62.5 bits (145), Expect = 1e-09
 Identities = 27/34 (79%), Positives = 32/34 (94%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDL 610
           V+DSG+GV+HTVPIY+G ALPHA LRLDLAGR+L
Sbjct: 70  VMDSGNGVTHTVPIYDGNALPHATLRLDLAGREL 103


>Z74696-1|CAI42428.1|  376|Homo sapiens actin-related protein T1
           (ACTRT1) protein.
          Length = 376

 Score =  109 bits (261), Expect = 1e-23
 Identities = 47/85 (55%), Positives = 60/85 (70%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           L YPIE G+VT WDDMEK+W H F  EL V P + PVL+TE  LNP+  REK+ ++MFET
Sbjct: 70  LHYPIERGLVTGWDDMEKLWKHLFERELGVKPSQQPVLMTEPSLNPREIREKLAEMMFET 129

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           F+ P  Y++  AV +LYAS   TG+
Sbjct: 130 FSVPGFYLSNHAVAALYASACVTGL 154



 Score = 65.3 bits (152), Expect = 2e-10
 Identities = 27/46 (58%), Positives = 39/46 (84%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           V+DSGDGV+ TVPI+EGY+LPHA+ +L +AGRD+T++L ++L   G
Sbjct: 155 VVDSGDGVTCTVPIFEGYSLPHAVTKLCMAGRDITEHLTRLLFASG 200



 Score = 50.4 bits (115), Expect = 6e-06
 Identities = 26/67 (38%), Positives = 39/67 (58%)
 Frame = +1

Query: 67  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRG 246
           +V A++ DNGSG+CKAG +G+  PR V  S++G  +    +  + QK  +VG EA  K  
Sbjct: 8   DVPAVIFDNGSGLCKAGLSGEIGPRHVISSVLGHCKFNVPLARLNQK-YFVGQEALYKYE 66

Query: 247 ILTSNTP 267
            L  + P
Sbjct: 67  ALHLHYP 73


>BC014597-1|AAH14597.1|  376|Homo sapiens actin-related protein T1
           protein.
          Length = 376

 Score =  109 bits (261), Expect = 1e-23
 Identities = 47/85 (55%), Positives = 60/85 (70%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           L YPIE G+VT WDDMEK+W H F  EL V P + PVL+TE  LNP+  REK+ ++MFET
Sbjct: 70  LHYPIERGLVTGWDDMEKLWKHLFERELGVKPSQQPVLMTEPSLNPREIREKLAEMMFET 129

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           F+ P  Y++  AV +LYAS   TG+
Sbjct: 130 FSVPGFYLSNHAVAALYASACVTGL 154



 Score = 65.3 bits (152), Expect = 2e-10
 Identities = 27/46 (58%), Positives = 39/46 (84%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           V+DSGDGV+ TVPI+EGY+LPHA+ +L +AGRD+T++L ++L   G
Sbjct: 155 VVDSGDGVTCTVPIFEGYSLPHAVTKLCMAGRDITEHLTRLLFASG 200



 Score = 50.4 bits (115), Expect = 6e-06
 Identities = 26/67 (38%), Positives = 39/67 (58%)
 Frame = +1

Query: 67  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRG 246
           +V A++ DNGSG+CKAG +G+  PR V  S++G  +    +  + QK  +VG EA  K  
Sbjct: 8   DVPAVIFDNGSGLCKAGLSGEIGPRHVISSVLGHCKFNVPLARLNQK-YFVGQEALYKYE 66

Query: 247 ILTSNTP 267
            L  + P
Sbjct: 67  ALHLHYP 73


>AF440739-1|AAM00432.1|  376|Homo sapiens actin-related protein T1
           protein.
          Length = 376

 Score =  109 bits (261), Expect = 1e-23
 Identities = 47/85 (55%), Positives = 60/85 (70%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           L YPIE G+VT WDDMEK+W H F  EL V P + PVL+TE  LNP+  REK+ ++MFET
Sbjct: 70  LHYPIERGLVTGWDDMEKLWKHLFERELGVKPSQQPVLMTEPSLNPREIREKLAEMMFET 129

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           F+ P  Y++  AV +LYAS   TG+
Sbjct: 130 FSVPGFYLSNHAVAALYASACVTGL 154



 Score = 65.3 bits (152), Expect = 2e-10
 Identities = 27/46 (58%), Positives = 39/46 (84%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           V+DSGDGV+ TVPI+EGY+LPHA+ +L +AGRD+T++L ++L   G
Sbjct: 155 VVDSGDGVTCTVPIFEGYSLPHAVTKLCMAGRDITEHLTRLLFASG 200



 Score = 50.4 bits (115), Expect = 6e-06
 Identities = 26/67 (38%), Positives = 39/67 (58%)
 Frame = +1

Query: 67  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRG 246
           +V A++ DNGSG+CKAG +G+  PR V  S++G  +    +  + QK  +VG EA  K  
Sbjct: 8   DVPAVIFDNGSGLCKAGLSGEIGPRHVISSVLGHCKFNVPLARLNQK-YFVGQEALYKYE 66

Query: 247 ILTSNTP 267
            L  + P
Sbjct: 67  ALHLHYP 73


>BC014610-1|AAH14610.1|  435|Homo sapiens actin-like 7A protein.
          Length = 435

 Score =  108 bits (259), Expect = 2e-23
 Identities = 41/82 (50%), Positives = 64/82 (78%)
 Frame = +3

Query: 264 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNT 443
           P+ HGI+ +WD ++ IW + F  E+++APEEH VL+++ PL+P  NREK  +++FE FNT
Sbjct: 134 PLRHGIIVDWDTVQDIWEYLFRQEMKIAPEEHAVLVSDPPLSPHTNREKYAEMLFEAFNT 193

Query: 444 PAMYVAIQAVLSLYASGRTTGM 509
           PAM++A Q+ LS+Y+ GRT+G+
Sbjct: 194 PAMHIAYQSRLSMYSYGRTSGL 215



 Score = 55.2 bits (127), Expect = 2e-07
 Identities = 26/46 (56%), Positives = 31/46 (67%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           V++ G GVS+ VPIYEGY LP    RLD AG DLT YL+ +L   G
Sbjct: 216 VVEVGHGVSYVVPIYEGYPLPSITGRLDYAGSDLTAYLLGLLNSAG 261



 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 22/55 (40%), Positives = 31/55 (56%)
 Frame = +1

Query: 64  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE 228
           E   A+VVD G+G CK GFAG   P     + VG+P  +    G  +K+++VG E
Sbjct: 67  EVTKAVVVDLGTGYCKCGFAGLPRPTHKISTTVGKPYMETAKTGDNRKETFVGQE 121


>AL359692-4|CAI40571.1|  435|Homo sapiens actin-like 7A protein.
          Length = 435

 Score =  108 bits (259), Expect = 2e-23
 Identities = 41/82 (50%), Positives = 64/82 (78%)
 Frame = +3

Query: 264 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNT 443
           P+ HGI+ +WD ++ IW + F  E+++APEEH VL+++ PL+P  NREK  +++FE FNT
Sbjct: 134 PLRHGIIVDWDTVQDIWEYLFRQEMKIAPEEHAVLVSDPPLSPHTNREKYAEMLFEAFNT 193

Query: 444 PAMYVAIQAVLSLYASGRTTGM 509
           PAM++A Q+ LS+Y+ GRT+G+
Sbjct: 194 PAMHIAYQSRLSMYSYGRTSGL 215



 Score = 55.2 bits (127), Expect = 2e-07
 Identities = 26/46 (56%), Positives = 31/46 (67%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           V++ G GVS+ VPIYEGY LP    RLD AG DLT YL+ +L   G
Sbjct: 216 VVEVGHGVSYVVPIYEGYPLPSITGRLDYAGSDLTAYLLGLLNSAG 261



 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 22/55 (40%), Positives = 31/55 (56%)
 Frame = +1

Query: 64  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE 228
           E   A+VVD G+G CK GFAG   P     + VG+P  +    G  +K+++VG E
Sbjct: 67  EVTKAVVVDLGTGYCKCGFAGLPRPTHKISTTVGKPYMETAKTGDNRKETFVGQE 121


>AF113526-1|AAD44109.1|  435|Homo sapiens actin-like-7-alpha
           protein.
          Length = 435

 Score =  108 bits (259), Expect = 2e-23
 Identities = 41/82 (50%), Positives = 64/82 (78%)
 Frame = +3

Query: 264 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNT 443
           P+ HGI+ +WD ++ IW + F  E+++APEEH VL+++ PL+P  NREK  +++FE FNT
Sbjct: 134 PLRHGIIVDWDTVQDIWEYLFRQEMKIAPEEHAVLVSDPPLSPHTNREKYAEMLFEAFNT 193

Query: 444 PAMYVAIQAVLSLYASGRTTGM 509
           PAM++A Q+ LS+Y+ GRT+G+
Sbjct: 194 PAMHIAYQSRLSMYSYGRTSGL 215



 Score = 55.2 bits (127), Expect = 2e-07
 Identities = 26/46 (56%), Positives = 31/46 (67%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           V++ G GVS+ VPIYEGY LP    RLD AG DLT YL+ +L   G
Sbjct: 216 VVEVGHGVSYVVPIYEGYPLPSITGRLDYAGSDLTAYLLGLLNSAG 261



 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 22/55 (40%), Positives = 31/55 (56%)
 Frame = +1

Query: 64  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE 228
           E   A+VVD G+G CK GFAG   P     + VG+P  +    G  +K+++VG E
Sbjct: 67  EVTKAVVVDLGTGYCKCGFAGLPRPTHKISTTVGKPYMETAKTGDNRKETFVGQE 121


>AB284520-1|BAF41971.1|  435|Homo sapiens human t-actin 2 protein.
          Length = 435

 Score =  108 bits (259), Expect = 2e-23
 Identities = 41/82 (50%), Positives = 64/82 (78%)
 Frame = +3

Query: 264 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNT 443
           P+ HGI+ +WD ++ IW + F  E+++APEEH VL+++ PL+P  NREK  +++FE FNT
Sbjct: 134 PLRHGIIVDWDTVQDIWEYLFRQEMKIAPEEHAVLVSDPPLSPHTNREKYAEMLFEAFNT 193

Query: 444 PAMYVAIQAVLSLYASGRTTGM 509
           PAM++A Q+ LS+Y+ GRT+G+
Sbjct: 194 PAMHIAYQSRLSMYSYGRTSGL 215



 Score = 55.2 bits (127), Expect = 2e-07
 Identities = 26/46 (56%), Positives = 31/46 (67%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           V++ G GVS+ VPIYEGY LP    RLD AG DLT YL+ +L   G
Sbjct: 216 VVEVGHGVSYVVPIYEGYPLPSITGRLDYAGSDLTAYLLGLLNSAG 261



 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 22/55 (40%), Positives = 31/55 (56%)
 Frame = +1

Query: 64  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE 228
           E   A+VVD G+G CK GFAG   P     + VG+P  +    G  +K+++VG E
Sbjct: 67  EVTKAVVVDLGTGYCKCGFAGLPRPTHKISTTVGKPYMETAKTGDNRKETFVGQE 121


>BC029499-1|AAH29499.1|  376|Homo sapiens actin-related protein T2
           protein.
          Length = 376

 Score =  105 bits (252), Expect = 1e-22
 Identities = 45/85 (52%), Positives = 59/85 (69%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           L  P E G++T WDD+E++W H F  EL V P + P+L TE  LNP+ NREKM ++MFE 
Sbjct: 70  LHSPFERGLITGWDDVERLWKHLFEWELGVKPSDQPLLATEPSLNPRENREKMAEVMFEN 129

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           F  PA Y++ QAVL+LYAS   TG+
Sbjct: 130 FGVPAFYLSDQAVLALYASACVTGL 154



 Score = 64.5 bits (150), Expect = 3e-10
 Identities = 27/46 (58%), Positives = 38/46 (82%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           V+DSGD V+ TVPI+EGY+LPHA+ +L +AGRD+T+ LM++L   G
Sbjct: 155 VVDSGDAVTCTVPIFEGYSLPHAVTKLHVAGRDITELLMQLLLASG 200



 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 27/64 (42%), Positives = 38/64 (59%)
 Frame = +1

Query: 76  ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILT 255
           A++ DNGSG CKAG +G+  PR +  SIVG  + Q       QK  +VG+EA  K+  L 
Sbjct: 11  AVIFDNGSGFCKAGLSGEFGPRHMVSSIVGHLKFQAPSAEANQK-YFVGEEALYKQEALQ 69

Query: 256 SNTP 267
            ++P
Sbjct: 70  LHSP 73


>AL356984-1|CAH72587.1|  377|Homo sapiens actin-related protein M2
           (ARPM2) protein.
          Length = 377

 Score =  105 bits (252), Expect = 1e-22
 Identities = 45/85 (52%), Positives = 59/85 (69%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           L  P E G++T WDD+E++W H F  EL V P + P+L TE  LNP+ NREKM ++MFE 
Sbjct: 71  LHSPFERGLITGWDDVERLWKHLFEWELGVKPSDQPLLATEPSLNPRENREKMAEVMFEN 130

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           F  PA Y++ QAVL+LYAS   TG+
Sbjct: 131 FGVPAFYLSDQAVLALYASACVTGL 155



 Score = 64.5 bits (150), Expect = 3e-10
 Identities = 27/46 (58%), Positives = 38/46 (82%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           V+DSGD V+ TVPI+EGY+LPHA+ +L +AGRD+T+ LM++L   G
Sbjct: 156 VVDSGDAVTCTVPIFEGYSLPHAVTKLHVAGRDITELLMQLLLASG 201



 Score = 56.0 bits (129), Expect = 1e-07
 Identities = 27/64 (42%), Positives = 38/64 (59%)
 Frame = +1

Query: 76  ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILT 255
           A++ DNGSG CKAG +G+  PR +  SIVG  + Q       QK  +VG+EA  K+  L 
Sbjct: 11  AVIFDNGSGFCKAGLSGEFGPRHMVSSIVGHLKFQAPSAEANQKKYFVGEEALYKQEALQ 70

Query: 256 SNTP 267
            ++P
Sbjct: 71  LHSP 74


>AK058153-1|BAB71690.1|  328|Homo sapiens protein ( Homo sapiens
           cDNA FLJ25424 fis, clone TST04169. ).
          Length = 328

 Score =  105 bits (252), Expect = 1e-22
 Identities = 45/85 (52%), Positives = 59/85 (69%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           L  P E G++T WDD+E++W H F  EL V P + P+L TE  LNP+ NREKM ++MFE 
Sbjct: 71  LHSPFERGLITGWDDVERLWKHLFEWELGVKPSDQPLLATEPSLNPRENREKMAEVMFEN 130

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           F  PA Y++ QAVL+LYAS   TG+
Sbjct: 131 FGVPAFYLSDQAVLALYASACVTGL 155



 Score = 64.5 bits (150), Expect = 3e-10
 Identities = 27/46 (58%), Positives = 38/46 (82%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           V+DSGD V+ TVPI+EGY+LPHA+ +L +AGRD+T+ LM++L   G
Sbjct: 156 VVDSGDAVTCTVPIFEGYSLPHAVTKLHVAGRDITELLMQLLLASG 201



 Score = 56.0 bits (129), Expect = 1e-07
 Identities = 27/64 (42%), Positives = 38/64 (59%)
 Frame = +1

Query: 76  ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILT 255
           A++ DNGSG CKAG +G+  PR +  SIVG  + Q       QK  +VG+EA  K+  L 
Sbjct: 11  AVIFDNGSGFCKAGLSGEFGPRHMVSSIVGHLKFQAPSAEANQKKYFVGEEALYKQEALQ 70

Query: 256 SNTP 267
            ++P
Sbjct: 71  LHSP 74


>AF440740-1|AAM00433.1|  377|Homo sapiens actin-related protein T2
           protein.
          Length = 377

 Score =  105 bits (252), Expect = 1e-22
 Identities = 45/85 (52%), Positives = 59/85 (69%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           L  P E G++T WDD+E++W H F  EL V P + P+L TE  LNP+ NREKM ++MFE 
Sbjct: 71  LHSPFERGLITGWDDVERLWKHLFEWELGVKPSDQPLLATEPSLNPRENREKMAEVMFEN 130

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           F  PA Y++ QAVL+LYAS   TG+
Sbjct: 131 FGVPAFYLSDQAVLALYASACVTGL 155



 Score = 64.5 bits (150), Expect = 3e-10
 Identities = 27/46 (58%), Positives = 38/46 (82%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           V+DSGD V+ TVPI+EGY+LPHA+ +L +AGRD+T+ LM++L   G
Sbjct: 156 VVDSGDAVTCTVPIFEGYSLPHAVTKLHVAGRDITELLMQLLLASG 201



 Score = 56.0 bits (129), Expect = 1e-07
 Identities = 27/64 (42%), Positives = 38/64 (59%)
 Frame = +1

Query: 76  ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILT 255
           A++ DNGSG CKAG +G+  PR +  SIVG  + Q       QK  +VG+EA  K+  L 
Sbjct: 11  AVIFDNGSGFCKAGLSGEFGPRHMVSSIVGHLKFQAPSAEANQKKYFVGEEALYKQEALQ 70

Query: 256 SNTP 267
            ++P
Sbjct: 71  LHSP 74


>AB057364-1|BAB85862.1|  377|Homo sapiens actin-related protein
           hArpM2 protein.
          Length = 377

 Score =  105 bits (252), Expect = 1e-22
 Identities = 45/85 (52%), Positives = 59/85 (69%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           L  P E G++T WDD+E++W H F  EL V P + P+L TE  LNP+ NREKM ++MFE 
Sbjct: 71  LHSPFERGLITGWDDVERLWKHLFEWELGVKPSDQPLLATEPSLNPRENREKMAEVMFEN 130

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           F  PA Y++ QAVL+LYAS   TG+
Sbjct: 131 FGVPAFYLSDQAVLALYASACVTGL 155



 Score = 64.5 bits (150), Expect = 3e-10
 Identities = 27/46 (58%), Positives = 38/46 (82%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           V+DSGD V+ TVPI+EGY+LPHA+ +L +AGRD+T+ LM++L   G
Sbjct: 156 VVDSGDAVTCTVPIFEGYSLPHAVTKLHVAGRDITELLMQLLLASG 201



 Score = 56.0 bits (129), Expect = 1e-07
 Identities = 27/64 (42%), Positives = 38/64 (59%)
 Frame = +1

Query: 76  ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILT 255
           A++ DNGSG CKAG +G+  PR +  SIVG  + Q       QK  +VG+EA  K+  L 
Sbjct: 11  AVIFDNGSGFCKAGLSGEFGPRHMVSSIVGHLKFQAPSAEANQKKYFVGEEALYKQEALQ 70

Query: 256 SNTP 267
            ++P
Sbjct: 71  LHSP 74


>BC033789-1|AAH33789.1|  415|Homo sapiens actin-like 7B protein.
          Length = 415

 Score =  102 bits (244), Expect = 1e-21
 Identities = 39/82 (47%), Positives = 63/82 (76%)
 Frame = +3

Query: 264 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNT 443
           P++HGIV +WD ++ IW + F   +++ PEEH VL+++ PL+P +NREK  ++MFETF  
Sbjct: 114 PLKHGIVVDWDCVQDIWEYIFRTAMKILPEEHAVLVSDPPLSPSSNREKYAELMFETFGI 173

Query: 444 PAMYVAIQAVLSLYASGRTTGM 509
           PAM+V  Q++LS+Y+ G+T+G+
Sbjct: 174 PAMHVTSQSLLSIYSYGKTSGL 195



 Score = 56.4 bits (130), Expect = 8e-08
 Identities = 27/46 (58%), Positives = 32/46 (69%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           V++SG GVSH VPI EG  LP    R D AG DLT+YLM++L E G
Sbjct: 196 VVESGHGVSHVVPISEGDVLPGLTSRADYAGGDLTNYLMQLLNEAG 241



 Score = 37.5 bits (83), Expect = 0.042
 Identities = 18/54 (33%), Positives = 29/54 (53%)
 Frame = +1

Query: 67  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE 228
           ++ A+++D GS  CK G+AG+  P     S VG+   +    G  +K + VG E
Sbjct: 48  KIKAVIIDLGSQYCKCGYAGEPRPTYFISSTVGKRCPEAADAGDTRKWTLVGHE 101


>AL359692-3|CAI40570.1|  415|Homo sapiens actin-like 7B protein.
          Length = 415

 Score =  102 bits (244), Expect = 1e-21
 Identities = 39/82 (47%), Positives = 63/82 (76%)
 Frame = +3

Query: 264 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNT 443
           P++HGIV +WD ++ IW + F   +++ PEEH VL+++ PL+P +NREK  ++MFETF  
Sbjct: 114 PLKHGIVVDWDCVQDIWEYIFRTAMKILPEEHAVLVSDPPLSPSSNREKYAELMFETFGI 173

Query: 444 PAMYVAIQAVLSLYASGRTTGM 509
           PAM+V  Q++LS+Y+ G+T+G+
Sbjct: 174 PAMHVTSQSLLSIYSYGKTSGL 195



 Score = 56.4 bits (130), Expect = 8e-08
 Identities = 27/46 (58%), Positives = 32/46 (69%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           V++SG GVSH VPI EG  LP    R D AG DLT+YLM++L E G
Sbjct: 196 VVESGHGVSHVVPISEGDVLPGLTSRADYAGGDLTNYLMQLLNEAG 241



 Score = 37.5 bits (83), Expect = 0.042
 Identities = 18/54 (33%), Positives = 29/54 (53%)
 Frame = +1

Query: 67  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE 228
           ++ A+++D GS  CK G+AG+  P     S VG+   +    G  +K + VG E
Sbjct: 48  KIKAVIIDLGSQYCKCGYAGEPRPTYFISSTVGKRCPEAADAGDTRKWTLVGHE 101


>AF113527-1|AAD44110.1|  415|Homo sapiens actin-like-7-beta protein.
          Length = 415

 Score =  102 bits (244), Expect = 1e-21
 Identities = 39/82 (47%), Positives = 63/82 (76%)
 Frame = +3

Query: 264 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNT 443
           P++HGIV +WD ++ IW + F   +++ PEEH VL+++ PL+P +NREK  ++MFETF  
Sbjct: 114 PLKHGIVVDWDCVQDIWEYIFRTAMKILPEEHAVLVSDPPLSPSSNREKYAELMFETFGI 173

Query: 444 PAMYVAIQAVLSLYASGRTTGM 509
           PAM+V  Q++LS+Y+ G+T+G+
Sbjct: 174 PAMHVTSQSLLSIYSYGKTSGL 195



 Score = 56.4 bits (130), Expect = 8e-08
 Identities = 27/46 (58%), Positives = 32/46 (69%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           V++SG GVSH VPI EG  LP    R D AG DLT+YLM++L E G
Sbjct: 196 VVESGHGVSHVVPISEGDVLPGLTSRADYAGGDLTNYLMQLLNEAG 241



 Score = 37.5 bits (83), Expect = 0.042
 Identities = 18/54 (33%), Positives = 29/54 (53%)
 Frame = +1

Query: 67  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE 228
           ++ A+++D GS  CK G+AG+  P     S VG+   +    G  +K + VG E
Sbjct: 48  KIKAVIIDLGSQYCKCGYAGEPRPTYFISSTVGKRCPEAADAGDTRKWTLVGHE 101


>AB284521-1|BAF41972.1|  415|Homo sapiens t-actin 1 protein.
          Length = 415

 Score =  102 bits (244), Expect = 1e-21
 Identities = 39/82 (47%), Positives = 63/82 (76%)
 Frame = +3

Query: 264 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNT 443
           P++HGIV +WD ++ IW + F   +++ PEEH VL+++ PL+P +NREK  ++MFETF  
Sbjct: 114 PLKHGIVVDWDCVQDIWEYIFRTAMKILPEEHAVLVSDPPLSPSSNREKYAELMFETFGI 173

Query: 444 PAMYVAIQAVLSLYASGRTTGM 509
           PAM+V  Q++LS+Y+ G+T+G+
Sbjct: 174 PAMHVTSQSLLSIYSYGKTSGL 195



 Score = 56.4 bits (130), Expect = 8e-08
 Identities = 27/46 (58%), Positives = 32/46 (69%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           V++SG GVSH VPI EG  LP    R D AG DLT+YLM++L E G
Sbjct: 196 VVESGHGVSHVVPISEGDVLPGLTSRADYAGGDLTNYLMQLLNEAG 241



 Score = 37.5 bits (83), Expect = 0.042
 Identities = 18/54 (33%), Positives = 29/54 (53%)
 Frame = +1

Query: 67  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDE 228
           ++ A+++D GS  CK G+AG+  P     S VG+   +    G  +K + VG E
Sbjct: 48  KIKAVIIDLGSQYCKCGYAGEPRPTYFISSTVGKRCPEAADAGDTRKWTLVGHE 101


>AK055346-1|BAB70906.1|  372|Homo sapiens protein ( Homo sapiens
           cDNA FLJ30784 fis, clone FEBRA2000881, moderately
           similar to ACTIN 6. ).
          Length = 372

 Score =  101 bits (243), Expect = 2e-21
 Identities = 41/85 (48%), Positives = 64/85 (75%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           + YP+E G++T+W+DME +W H +   L++ P + PVL+TE  LNP ANR+++T++ FE 
Sbjct: 66  ISYPVERGLITSWEDMEIMWKHIYDYNLKLKPCDGPVLITEPALNPLANRQQITEMFFEH 125

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
              PA Y++IQAVL+L+A+G TTG+
Sbjct: 126 LGVPAFYMSIQAVLALFAAGFTTGL 150



 Score = 63.3 bits (147), Expect = 7e-10
 Identities = 27/46 (58%), Positives = 36/46 (78%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VL+SG GV+ +VPI+EGY LPH + +LDLAG DLT+YLM ++   G
Sbjct: 151 VLNSGAGVTQSVPIFEGYCLPHGVQQLDLAGLDLTNYLMVLMKNHG 196



 Score = 52.8 bits (121), Expect = 1e-06
 Identities = 27/63 (42%), Positives = 38/63 (60%)
 Frame = +1

Query: 79  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTS 258
           +V+DNGSGM KAG AG   P+ ++P+I+GR + Q      G  +  VGD+AQ  R  L  
Sbjct: 8   VVIDNGSGMIKAGVAGCREPQFIYPNIIGRAKGQS-RAAQGGLELCVGDQAQDWRSSLFI 66

Query: 259 NTP 267
           + P
Sbjct: 67  SYP 69


>AB049117-1|BAB39481.1|  372|Homo sapiens actin related protein
           protein.
          Length = 372

 Score =  101 bits (243), Expect = 2e-21
 Identities = 41/85 (48%), Positives = 64/85 (75%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           + YP+E G++T+W+DME +W H +   L++ P + PVL+TE  LNP ANR+++T++ FE 
Sbjct: 66  ISYPVERGLITSWEDMEIMWKHIYDYNLKLKPCDGPVLITEPALNPLANRQQITEMFFEH 125

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
              PA Y++IQAVL+L+A+G TTG+
Sbjct: 126 LGVPAFYMSIQAVLALFAAGFTTGL 150



 Score = 63.3 bits (147), Expect = 7e-10
 Identities = 27/46 (58%), Positives = 36/46 (78%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VL+SG GV+ +VPI+EGY LPH + +LDLAG DLT+YLM ++   G
Sbjct: 151 VLNSGAGVTQSVPIFEGYCLPHGVQQLDLAGLDLTNYLMVLMKNHG 196



 Score = 52.8 bits (121), Expect = 1e-06
 Identities = 27/63 (42%), Positives = 38/63 (60%)
 Frame = +1

Query: 79  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTS 258
           +V+DNGSGM KAG AG   P+ ++P+I+GR + Q      G  +  VGD+AQ  R  L  
Sbjct: 8   VVIDNGSGMIKAGVAGCREPQFIYPNIIGRAKGQS-RAAQGGLELCVGDQAQDWRSSLFI 66

Query: 259 NTP 267
           + P
Sbjct: 67  SYP 69


>BC036253-1|AAH36253.1|  339|Homo sapiens ACTR2 protein protein.
          Length = 339

 Score =  101 bits (242), Expect = 2e-21
 Identities = 46/94 (48%), Positives = 65/94 (69%), Gaps = 1/94 (1%)
 Frame = +3

Query: 231 TEQKRYPDLKYPIEHGIVTNWDDMEKIWHHTFYNE-LRVAPEEHPVLLTEAPLNPKANRE 407
           +E +   ++ YP+E+GIV NWDDM+ +W +TF  E L +      +LLTE P+NP  NRE
Sbjct: 7   SELRSMLEVNYPMENGIVRNWDDMKHLWDYTFGPEKLNIDTRNCKILLTEPPMNPTKNRE 66

Query: 408 KMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGM 509
           K+ ++MFET+    +YVAIQAVL+LYA G  TG+
Sbjct: 67  KIVEVMFETYQFSGVYVAIQAVLTLYAQGLLTGV 100



 Score = 70.1 bits (164), Expect = 6e-12
 Identities = 29/46 (63%), Positives = 38/46 (82%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           V+DSGDGV+H  P+YEG++LPH   RLD+AGRD+T YL+K+L  RG
Sbjct: 101 VVDSGDGVTHICPVYEGFSLPHLTRRLDIAGRDITRYLIKLLLLRG 146


>AF006082-1|AAB64187.1|  394|Homo sapiens Arp2 protein.
          Length = 394

 Score =  101 bits (242), Expect = 2e-21
 Identities = 46/94 (48%), Positives = 65/94 (69%), Gaps = 1/94 (1%)
 Frame = +3

Query: 231 TEQKRYPDLKYPIEHGIVTNWDDMEKIWHHTFYNE-LRVAPEEHPVLLTEAPLNPKANRE 407
           +E +   ++ YP+E+GIV NWDDM+ +W +TF  E L +      +LLTE P+NP  NRE
Sbjct: 62  SELRSMLEVNYPMENGIVRNWDDMKHLWDYTFGPEKLNIDTRNCKILLTEPPMNPTKNRE 121

Query: 408 KMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGM 509
           K+ ++MFET+    +YVAIQAVL+LYA G  TG+
Sbjct: 122 KIVEVMFETYQFSGVYVAIQAVLTLYAQGLLTGV 155



 Score = 70.1 bits (164), Expect = 6e-12
 Identities = 29/46 (63%), Positives = 38/46 (82%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           V+DSGDGV+H  P+YEG++LPH   RLD+AGRD+T YL+K+L  RG
Sbjct: 156 VVDSGDGVTHICPVYEGFSLPHLTRRLDIAGRDITRYLIKLLLLRG 201



 Score = 54.8 bits (126), Expect = 3e-07
 Identities = 28/65 (43%), Positives = 38/65 (58%), Gaps = 2/65 (3%)
 Frame = +1

Query: 79  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP--RHQGVMVGMGQKDSYVGDEAQSKRGIL 252
           +V DNG+G  K G+AG + P  +FP++VGRP  R    +  +  KD  VGDEA   R +L
Sbjct: 9   VVCDNGTGFVKCGYAGSNFPEHIFPALVGRPIIRSTTKVGNIEIKDLMVGDEASELRSML 68

Query: 253 TSNTP 267
             N P
Sbjct: 69  EVNYP 73


>BC014546-1|AAH14546.1|  394|Homo sapiens ARP2 actin-related protein
           2 homolog (yeast) protein.
          Length = 394

 Score =  101 bits (241), Expect = 3e-21
 Identities = 45/87 (51%), Positives = 62/87 (71%), Gaps = 1/87 (1%)
 Frame = +3

Query: 252 DLKYPIEHGIVTNWDDMEKIWHHTFYNE-LRVAPEEHPVLLTEAPLNPKANREKMTQIMF 428
           ++ YP+E+GIV NWDDM+ +W +TF  E L +      +LLTE P+NP  NREK+ ++MF
Sbjct: 69  EVNYPMENGIVRNWDDMKHLWDYTFGPEKLNIDTRNCKILLTEPPMNPTKNREKIVEVMF 128

Query: 429 ETFNTPAMYVAIQAVLSLYASGRTTGM 509
           ET+    +YVAIQAVL+LYA G  TG+
Sbjct: 129 ETYQFSGVYVAIQAVLTLYAQGLLTGV 155



 Score = 67.7 bits (158), Expect = 3e-11
 Identities = 28/46 (60%), Positives = 37/46 (80%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           V+DSGDGV+H  P+YE ++LPH   RLD+AGRD+T YL+K+L  RG
Sbjct: 156 VVDSGDGVTHICPVYESFSLPHLTRRLDIAGRDITRYLIKLLLLRG 201



 Score = 54.0 bits (124), Expect = 5e-07
 Identities = 28/65 (43%), Positives = 37/65 (56%), Gaps = 2/65 (3%)
 Frame = +1

Query: 79  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP--RHQGVMVGMGQKDSYVGDEAQSKRGIL 252
           +V DNG+G  K G+AG + P  +FP++VGRP  R    +  +  KD  VGDEA   R  L
Sbjct: 9   VVCDNGTGFVKCGYAGSNFPEHIFPALVGRPIIRSTTKVGNIEIKDLMVGDEASELRSTL 68

Query: 253 TSNTP 267
             N P
Sbjct: 69  EVNYP 73


>BC045752-1|AAH45752.1|  416|Homo sapiens hypothetical protein
           MGC33407 protein.
          Length = 416

 Score = 99.1 bits (236), Expect = 1e-20
 Identities = 41/85 (48%), Positives = 59/85 (69%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           L  P+  GIV +WD  E IW H   ++LRVA  +HP+L ++ P +P  NREK+ ++ FE+
Sbjct: 110 LVQPLRSGIVVDWDAAELIWRHLLEHDLRVATHDHPLLFSDPPFSPATNREKLVEVAFES 169

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
             +PAMYVA Q+VLS+YA GR +G+
Sbjct: 170 LRSPAMYVASQSVLSVYAHGRVSGL 194



 Score = 56.0 bits (129), Expect = 1e-07
 Identities = 24/46 (52%), Positives = 36/46 (78%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           V+D+G GV++TVP+++GY L HA  RLDLAG +LT +L ++L + G
Sbjct: 195 VVDTGHGVTYTVPVFQGYNLLHATERLDLAGNNLTAFLAEMLLQAG 240



 Score = 39.5 bits (88), Expect = 0.010
 Identities = 17/56 (30%), Positives = 30/56 (53%)
 Frame = +1

Query: 67  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 234
           +  A+V+D G+G CK GFAG  +P     +I+G    +    G     +++G+ A+
Sbjct: 48  KTGAVVIDMGTGTCKVGFAGQASPTYTVATILGCQPKKPATSGQSGLQTFIGEAAR 103


>BC024028-1|AAH24028.1|  416|Homo sapiens hypothetical protein
           MGC33407 protein.
          Length = 416

 Score = 99.1 bits (236), Expect = 1e-20
 Identities = 41/85 (48%), Positives = 59/85 (69%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           L  P+  GIV +WD  E IW H   ++LRVA  +HP+L ++ P +P  NREK+ ++ FE+
Sbjct: 110 LVQPLRSGIVVDWDAAELIWRHLLEHDLRVATHDHPLLFSDPPFSPATNREKLVEVAFES 169

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
             +PAMYVA Q+VLS+YA GR +G+
Sbjct: 170 LRSPAMYVASQSVLSVYAHGRVSGL 194



 Score = 56.0 bits (129), Expect = 1e-07
 Identities = 24/46 (52%), Positives = 36/46 (78%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           V+D+G GV++TVP+++GY L HA  RLDLAG +LT +L ++L + G
Sbjct: 195 VVDTGHGVTYTVPVFQGYNLLHATERLDLAGNNLTAFLAEMLLQAG 240



 Score = 39.5 bits (88), Expect = 0.010
 Identities = 17/56 (30%), Positives = 30/56 (53%)
 Frame = +1

Query: 67  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 234
           +  A+V+D G+G CK GFAG  +P     +I+G    +    G     +++G+ A+
Sbjct: 48  KTGAVVIDMGTGTCKVGFAGQASPTYTVATILGCQPKKPATSGQSGLQTFIGEAAR 103


>M16247-1|AAA51580.1|  232|Homo sapiens ACTG1 protein.
          Length = 232

 Score = 97.5 bits (232), Expect = 4e-20
 Identities = 44/46 (95%), Positives = 46/46 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           V+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG
Sbjct: 9   VMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 54


>BC113036-1|AAI13037.1|  103|Homo sapiens ACTB protein protein.
          Length = 103

 Score = 97.5 bits (232), Expect = 4e-20
 Identities = 44/46 (95%), Positives = 46/46 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           V+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG
Sbjct: 45  VMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 90



 Score = 85.8 bits (203), Expect = 1e-16
 Identities = 40/41 (97%), Positives = 41/41 (100%)
 Frame = +3

Query: 387 NPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGM 509
           NPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTG+
Sbjct: 4   NPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGI 44


>BC023548-1|AAH23548.1|  263|Homo sapiens ACTG1 protein protein.
          Length = 263

 Score = 97.5 bits (232), Expect = 4e-20
 Identities = 44/46 (95%), Positives = 46/46 (100%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           V+DSGDGV+HTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG
Sbjct: 40  VMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 85



 Score = 80.6 bits (190), Expect = 5e-15
 Identities = 38/39 (97%), Positives = 39/39 (100%)
 Frame = +3

Query: 393 KANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGM 509
           KANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTG+
Sbjct: 1   KANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGI 39


>AY970399-1|AAX82208.1|   97|Homo sapiens actin-like protein
           protein.
          Length = 97

 Score = 97.1 bits (231), Expect = 5e-20
 Identities = 50/68 (73%), Positives = 55/68 (80%)
 Frame = +3

Query: 306 KIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLY 485
           KIW    YNEL VAPEEHPV LTEAP+N KAN +KMTQIMFETFNTPA+YVA    +SLY
Sbjct: 1   KIW---LYNELGVAPEEHPVQLTEAPMNHKANCKKMTQIMFETFNTPAIYVAF---VSLY 54

Query: 486 ASGRTTGM 509
           ASGRTT +
Sbjct: 55  ASGRTTSI 62



 Score = 62.9 bits (146), Expect = 1e-09
 Identities = 27/35 (77%), Positives = 33/35 (94%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLT 613
           ++DSGDGV+HTVP+Y+G+ALPHAIL LDLAG DLT
Sbjct: 63  MMDSGDGVTHTVPMYKGHALPHAILYLDLAGWDLT 97


>BC007289-1|AAH07289.1|  372|Homo sapiens actin related protein M1
           protein.
          Length = 372

 Score = 96.7 bits (230), Expect = 6e-20
 Identities = 40/85 (47%), Positives = 63/85 (74%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           + YP+E G++T+ +DME +W H +   L++ P + PVL+TE  LNP ANR+++T++ FE 
Sbjct: 66  ISYPVERGLITSCEDMEIMWKHIYDYNLKLKPCDGPVLITEPALNPLANRQQITEMFFEH 125

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
              PA Y++IQAVL+L+A+G TTG+
Sbjct: 126 LGVPAFYMSIQAVLALFAAGFTTGL 150



 Score = 63.3 bits (147), Expect = 7e-10
 Identities = 27/46 (58%), Positives = 36/46 (78%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VL+SG GV+ +VPI+EGY LPH + +LDLAG DLT+YLM ++   G
Sbjct: 151 VLNSGAGVTQSVPIFEGYCLPHGVQQLDLAGLDLTNYLMVLMKNHG 196



 Score = 52.8 bits (121), Expect = 1e-06
 Identities = 27/63 (42%), Positives = 38/63 (60%)
 Frame = +1

Query: 79  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTS 258
           +V+DNGSGM KAG AG   P+ ++P+I+GR + Q      G  +  VGD+AQ  R  L  
Sbjct: 8   VVIDNGSGMIKAGVAGCREPQFIYPNIIGRAKGQS-RAAQGGLELCVGDQAQDWRSSLFI 66

Query: 259 NTP 267
           + P
Sbjct: 67  SYP 69


>BC044590-1|AAH44590.1|  418|Homo sapiens ARP3 actin-related protein
           3 homolog (yeast) protein.
          Length = 418

 Score = 94.3 bits (224), Expect = 3e-19
 Identities = 42/78 (53%), Positives = 53/78 (67%)
 Frame = +3

Query: 258 KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETF 437
           K+PI HGIV +WD ME+      +  LR  PE+H  LLTE PLN   NRE   +IMFE+F
Sbjct: 75  KWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESF 134

Query: 438 NTPAMYVAIQAVLSLYAS 491
           N P +Y+A+QAVL+L AS
Sbjct: 135 NVPGLYIAVQAVLALAAS 152



 Score = 53.6 bits (123), Expect = 6e-07
 Identities = 20/45 (44%), Positives = 33/45 (73%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTER 643
           V+DSGDGV+H +P+ EGY +   I  + +AGRD+T ++ ++L +R
Sbjct: 167 VIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDR 211



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 24/63 (38%), Positives = 33/63 (52%), Gaps = 8/63 (12%)
 Frame = +1

Query: 76  ALVVDNGSGMCKAGFAGDDAPRAVFPSI--------VGRPRHQGVMVGMGQKDSYVGDEA 231
           A VVD G+G  K G+AG+  P+ + PS         VG    + VM G+   D ++GDEA
Sbjct: 7   ACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRRVMKGVDDLDFFIGDEA 66

Query: 232 QSK 240
             K
Sbjct: 67  IEK 69


>AF127773-1|AAD51904.1|  418|Homo sapiens unknown protein.
          Length = 418

 Score = 94.3 bits (224), Expect = 3e-19
 Identities = 42/78 (53%), Positives = 53/78 (67%)
 Frame = +3

Query: 258 KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETF 437
           K+PI HGIV +WD ME+      +  LR  PE+H  LLTE PLN   NRE   +IMFE+F
Sbjct: 75  KWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESF 134

Query: 438 NTPAMYVAIQAVLSLYAS 491
           N P +Y+A+QAVL+L AS
Sbjct: 135 NVPGLYIAVQAVLALAAS 152



 Score = 53.6 bits (123), Expect = 6e-07
 Identities = 20/45 (44%), Positives = 33/45 (73%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTER 643
           V+DSGDGV+H +P+ EGY +   I  + +AGRD+T ++ ++L +R
Sbjct: 167 VIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDR 211



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 24/63 (38%), Positives = 33/63 (52%), Gaps = 8/63 (12%)
 Frame = +1

Query: 76  ALVVDNGSGMCKAGFAGDDAPRAVFPSI--------VGRPRHQGVMVGMGQKDSYVGDEA 231
           A VVD G+G  K G+AG+  P+ + PS         VG    + VM G+   D ++GDEA
Sbjct: 7   ACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRRVMKGVDDLDFFIGDEA 66

Query: 232 QSK 240
             K
Sbjct: 67  IEK 69


>AF006083-1|AAB64188.1|  418|Homo sapiens Arp3 protein.
          Length = 418

 Score = 94.3 bits (224), Expect = 3e-19
 Identities = 42/78 (53%), Positives = 53/78 (67%)
 Frame = +3

Query: 258 KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETF 437
           K+PI HGIV +WD ME+      +  LR  PE+H  LLTE PLN   NRE   +IMFE+F
Sbjct: 75  KWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESF 134

Query: 438 NTPAMYVAIQAVLSLYAS 491
           N P +Y+A+QAVL+L AS
Sbjct: 135 NVPGLYIAVQAVLALAAS 152



 Score = 53.6 bits (123), Expect = 6e-07
 Identities = 20/45 (44%), Positives = 33/45 (73%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTER 643
           V+DSGDGV+H +P+ EGY +   I  + +AGRD+T ++ ++L +R
Sbjct: 167 VIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDR 211



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 24/63 (38%), Positives = 33/63 (52%), Gaps = 8/63 (12%)
 Frame = +1

Query: 76  ALVVDNGSGMCKAGFAGDDAPRAVFPSI--------VGRPRHQGVMVGMGQKDSYVGDEA 231
           A VVD G+G  K G+AG+  P+ + PS         VG    + VM G+   D ++GDEA
Sbjct: 7   ACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRRVMKGVDDLDFFIGDEA 66

Query: 232 QSK 240
             K
Sbjct: 67  IEK 69


>AC110769-1|AAX93226.1|  418|Homo sapiens unknown protein.
          Length = 418

 Score = 94.3 bits (224), Expect = 3e-19
 Identities = 42/78 (53%), Positives = 53/78 (67%)
 Frame = +3

Query: 258 KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETF 437
           K+PI HGIV +WD ME+      +  LR  PE+H  LLTE PLN   NRE   +IMFE+F
Sbjct: 75  KWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESF 134

Query: 438 NTPAMYVAIQAVLSLYAS 491
           N P +Y+A+QAVL+L AS
Sbjct: 135 NVPGLYIAVQAVLALAAS 152



 Score = 53.6 bits (123), Expect = 6e-07
 Identities = 20/45 (44%), Positives = 33/45 (73%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTER 643
           V+DSGDGV+H +P+ EGY +   I  + +AGRD+T ++ ++L +R
Sbjct: 167 VIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDR 211



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 24/63 (38%), Positives = 33/63 (52%), Gaps = 8/63 (12%)
 Frame = +1

Query: 76  ALVVDNGSGMCKAGFAGDDAPRAVFPSI--------VGRPRHQGVMVGMGQKDSYVGDEA 231
           A VVD G+G  K G+AG+  P+ + PS         VG    + VM G+   D ++GDEA
Sbjct: 7   ACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRRVMKGVDDLDFFIGDEA 66

Query: 232 QSK 240
             K
Sbjct: 67  IEK 69


>AB209353-1|BAD92590.1|  369|Homo sapiens ARP3 actin-related protein
           3 homolog variant protein.
          Length = 369

 Score = 94.3 bits (224), Expect = 3e-19
 Identities = 42/78 (53%), Positives = 53/78 (67%)
 Frame = +3

Query: 258 KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETF 437
           K+PI HGIV +WD ME+      +  LR  PE+H  LLTE PLN   NRE   +IMFE+F
Sbjct: 26  KWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESF 85

Query: 438 NTPAMYVAIQAVLSLYAS 491
           N P +Y+A+QAVL+L AS
Sbjct: 86  NVPGLYIAVQAVLALAAS 103



 Score = 51.6 bits (118), Expect = 2e-06
 Identities = 19/45 (42%), Positives = 33/45 (73%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTER 643
           V++SGDGV+H +P+ EGY +   I  + +AGRD+T ++ ++L +R
Sbjct: 118 VINSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDR 162


>BC015207-1|AAH15207.1|  348|Homo sapiens ARP3 actin-related protein
           3 homolog B (yeast) protein.
          Length = 348

 Score = 93.9 bits (223), Expect = 5e-19
 Identities = 40/78 (51%), Positives = 54/78 (69%)
 Frame = +3

Query: 258 KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETF 437
           K+PI HGI+ +WD ME+      +  LR  PE+H  L+TE PLN   NRE + +IMFE+F
Sbjct: 75  KWPIRHGIIEDWDLMERFMEQVVFKYLRAEPEDHYFLMTEPPLNTPENREYLAEIMFESF 134

Query: 438 NTPAMYVAIQAVLSLYAS 491
           N P +Y+A+QAVL+L AS
Sbjct: 135 NVPGLYIAVQAVLALAAS 152



 Score = 54.8 bits (126), Expect = 3e-07
 Identities = 21/45 (46%), Positives = 33/45 (73%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTER 643
           V+DSGDGV+H +P+ EGY +   I  + +AGRD+T ++ ++L ER
Sbjct: 167 VIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRER 211



 Score = 34.7 bits (76), Expect = 0.30
 Identities = 20/61 (32%), Positives = 31/61 (50%), Gaps = 8/61 (13%)
 Frame = +1

Query: 82  VVDNGSGMCKAGFAGDDAPRAVFPSIVG--------RPRHQGVMVGMGQKDSYVGDEAQS 237
           VVD G+G  K G+AG+  P+ + PS +             + V+ G+   D ++GDEA  
Sbjct: 9   VVDCGTGYTKLGYAGNTEPQFIIPSCIAIRESAKVVDQAQRRVLRGVDDLDFFIGDEAID 68

Query: 238 K 240
           K
Sbjct: 69  K 69


>BC008682-1|AAH08682.1|  418|Homo sapiens ARP3 actin-related protein
           3 homolog B (yeast) protein.
          Length = 418

 Score = 93.9 bits (223), Expect = 5e-19
 Identities = 40/78 (51%), Positives = 54/78 (69%)
 Frame = +3

Query: 258 KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETF 437
           K+PI HGI+ +WD ME+      +  LR  PE+H  L+TE PLN   NRE + +IMFE+F
Sbjct: 75  KWPIRHGIIEDWDLMERFMEQVVFKYLRAEPEDHYFLMTEPPLNTPENREYLAEIMFESF 134

Query: 438 NTPAMYVAIQAVLSLYAS 491
           N P +Y+A+QAVL+L AS
Sbjct: 135 NVPGLYIAVQAVLALAAS 152



 Score = 54.8 bits (126), Expect = 3e-07
 Identities = 21/45 (46%), Positives = 33/45 (73%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTER 643
           V+DSGDGV+H +P+ EGY +   I  + +AGRD+T ++ ++L ER
Sbjct: 167 VIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRER 211



 Score = 34.7 bits (76), Expect = 0.30
 Identities = 20/61 (32%), Positives = 31/61 (50%), Gaps = 8/61 (13%)
 Frame = +1

Query: 82  VVDNGSGMCKAGFAGDDAPRAVFPSIVG--------RPRHQGVMVGMGQKDSYVGDEAQS 237
           VVD G+G  K G+AG+  P+ + PS +             + V+ G+   D ++GDEA  
Sbjct: 9   VVDCGTGYTKLGYAGNTEPQFIIPSCIAIRESAKVVDQAQRRVLRGVDDLDFFIGDEAID 68

Query: 238 K 240
           K
Sbjct: 69  K 69


>AF086920-1|AAP97150.1|  402|Homo sapiens actin related protein ARP4
           protein.
          Length = 402

 Score = 93.9 bits (223), Expect = 5e-19
 Identities = 40/78 (51%), Positives = 54/78 (69%)
 Frame = +3

Query: 258 KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETF 437
           K+PI HGI+ +WD ME+      +  LR  PE+H  L+TE PLN   NRE + +IMFE+F
Sbjct: 56  KWPIRHGIIEDWDLMERFMEQVVFKYLRAEPEDHYFLMTEPPLNTPENREYLAEIMFESF 115

Query: 438 NTPAMYVAIQAVLSLYAS 491
           N P +Y+A+QAVL+L AS
Sbjct: 116 NVPGLYIAVQAVLALAAS 133



 Score = 50.8 bits (116), Expect = 4e-06
 Identities = 21/46 (45%), Positives = 33/46 (71%), Gaps = 1/46 (2%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPI-YEGYALPHAILRLDLAGRDLTDYLMKILTER 643
           V+DSGDGV+H +P+  EGY +   I  + +AGRD+T ++ ++L ER
Sbjct: 148 VIDSGDGVTHVIPVGQEGYVIGSCIKHIPIAGRDITYFIQQLLRER 193


>AF023453-1|AAC98904.1|  418|Homo sapiens actin-related protein
           3-beta protein.
          Length = 418

 Score = 93.9 bits (223), Expect = 5e-19
 Identities = 40/78 (51%), Positives = 54/78 (69%)
 Frame = +3

Query: 258 KYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETF 437
           K+PI HGI+ +WD ME+      +  LR  PE+H  L+TE PLN   NRE + +IMFE+F
Sbjct: 75  KWPIRHGIIEDWDLMERFMEQVVFKYLRAEPEDHYFLMTEPPLNTPENREYLAEIMFESF 134

Query: 438 NTPAMYVAIQAVLSLYAS 491
           N P +Y+A+QAVL+L AS
Sbjct: 135 NVPGLYIAVQAVLALAAS 152



 Score = 54.8 bits (126), Expect = 3e-07
 Identities = 21/45 (46%), Positives = 33/45 (73%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTER 643
           V+DSGDGV+H +P+ EGY +   I  + +AGRD+T ++ ++L ER
Sbjct: 167 VIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRER 211



 Score = 34.7 bits (76), Expect = 0.30
 Identities = 20/61 (32%), Positives = 31/61 (50%), Gaps = 8/61 (13%)
 Frame = +1

Query: 82  VVDNGSGMCKAGFAGDDAPRAVFPSIVG--------RPRHQGVMVGMGQKDSYVGDEAQS 237
           VVD G+G  K G+AG+  P+ + PS +             + V+ G+   D ++GDEA  
Sbjct: 9   VVDCGTGYTKLGYAGNTEPQFIIPSCIAIRESAKVVDQAQRRVLRGVDDLDFFIGDEAID 68

Query: 238 K 240
           K
Sbjct: 69  K 69


>BC020944-1|AAH20944.1|  426|Homo sapiens actin-like 6B protein.
          Length = 426

 Score = 87.8 bits (208), Expect = 3e-17
 Identities = 36/95 (37%), Positives = 60/95 (63%)
 Frame = +3

Query: 264 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNT 443
           P+++G++ +W+    I  HT+   ++  P  HPVL++EAP N +A REK+T++MFE +N 
Sbjct: 84  PLKNGMIEDWECFRAILDHTYSKHVKSEPNLHPVLMSEAPWNTRAKREKLTELMFEQYNI 143

Query: 444 PAMYVAIQAVLSLYASGRTTGMCWTPATVSPTPYP 548
           PA ++   AVL+ +A+GR+TG+         T  P
Sbjct: 144 PAFFLCKTAVLTAFANGRSTGLVLDSGATHTTAIP 178



 Score = 42.7 bits (96), Expect = 0.001
 Identities = 19/34 (55%), Positives = 25/34 (73%)
 Frame = +1

Query: 64  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 165
           +EV ALV D GS   +AG+AG+D P+A FP+ VG
Sbjct: 9   DEVGALVFDIGSFSVRAGYAGEDCPKADFPTTVG 42



 Score = 31.9 bits (69), Expect = 2.1
 Identities = 15/51 (29%), Positives = 27/51 (52%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGTRSLP 661
           VLDSG   +  +P+++GY L   I++  LAG  ++    ++  E     +P
Sbjct: 166 VLDSGATHTTAIPVHDGYVLQQGIVKSPLAGDFISMQCRELFQEMAIDIIP 216


>AF053356-5|AAC78795.1|  475|Homo sapiens actin like gene protein.
          Length = 475

 Score = 87.8 bits (208), Expect = 3e-17
 Identities = 36/95 (37%), Positives = 60/95 (63%)
 Frame = +3

Query: 264 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNT 443
           P+++G++ +W+    I  HT+   ++  P  HPVL++EAP N +A REK+T++MFE +N 
Sbjct: 84  PLKNGMIEDWECFRAILDHTYSKHVKSEPNLHPVLMSEAPWNTRAKREKLTELMFEQYNI 143

Query: 444 PAMYVAIQAVLSLYASGRTTGMCWTPATVSPTPYP 548
           PA ++   AVL+ +A+GR+TG+         T  P
Sbjct: 144 PAFFLCKTAVLTAFANGRSTGLVLDSGATHTTAIP 178



 Score = 42.7 bits (96), Expect = 0.001
 Identities = 19/34 (55%), Positives = 25/34 (73%)
 Frame = +1

Query: 64  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 165
           +EV ALV D GS   +AG+AG+D P+A FP+ VG
Sbjct: 9   DEVGALVFDIGSFSVRAGYAGEDCPKADFPTTVG 42



 Score = 31.9 bits (69), Expect = 2.1
 Identities = 15/51 (29%), Positives = 27/51 (52%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGTRSLP 661
           VLDSG   +  +P+++GY L   I++  LAG  ++    ++  E     +P
Sbjct: 166 VLDSGATHTTAIPVHDGYVLQQGIVKSPLAGDFISMQCRELFQEMAIDIIP 216


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 108,957,615
Number of Sequences: 237096
Number of extensions: 2655583
Number of successful extensions: 13392
Number of sequences better than 10.0: 299
Number of HSP's better than 10.0 without gapping: 11919
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 13341
length of database: 76,859,062
effective HSP length: 87
effective length of database: 56,231,710
effective search space used: 7422585720
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).