SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30036
         (699 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

X87373-1|CAA60827.1|  264|Homo sapiens ribosomal protein S3a pro...   140   6e-33
M84711-1|AAA58487.1|  264|Homo sapiens v-fos transformation effe...   140   6e-33
M77234-1|AAA60290.1|  264|Homo sapiens ribosomal protein S3a pro...   140   6e-33
L13802-1|AAA35682.1|  264|Homo sapiens ribosmal protein small su...   140   6e-33
BC071916-1|AAH71916.1|  264|Homo sapiens ribosomal protein S3A p...   140   6e-33
BC070211-1|AAH70211.1|  264|Homo sapiens ribosomal protein S3A p...   140   6e-33
BC066926-1|AAH66926.1|  264|Homo sapiens ribosomal protein S3A p...   140   6e-33
BC030161-1|AAH30161.1|  264|Homo sapiens ribosomal protein S3A p...   140   6e-33
BC019072-1|AAH19072.1|  264|Homo sapiens ribosomal protein S3A p...   140   6e-33
BC017123-1|AAH17123.1|  264|Homo sapiens ribosomal protein S3A p...   140   6e-33
BC009404-1|AAH09404.1|  264|Homo sapiens ribosomal protein S3A p...   140   6e-33
BC009219-1|AAH09219.1|  264|Homo sapiens ribosomal protein S3A p...   140   6e-33
BC006298-1|AAH06298.1|  264|Homo sapiens ribosomal protein S3A p...   140   6e-33
BC004981-1|AAH04981.1|  264|Homo sapiens ribosomal protein S3A p...   140   6e-33
BC001708-1|AAH01708.1|  264|Homo sapiens ribosomal protein S3A p...   140   6e-33
BC000204-1|AAH00204.1|  264|Homo sapiens ribosomal protein S3A p...   140   6e-33
AK122625-1|BAC85495.1|  438|Homo sapiens protein ( Homo sapiens ...    31   3.0  
U61263-1|AAC50934.1|  632|Homo sapiens acetolactate synthase hom...    31   4.0  
BC126913-1|AAI26914.1|  241|Homo sapiens ILVBL protein protein.        30   6.9  
BC011761-1|AAH11761.1|  632|Homo sapiens ilvB (bacterial acetola...    30   6.9  
BC011722-1|AAH11722.1|  632|Homo sapiens ilvB (bacterial acetola...    30   6.9  
AC003956-1|AAB94632.1|  632|Homo sapiens acetolactate synthase p...    30   6.9  
BX322635-1|CAI42530.1|  373|Homo sapiens G protein-coupled recep...    30   9.1  
BC009861-1|AAH09861.1|  373|Homo sapiens G protein-coupled recep...    30   9.1  
AB040801-1|BAA96647.1|  373|Homo sapiens SREB3 protein.                30   9.1  

>X87373-1|CAA60827.1|  264|Homo sapiens ribosomal protein S3a
           protein.
          Length = 264

 Score =  140 bits (338), Expect = 6e-33
 Identities = 67/103 (65%), Positives = 78/103 (75%)
 Frame = +1

Query: 259 LCNFHGMDLTTDKLRWMVKKWQTLIEANIDVKTTDGYVLRVFCIGFTNKDSLSQRKTCYA 438
           L NFHGMDLT DK+  MVKKWQT+IEA++DVKTTDGY+LR+FC+GFT K +   RKT YA
Sbjct: 97  LTNFHGMDLTRDKMCSMVKKWQTMIEAHVDVKTTDGYLLRLFCVGFTKKRNNQIRKTSYA 156

Query: 439 QHTQVRAIRKKMCEIITRDVTNSDSGRW*TS*FPDSIAKDIEK 567
           QH QVR IRKKM EI+TR+V  +D         PDSI KDIEK
Sbjct: 157 QHQQVRQIRKKMMEIMTREVQTNDLKEVVNKLIPDSIGKDIEK 199



 Score =  132 bits (318), Expect = 2e-30
 Identities = 63/86 (73%), Positives = 73/86 (84%)
 Frame = +2

Query: 2   KKGVKKKIVDPFTRKDWYDVKAPSMFSKRQVGTTLVNRTQGTKIASEGLKGRVFEVSLAD 181
           KKG KKK+VDPF++KDWYDVKAP+MF+ R +G TLV RTQGTKIAS+GLKGRVFEVSLAD
Sbjct: 14  KKGAKKKVVDPFSKKDWYDVKAPAMFNIRNIGKTLVTRTQGTKIASDGLKGRVFEVSLAD 73

Query: 182 LQADTDAERSFRKFRLIAEYVQGRMC 259
           LQ D   E +FRKF+LI E VQG+ C
Sbjct: 74  LQND---EVAFRKFKLITEDVQGKNC 96



 Score = 33.5 bits (73), Expect = 0.74
 Identities = 23/51 (45%), Positives = 30/51 (58%)
 Frame = +3

Query: 510 LREVVNKLIS*LHCQGHREGPAMASYPLRDVWHPKVKVLKRAPFSEISKLI 662
           L+EVVNKLI         E    + YPL DV+  KVK+LK+  F E+ KL+
Sbjct: 181 LKEVVNKLIPD-SIGKDIEKACQSIYPLHDVFVRKVKMLKKPKF-ELGKLM 229


>M84711-1|AAA58487.1|  264|Homo sapiens v-fos transformation
           effector protein protein.
          Length = 264

 Score =  140 bits (338), Expect = 6e-33
 Identities = 67/103 (65%), Positives = 78/103 (75%)
 Frame = +1

Query: 259 LCNFHGMDLTTDKLRWMVKKWQTLIEANIDVKTTDGYVLRVFCIGFTNKDSLSQRKTCYA 438
           L NFHGMDLT DK+  MVKKWQT+IEA++DVKTTDGY+LR+FC+GFT K +   RKT YA
Sbjct: 97  LTNFHGMDLTRDKMCSMVKKWQTMIEAHVDVKTTDGYLLRLFCVGFTKKRNNQIRKTSYA 156

Query: 439 QHTQVRAIRKKMCEIITRDVTNSDSGRW*TS*FPDSIAKDIEK 567
           QH QVR IRKKM EI+TR+V  +D         PDSI KDIEK
Sbjct: 157 QHQQVRQIRKKMMEIMTREVQTNDLKEVVNKLIPDSIGKDIEK 199



 Score =  132 bits (318), Expect = 2e-30
 Identities = 63/86 (73%), Positives = 73/86 (84%)
 Frame = +2

Query: 2   KKGVKKKIVDPFTRKDWYDVKAPSMFSKRQVGTTLVNRTQGTKIASEGLKGRVFEVSLAD 181
           KKG KKK+VDPF++KDWYDVKAP+MF+ R +G TLV RTQGTKIAS+GLKGRVFEVSLAD
Sbjct: 14  KKGAKKKVVDPFSKKDWYDVKAPAMFNIRNIGKTLVTRTQGTKIASDGLKGRVFEVSLAD 73

Query: 182 LQADTDAERSFRKFRLIAEYVQGRMC 259
           LQ D   E +FRKF+LI E VQG+ C
Sbjct: 74  LQND---EVAFRKFKLITEDVQGKNC 96



 Score = 33.5 bits (73), Expect = 0.74
 Identities = 23/51 (45%), Positives = 30/51 (58%)
 Frame = +3

Query: 510 LREVVNKLIS*LHCQGHREGPAMASYPLRDVWHPKVKVLKRAPFSEISKLI 662
           L+EVVNKLI         E    + YPL DV+  KVK+LK+  F E+ KL+
Sbjct: 181 LKEVVNKLIPD-SIGKDIEKACQSIYPLHDVFVRKVKMLKKPKF-ELGKLM 229


>M77234-1|AAA60290.1|  264|Homo sapiens ribosomal protein S3a
           protein.
          Length = 264

 Score =  140 bits (338), Expect = 6e-33
 Identities = 67/103 (65%), Positives = 78/103 (75%)
 Frame = +1

Query: 259 LCNFHGMDLTTDKLRWMVKKWQTLIEANIDVKTTDGYVLRVFCIGFTNKDSLSQRKTCYA 438
           L NFHGMDLT DK+  MVKKWQT+IEA++DVKTTDGY+LR+FC+GFT K +   RKT YA
Sbjct: 97  LTNFHGMDLTRDKMCSMVKKWQTMIEAHVDVKTTDGYLLRLFCVGFTKKRNNQIRKTSYA 156

Query: 439 QHTQVRAIRKKMCEIITRDVTNSDSGRW*TS*FPDSIAKDIEK 567
           QH QVR IRKKM EI+TR+V  +D         PDSI KDIEK
Sbjct: 157 QHQQVRQIRKKMMEIMTREVQTNDLKEVVNKLIPDSIGKDIEK 199



 Score =  132 bits (318), Expect = 2e-30
 Identities = 63/86 (73%), Positives = 73/86 (84%)
 Frame = +2

Query: 2   KKGVKKKIVDPFTRKDWYDVKAPSMFSKRQVGTTLVNRTQGTKIASEGLKGRVFEVSLAD 181
           KKG KKK+VDPF++KDWYDVKAP+MF+ R +G TLV RTQGTKIAS+GLKGRVFEVSLAD
Sbjct: 14  KKGAKKKVVDPFSKKDWYDVKAPAMFNIRNIGKTLVTRTQGTKIASDGLKGRVFEVSLAD 73

Query: 182 LQADTDAERSFRKFRLIAEYVQGRMC 259
           LQ D   E +FRKF+LI E VQG+ C
Sbjct: 74  LQND---EVAFRKFKLITEDVQGKNC 96



 Score = 33.5 bits (73), Expect = 0.74
 Identities = 23/51 (45%), Positives = 30/51 (58%)
 Frame = +3

Query: 510 LREVVNKLIS*LHCQGHREGPAMASYPLRDVWHPKVKVLKRAPFSEISKLI 662
           L+EVVNKLI         E    + YPL DV+  KVK+LK+  F E+ KL+
Sbjct: 181 LKEVVNKLIPD-SIGKDIEKACQSIYPLHDVFVRKVKMLKKPKF-ELGKLM 229


>L13802-1|AAA35682.1|  264|Homo sapiens ribosmal protein small
           subunit protein.
          Length = 264

 Score =  140 bits (338), Expect = 6e-33
 Identities = 67/103 (65%), Positives = 78/103 (75%)
 Frame = +1

Query: 259 LCNFHGMDLTTDKLRWMVKKWQTLIEANIDVKTTDGYVLRVFCIGFTNKDSLSQRKTCYA 438
           L NFHGMDLT DK+  MVKKWQT+IEA++DVKTTDGY+LR+FC+GFT K +   RKT YA
Sbjct: 97  LTNFHGMDLTRDKMCSMVKKWQTMIEAHVDVKTTDGYLLRLFCVGFTKKRNNQIRKTSYA 156

Query: 439 QHTQVRAIRKKMCEIITRDVTNSDSGRW*TS*FPDSIAKDIEK 567
           QH QVR IRKKM EI+TR+V  +D         PDSI KDIEK
Sbjct: 157 QHQQVRQIRKKMMEIMTREVQTNDLKEVVNKLIPDSIGKDIEK 199



 Score =  132 bits (318), Expect = 2e-30
 Identities = 63/86 (73%), Positives = 73/86 (84%)
 Frame = +2

Query: 2   KKGVKKKIVDPFTRKDWYDVKAPSMFSKRQVGTTLVNRTQGTKIASEGLKGRVFEVSLAD 181
           KKG KKK+VDPF++KDWYDVKAP+MF+ R +G TLV RTQGTKIAS+GLKGRVFEVSLAD
Sbjct: 14  KKGAKKKVVDPFSKKDWYDVKAPAMFNIRNIGKTLVTRTQGTKIASDGLKGRVFEVSLAD 73

Query: 182 LQADTDAERSFRKFRLIAEYVQGRMC 259
           LQ D   E +FRKF+LI E VQG+ C
Sbjct: 74  LQND---EVAFRKFKLITEDVQGKNC 96



 Score = 33.5 bits (73), Expect = 0.74
 Identities = 23/51 (45%), Positives = 30/51 (58%)
 Frame = +3

Query: 510 LREVVNKLIS*LHCQGHREGPAMASYPLRDVWHPKVKVLKRAPFSEISKLI 662
           L+EVVNKLI         E    + YPL DV+  KVK+LK+  F E+ KL+
Sbjct: 181 LKEVVNKLIPD-SIGKDIEKACQSIYPLHDVFVRKVKMLKKPKF-ELGKLM 229


>BC071916-1|AAH71916.1|  264|Homo sapiens ribosomal protein S3A
           protein.
          Length = 264

 Score =  140 bits (338), Expect = 6e-33
 Identities = 67/103 (65%), Positives = 78/103 (75%)
 Frame = +1

Query: 259 LCNFHGMDLTTDKLRWMVKKWQTLIEANIDVKTTDGYVLRVFCIGFTNKDSLSQRKTCYA 438
           L NFHGMDLT DK+  MVKKWQT+IEA++DVKTTDGY+LR+FC+GFT K +   RKT YA
Sbjct: 97  LTNFHGMDLTRDKMCSMVKKWQTMIEAHVDVKTTDGYLLRLFCVGFTKKRNNQIRKTSYA 156

Query: 439 QHTQVRAIRKKMCEIITRDVTNSDSGRW*TS*FPDSIAKDIEK 567
           QH QVR IRKKM EI+TR+V  +D         PDSI KDIEK
Sbjct: 157 QHQQVRQIRKKMMEIMTREVQTNDLKEVVNKLIPDSIGKDIEK 199



 Score =  132 bits (318), Expect = 2e-30
 Identities = 63/86 (73%), Positives = 73/86 (84%)
 Frame = +2

Query: 2   KKGVKKKIVDPFTRKDWYDVKAPSMFSKRQVGTTLVNRTQGTKIASEGLKGRVFEVSLAD 181
           KKG KKK+VDPF++KDWYDVKAP+MF+ R +G TLV RTQGTKIAS+GLKGRVFEVSLAD
Sbjct: 14  KKGAKKKVVDPFSKKDWYDVKAPAMFNIRNIGKTLVTRTQGTKIASDGLKGRVFEVSLAD 73

Query: 182 LQADTDAERSFRKFRLIAEYVQGRMC 259
           LQ D   E +FRKF+LI E VQG+ C
Sbjct: 74  LQND---EVAFRKFKLITEDVQGKNC 96



 Score = 33.5 bits (73), Expect = 0.74
 Identities = 23/51 (45%), Positives = 30/51 (58%)
 Frame = +3

Query: 510 LREVVNKLIS*LHCQGHREGPAMASYPLRDVWHPKVKVLKRAPFSEISKLI 662
           L+EVVNKLI         E    + YPL DV+  KVK+LK+  F E+ KL+
Sbjct: 181 LKEVVNKLIPD-SIGKDIEKACQSIYPLHDVFVRKVKMLKKPKF-ELGKLM 229


>BC070211-1|AAH70211.1|  264|Homo sapiens ribosomal protein S3A
           protein.
          Length = 264

 Score =  140 bits (338), Expect = 6e-33
 Identities = 67/103 (65%), Positives = 78/103 (75%)
 Frame = +1

Query: 259 LCNFHGMDLTTDKLRWMVKKWQTLIEANIDVKTTDGYVLRVFCIGFTNKDSLSQRKTCYA 438
           L NFHGMDLT DK+  MVKKWQT+IEA++DVKTTDGY+LR+FC+GFT K +   RKT YA
Sbjct: 97  LTNFHGMDLTRDKMCSMVKKWQTMIEAHVDVKTTDGYLLRLFCVGFTKKRNNQIRKTSYA 156

Query: 439 QHTQVRAIRKKMCEIITRDVTNSDSGRW*TS*FPDSIAKDIEK 567
           QH QVR IRKKM EI+TR+V  +D         PDSI KDIEK
Sbjct: 157 QHQQVRQIRKKMMEIMTREVQTNDLKEVVNKLIPDSIGKDIEK 199



 Score =  132 bits (318), Expect = 2e-30
 Identities = 63/86 (73%), Positives = 73/86 (84%)
 Frame = +2

Query: 2   KKGVKKKIVDPFTRKDWYDVKAPSMFSKRQVGTTLVNRTQGTKIASEGLKGRVFEVSLAD 181
           KKG KKK+VDPF++KDWYDVKAP+MF+ R +G TLV RTQGTKIAS+GLKGRVFEVSLAD
Sbjct: 14  KKGAKKKVVDPFSKKDWYDVKAPAMFNIRNIGKTLVTRTQGTKIASDGLKGRVFEVSLAD 73

Query: 182 LQADTDAERSFRKFRLIAEYVQGRMC 259
           LQ D   E +FRKF+LI E VQG+ C
Sbjct: 74  LQND---EVAFRKFKLITEDVQGKNC 96



 Score = 33.5 bits (73), Expect = 0.74
 Identities = 23/51 (45%), Positives = 30/51 (58%)
 Frame = +3

Query: 510 LREVVNKLIS*LHCQGHREGPAMASYPLRDVWHPKVKVLKRAPFSEISKLI 662
           L+EVVNKLI         E    + YPL DV+  KVK+LK+  F E+ KL+
Sbjct: 181 LKEVVNKLIPD-SIGKDIEKACQSIYPLHDVFVRKVKMLKKPKF-ELGKLM 229


>BC066926-1|AAH66926.1|  264|Homo sapiens ribosomal protein S3A
           protein.
          Length = 264

 Score =  140 bits (338), Expect = 6e-33
 Identities = 67/103 (65%), Positives = 78/103 (75%)
 Frame = +1

Query: 259 LCNFHGMDLTTDKLRWMVKKWQTLIEANIDVKTTDGYVLRVFCIGFTNKDSLSQRKTCYA 438
           L NFHGMDLT DK+  MVKKWQT+IEA++DVKTTDGY+LR+FC+GFT K +   RKT YA
Sbjct: 97  LTNFHGMDLTRDKMCSMVKKWQTMIEAHVDVKTTDGYLLRLFCVGFTKKRNNQIRKTSYA 156

Query: 439 QHTQVRAIRKKMCEIITRDVTNSDSGRW*TS*FPDSIAKDIEK 567
           QH QVR IRKKM EI+TR+V  +D         PDSI KDIEK
Sbjct: 157 QHQQVRQIRKKMMEIMTREVQTNDLKEVVNKLIPDSIGKDIEK 199



 Score =  132 bits (318), Expect = 2e-30
 Identities = 63/86 (73%), Positives = 73/86 (84%)
 Frame = +2

Query: 2   KKGVKKKIVDPFTRKDWYDVKAPSMFSKRQVGTTLVNRTQGTKIASEGLKGRVFEVSLAD 181
           KKG KKK+VDPF++KDWYDVKAP+MF+ R +G TLV RTQGTKIAS+GLKGRVFEVSLAD
Sbjct: 14  KKGAKKKVVDPFSKKDWYDVKAPAMFNIRNIGKTLVTRTQGTKIASDGLKGRVFEVSLAD 73

Query: 182 LQADTDAERSFRKFRLIAEYVQGRMC 259
           LQ D   E +FRKF+LI E VQG+ C
Sbjct: 74  LQND---EVAFRKFKLITEDVQGKNC 96



 Score = 33.5 bits (73), Expect = 0.74
 Identities = 23/51 (45%), Positives = 30/51 (58%)
 Frame = +3

Query: 510 LREVVNKLIS*LHCQGHREGPAMASYPLRDVWHPKVKVLKRAPFSEISKLI 662
           L+EVVNKLI         E    + YPL DV+  KVK+LK+  F E+ KL+
Sbjct: 181 LKEVVNKLIPD-SIGKDIEKACQSIYPLHDVFVRKVKMLKKPKF-ELGKLM 229


>BC030161-1|AAH30161.1|  264|Homo sapiens ribosomal protein S3A
           protein.
          Length = 264

 Score =  140 bits (338), Expect = 6e-33
 Identities = 67/103 (65%), Positives = 78/103 (75%)
 Frame = +1

Query: 259 LCNFHGMDLTTDKLRWMVKKWQTLIEANIDVKTTDGYVLRVFCIGFTNKDSLSQRKTCYA 438
           L NFHGMDLT DK+  MVKKWQT+IEA++DVKTTDGY+LR+FC+GFT K +   RKT YA
Sbjct: 97  LTNFHGMDLTRDKMCSMVKKWQTMIEAHVDVKTTDGYLLRLFCVGFTKKRNNQIRKTSYA 156

Query: 439 QHTQVRAIRKKMCEIITRDVTNSDSGRW*TS*FPDSIAKDIEK 567
           QH QVR IRKKM EI+TR+V  +D         PDSI KDIEK
Sbjct: 157 QHQQVRQIRKKMMEIMTREVQTNDLKEVVNKLIPDSIGKDIEK 199



 Score =  132 bits (318), Expect = 2e-30
 Identities = 63/86 (73%), Positives = 73/86 (84%)
 Frame = +2

Query: 2   KKGVKKKIVDPFTRKDWYDVKAPSMFSKRQVGTTLVNRTQGTKIASEGLKGRVFEVSLAD 181
           KKG KKK+VDPF++KDWYDVKAP+MF+ R +G TLV RTQGTKIAS+GLKGRVFEVSLAD
Sbjct: 14  KKGAKKKVVDPFSKKDWYDVKAPAMFNIRNIGKTLVTRTQGTKIASDGLKGRVFEVSLAD 73

Query: 182 LQADTDAERSFRKFRLIAEYVQGRMC 259
           LQ D   E +FRKF+LI E VQG+ C
Sbjct: 74  LQND---EVAFRKFKLITEDVQGKNC 96



 Score = 33.5 bits (73), Expect = 0.74
 Identities = 23/51 (45%), Positives = 30/51 (58%)
 Frame = +3

Query: 510 LREVVNKLIS*LHCQGHREGPAMASYPLRDVWHPKVKVLKRAPFSEISKLI 662
           L+EVVNKLI         E    + YPL DV+  KVK+LK+  F E+ KL+
Sbjct: 181 LKEVVNKLIPD-SIGKDIEKACQSIYPLHDVFVRKVKMLKKPKF-ELGKLM 229


>BC019072-1|AAH19072.1|  264|Homo sapiens ribosomal protein S3A
           protein.
          Length = 264

 Score =  140 bits (338), Expect = 6e-33
 Identities = 67/103 (65%), Positives = 78/103 (75%)
 Frame = +1

Query: 259 LCNFHGMDLTTDKLRWMVKKWQTLIEANIDVKTTDGYVLRVFCIGFTNKDSLSQRKTCYA 438
           L NFHGMDLT DK+  MVKKWQT+IEA++DVKTTDGY+LR+FC+GFT K +   RKT YA
Sbjct: 97  LTNFHGMDLTRDKMCSMVKKWQTMIEAHVDVKTTDGYLLRLFCVGFTKKRNNQIRKTSYA 156

Query: 439 QHTQVRAIRKKMCEIITRDVTNSDSGRW*TS*FPDSIAKDIEK 567
           QH QVR IRKKM EI+TR+V  +D         PDSI KDIEK
Sbjct: 157 QHQQVRQIRKKMMEIMTREVQTNDLKEVVNKLIPDSIGKDIEK 199



 Score =  132 bits (318), Expect = 2e-30
 Identities = 63/86 (73%), Positives = 73/86 (84%)
 Frame = +2

Query: 2   KKGVKKKIVDPFTRKDWYDVKAPSMFSKRQVGTTLVNRTQGTKIASEGLKGRVFEVSLAD 181
           KKG KKK+VDPF++KDWYDVKAP+MF+ R +G TLV RTQGTKIAS+GLKGRVFEVSLAD
Sbjct: 14  KKGAKKKVVDPFSKKDWYDVKAPAMFNIRNIGKTLVTRTQGTKIASDGLKGRVFEVSLAD 73

Query: 182 LQADTDAERSFRKFRLIAEYVQGRMC 259
           LQ D   E +FRKF+LI E VQG+ C
Sbjct: 74  LQND---EVAFRKFKLITEDVQGKNC 96



 Score = 33.5 bits (73), Expect = 0.74
 Identities = 23/51 (45%), Positives = 30/51 (58%)
 Frame = +3

Query: 510 LREVVNKLIS*LHCQGHREGPAMASYPLRDVWHPKVKVLKRAPFSEISKLI 662
           L+EVVNKLI         E    + YPL DV+  KVK+LK+  F E+ KL+
Sbjct: 181 LKEVVNKLIPD-SIGKDIEKACQSIYPLHDVFVRKVKMLKKPKF-ELGKLM 229


>BC017123-1|AAH17123.1|  264|Homo sapiens ribosomal protein S3A
           protein.
          Length = 264

 Score =  140 bits (338), Expect = 6e-33
 Identities = 67/103 (65%), Positives = 78/103 (75%)
 Frame = +1

Query: 259 LCNFHGMDLTTDKLRWMVKKWQTLIEANIDVKTTDGYVLRVFCIGFTNKDSLSQRKTCYA 438
           L NFHGMDLT DK+  MVKKWQT+IEA++DVKTTDGY+LR+FC+GFT K +   RKT YA
Sbjct: 97  LTNFHGMDLTRDKMCSMVKKWQTMIEAHVDVKTTDGYLLRLFCVGFTKKRNNQIRKTSYA 156

Query: 439 QHTQVRAIRKKMCEIITRDVTNSDSGRW*TS*FPDSIAKDIEK 567
           QH QVR IRKKM EI+TR+V  +D         PDSI KDIEK
Sbjct: 157 QHQQVRQIRKKMMEIMTREVQTNDLKEVVNKLIPDSIGKDIEK 199



 Score =  132 bits (318), Expect = 2e-30
 Identities = 63/86 (73%), Positives = 73/86 (84%)
 Frame = +2

Query: 2   KKGVKKKIVDPFTRKDWYDVKAPSMFSKRQVGTTLVNRTQGTKIASEGLKGRVFEVSLAD 181
           KKG KKK+VDPF++KDWYDVKAP+MF+ R +G TLV RTQGTKIAS+GLKGRVFEVSLAD
Sbjct: 14  KKGAKKKVVDPFSKKDWYDVKAPAMFNIRNIGKTLVTRTQGTKIASDGLKGRVFEVSLAD 73

Query: 182 LQADTDAERSFRKFRLIAEYVQGRMC 259
           LQ D   E +FRKF+LI E VQG+ C
Sbjct: 74  LQND---EVAFRKFKLITEDVQGKNC 96



 Score = 33.5 bits (73), Expect = 0.74
 Identities = 23/51 (45%), Positives = 30/51 (58%)
 Frame = +3

Query: 510 LREVVNKLIS*LHCQGHREGPAMASYPLRDVWHPKVKVLKRAPFSEISKLI 662
           L+EVVNKLI         E    + YPL DV+  KVK+LK+  F E+ KL+
Sbjct: 181 LKEVVNKLIPD-SIGKDIEKACQSIYPLHDVFVRKVKMLKKPKF-ELGKLM 229


>BC009404-1|AAH09404.1|  264|Homo sapiens ribosomal protein S3A
           protein.
          Length = 264

 Score =  140 bits (338), Expect = 6e-33
 Identities = 67/103 (65%), Positives = 78/103 (75%)
 Frame = +1

Query: 259 LCNFHGMDLTTDKLRWMVKKWQTLIEANIDVKTTDGYVLRVFCIGFTNKDSLSQRKTCYA 438
           L NFHGMDLT DK+  MVKKWQT+IEA++DVKTTDGY+LR+FC+GFT K +   RKT YA
Sbjct: 97  LTNFHGMDLTRDKMCSMVKKWQTMIEAHVDVKTTDGYLLRLFCVGFTKKRNNQIRKTSYA 156

Query: 439 QHTQVRAIRKKMCEIITRDVTNSDSGRW*TS*FPDSIAKDIEK 567
           QH QVR IRKKM EI+TR+V  +D         PDSI KDIEK
Sbjct: 157 QHQQVRQIRKKMMEIMTREVQTNDLKEVVNKLIPDSIGKDIEK 199



 Score =  132 bits (318), Expect = 2e-30
 Identities = 63/86 (73%), Positives = 73/86 (84%)
 Frame = +2

Query: 2   KKGVKKKIVDPFTRKDWYDVKAPSMFSKRQVGTTLVNRTQGTKIASEGLKGRVFEVSLAD 181
           KKG KKK+VDPF++KDWYDVKAP+MF+ R +G TLV RTQGTKIAS+GLKGRVFEVSLAD
Sbjct: 14  KKGAKKKVVDPFSKKDWYDVKAPAMFNIRNIGKTLVTRTQGTKIASDGLKGRVFEVSLAD 73

Query: 182 LQADTDAERSFRKFRLIAEYVQGRMC 259
           LQ D   E +FRKF+LI E VQG+ C
Sbjct: 74  LQND---EVAFRKFKLITEDVQGKNC 96



 Score = 33.5 bits (73), Expect = 0.74
 Identities = 23/51 (45%), Positives = 30/51 (58%)
 Frame = +3

Query: 510 LREVVNKLIS*LHCQGHREGPAMASYPLRDVWHPKVKVLKRAPFSEISKLI 662
           L+EVVNKLI         E    + YPL DV+  KVK+LK+  F E+ KL+
Sbjct: 181 LKEVVNKLIPD-SIGKDIEKACQSIYPLHDVFVRKVKMLKKPKF-ELGKLM 229


>BC009219-1|AAH09219.1|  264|Homo sapiens ribosomal protein S3A
           protein.
          Length = 264

 Score =  140 bits (338), Expect = 6e-33
 Identities = 67/103 (65%), Positives = 78/103 (75%)
 Frame = +1

Query: 259 LCNFHGMDLTTDKLRWMVKKWQTLIEANIDVKTTDGYVLRVFCIGFTNKDSLSQRKTCYA 438
           L NFHGMDLT DK+  MVKKWQT+IEA++DVKTTDGY+LR+FC+GFT K +   RKT YA
Sbjct: 97  LTNFHGMDLTRDKMCSMVKKWQTMIEAHVDVKTTDGYLLRLFCVGFTKKRNNQIRKTSYA 156

Query: 439 QHTQVRAIRKKMCEIITRDVTNSDSGRW*TS*FPDSIAKDIEK 567
           QH QVR IRKKM EI+TR+V  +D         PDSI KDIEK
Sbjct: 157 QHQQVRQIRKKMMEIMTREVQTNDLKEVVNKLIPDSIGKDIEK 199



 Score =  132 bits (318), Expect = 2e-30
 Identities = 63/86 (73%), Positives = 73/86 (84%)
 Frame = +2

Query: 2   KKGVKKKIVDPFTRKDWYDVKAPSMFSKRQVGTTLVNRTQGTKIASEGLKGRVFEVSLAD 181
           KKG KKK+VDPF++KDWYDVKAP+MF+ R +G TLV RTQGTKIAS+GLKGRVFEVSLAD
Sbjct: 14  KKGAKKKVVDPFSKKDWYDVKAPAMFNIRNIGKTLVTRTQGTKIASDGLKGRVFEVSLAD 73

Query: 182 LQADTDAERSFRKFRLIAEYVQGRMC 259
           LQ D   E +FRKF+LI E VQG+ C
Sbjct: 74  LQND---EVAFRKFKLITEDVQGKNC 96



 Score = 33.5 bits (73), Expect = 0.74
 Identities = 23/51 (45%), Positives = 30/51 (58%)
 Frame = +3

Query: 510 LREVVNKLIS*LHCQGHREGPAMASYPLRDVWHPKVKVLKRAPFSEISKLI 662
           L+EVVNKLI         E    + YPL DV+  KVK+LK+  F E+ KL+
Sbjct: 181 LKEVVNKLIPD-SIGKDIEKACQSIYPLHDVFVRKVKMLKKPKF-ELGKLM 229


>BC006298-1|AAH06298.1|  264|Homo sapiens ribosomal protein S3A
           protein.
          Length = 264

 Score =  140 bits (338), Expect = 6e-33
 Identities = 67/103 (65%), Positives = 78/103 (75%)
 Frame = +1

Query: 259 LCNFHGMDLTTDKLRWMVKKWQTLIEANIDVKTTDGYVLRVFCIGFTNKDSLSQRKTCYA 438
           L NFHGMDLT DK+  MVKKWQT+IEA++DVKTTDGY+LR+FC+GFT K +   RKT YA
Sbjct: 97  LTNFHGMDLTRDKMCSMVKKWQTMIEAHVDVKTTDGYLLRLFCVGFTKKRNNQIRKTSYA 156

Query: 439 QHTQVRAIRKKMCEIITRDVTNSDSGRW*TS*FPDSIAKDIEK 567
           QH QVR IRKKM EI+TR+V  +D         PDSI KDIEK
Sbjct: 157 QHQQVRQIRKKMMEIMTREVQTNDLKEVVNKLIPDSIGKDIEK 199



 Score =  132 bits (318), Expect = 2e-30
 Identities = 63/86 (73%), Positives = 73/86 (84%)
 Frame = +2

Query: 2   KKGVKKKIVDPFTRKDWYDVKAPSMFSKRQVGTTLVNRTQGTKIASEGLKGRVFEVSLAD 181
           KKG KKK+VDPF++KDWYDVKAP+MF+ R +G TLV RTQGTKIAS+GLKGRVFEVSLAD
Sbjct: 14  KKGAKKKVVDPFSKKDWYDVKAPAMFNIRNIGKTLVTRTQGTKIASDGLKGRVFEVSLAD 73

Query: 182 LQADTDAERSFRKFRLIAEYVQGRMC 259
           LQ D   E +FRKF+LI E VQG+ C
Sbjct: 74  LQND---EVAFRKFKLITEDVQGKNC 96



 Score = 33.5 bits (73), Expect = 0.74
 Identities = 23/51 (45%), Positives = 30/51 (58%)
 Frame = +3

Query: 510 LREVVNKLIS*LHCQGHREGPAMASYPLRDVWHPKVKVLKRAPFSEISKLI 662
           L+EVVNKLI         E    + YPL DV+  KVK+LK+  F E+ KL+
Sbjct: 181 LKEVVNKLIPD-SIGKDIEKACQSIYPLHDVFVRKVKMLKKPKF-ELGKLM 229


>BC004981-1|AAH04981.1|  264|Homo sapiens ribosomal protein S3A
           protein.
          Length = 264

 Score =  140 bits (338), Expect = 6e-33
 Identities = 67/103 (65%), Positives = 78/103 (75%)
 Frame = +1

Query: 259 LCNFHGMDLTTDKLRWMVKKWQTLIEANIDVKTTDGYVLRVFCIGFTNKDSLSQRKTCYA 438
           L NFHGMDLT DK+  MVKKWQT+IEA++DVKTTDGY+LR+FC+GFT K +   RKT YA
Sbjct: 97  LTNFHGMDLTRDKMCSMVKKWQTMIEAHVDVKTTDGYLLRLFCVGFTKKRNNQIRKTSYA 156

Query: 439 QHTQVRAIRKKMCEIITRDVTNSDSGRW*TS*FPDSIAKDIEK 567
           QH QVR IRKKM EI+TR+V  +D         PDSI KDIEK
Sbjct: 157 QHQQVRQIRKKMMEIMTREVQTNDLKEVVNKLIPDSIGKDIEK 199



 Score =  132 bits (318), Expect = 2e-30
 Identities = 63/86 (73%), Positives = 73/86 (84%)
 Frame = +2

Query: 2   KKGVKKKIVDPFTRKDWYDVKAPSMFSKRQVGTTLVNRTQGTKIASEGLKGRVFEVSLAD 181
           KKG KKK+VDPF++KDWYDVKAP+MF+ R +G TLV RTQGTKIAS+GLKGRVFEVSLAD
Sbjct: 14  KKGAKKKVVDPFSKKDWYDVKAPAMFNIRNIGKTLVTRTQGTKIASDGLKGRVFEVSLAD 73

Query: 182 LQADTDAERSFRKFRLIAEYVQGRMC 259
           LQ D   E +FRKF+LI E VQG+ C
Sbjct: 74  LQND---EVAFRKFKLITEDVQGKNC 96



 Score = 33.5 bits (73), Expect = 0.74
 Identities = 23/51 (45%), Positives = 30/51 (58%)
 Frame = +3

Query: 510 LREVVNKLIS*LHCQGHREGPAMASYPLRDVWHPKVKVLKRAPFSEISKLI 662
           L+EVVNKLI         E    + YPL DV+  KVK+LK+  F E+ KL+
Sbjct: 181 LKEVVNKLIPD-SIGKDIEKACQSIYPLHDVFVRKVKMLKKPKF-ELGKLM 229


>BC001708-1|AAH01708.1|  264|Homo sapiens ribosomal protein S3A
           protein.
          Length = 264

 Score =  140 bits (338), Expect = 6e-33
 Identities = 67/103 (65%), Positives = 78/103 (75%)
 Frame = +1

Query: 259 LCNFHGMDLTTDKLRWMVKKWQTLIEANIDVKTTDGYVLRVFCIGFTNKDSLSQRKTCYA 438
           L NFHGMDLT DK+  MVKKWQT+IEA++DVKTTDGY+LR+FC+GFT K +   RKT YA
Sbjct: 97  LTNFHGMDLTRDKMCSMVKKWQTMIEAHVDVKTTDGYLLRLFCVGFTKKRNNQIRKTSYA 156

Query: 439 QHTQVRAIRKKMCEIITRDVTNSDSGRW*TS*FPDSIAKDIEK 567
           QH QVR IRKKM EI+TR+V  +D         PDSI KDIEK
Sbjct: 157 QHQQVRQIRKKMMEIMTREVQTNDLKEVVNKLIPDSIGKDIEK 199



 Score =  132 bits (318), Expect = 2e-30
 Identities = 63/86 (73%), Positives = 73/86 (84%)
 Frame = +2

Query: 2   KKGVKKKIVDPFTRKDWYDVKAPSMFSKRQVGTTLVNRTQGTKIASEGLKGRVFEVSLAD 181
           KKG KKK+VDPF++KDWYDVKAP+MF+ R +G TLV RTQGTKIAS+GLKGRVFEVSLAD
Sbjct: 14  KKGAKKKVVDPFSKKDWYDVKAPAMFNIRNIGKTLVTRTQGTKIASDGLKGRVFEVSLAD 73

Query: 182 LQADTDAERSFRKFRLIAEYVQGRMC 259
           LQ D   E +FRKF+LI E VQG+ C
Sbjct: 74  LQND---EVAFRKFKLITEDVQGKNC 96



 Score = 33.5 bits (73), Expect = 0.74
 Identities = 23/51 (45%), Positives = 30/51 (58%)
 Frame = +3

Query: 510 LREVVNKLIS*LHCQGHREGPAMASYPLRDVWHPKVKVLKRAPFSEISKLI 662
           L+EVVNKLI         E    + YPL DV+  KVK+LK+  F E+ KL+
Sbjct: 181 LKEVVNKLIPD-SIGKDIEKACQSIYPLHDVFVRKVKMLKKPKF-ELGKLM 229


>BC000204-1|AAH00204.1|  264|Homo sapiens ribosomal protein S3A
           protein.
          Length = 264

 Score =  140 bits (338), Expect = 6e-33
 Identities = 67/103 (65%), Positives = 78/103 (75%)
 Frame = +1

Query: 259 LCNFHGMDLTTDKLRWMVKKWQTLIEANIDVKTTDGYVLRVFCIGFTNKDSLSQRKTCYA 438
           L NFHGMDLT DK+  MVKKWQT+IEA++DVKTTDGY+LR+FC+GFT K +   RKT YA
Sbjct: 97  LTNFHGMDLTRDKMCSMVKKWQTMIEAHVDVKTTDGYLLRLFCVGFTKKRNNQIRKTSYA 156

Query: 439 QHTQVRAIRKKMCEIITRDVTNSDSGRW*TS*FPDSIAKDIEK 567
           QH QVR IRKKM EI+TR+V  +D         PDSI KDIEK
Sbjct: 157 QHQQVRQIRKKMMEIMTREVQTNDLKEVVNKLIPDSIGKDIEK 199



 Score =  132 bits (318), Expect = 2e-30
 Identities = 63/86 (73%), Positives = 73/86 (84%)
 Frame = +2

Query: 2   KKGVKKKIVDPFTRKDWYDVKAPSMFSKRQVGTTLVNRTQGTKIASEGLKGRVFEVSLAD 181
           KKG KKK+VDPF++KDWYDVKAP+MF+ R +G TLV RTQGTKIAS+GLKGRVFEVSLAD
Sbjct: 14  KKGAKKKVVDPFSKKDWYDVKAPAMFNIRNIGKTLVTRTQGTKIASDGLKGRVFEVSLAD 73

Query: 182 LQADTDAERSFRKFRLIAEYVQGRMC 259
           LQ D   E +FRKF+LI E VQG+ C
Sbjct: 74  LQND---EVAFRKFKLITEDVQGKNC 96



 Score = 33.5 bits (73), Expect = 0.74
 Identities = 23/51 (45%), Positives = 30/51 (58%)
 Frame = +3

Query: 510 LREVVNKLIS*LHCQGHREGPAMASYPLRDVWHPKVKVLKRAPFSEISKLI 662
           L+EVVNKLI         E    + YPL DV+  KVK+LK+  F E+ KL+
Sbjct: 181 LKEVVNKLIPD-SIGKDIEKACQSIYPLHDVFVRKVKMLKKPKF-ELGKLM 229


>AK122625-1|BAC85495.1|  438|Homo sapiens protein ( Homo sapiens
           cDNA FLJ16046 fis, clone CTONG2013178, weakly  similar
           to Homo sapiens serine protease DESC1 (DESC1) mRNA. ).
          Length = 438

 Score = 31.5 bits (68), Expect = 3.0
 Identities = 15/40 (37%), Positives = 23/40 (57%), Gaps = 1/40 (2%)
 Frame = -1

Query: 660 STSRSPKTGPSSTLSLSDAKHRA-EGKMPWQALLDVLGNG 544
           ++S  P    SST  +   +  A EG+ PWQA L ++G+G
Sbjct: 191 TSSNMPLPASSSTQRIVQGRETAMEGEWPWQASLQLIGSG 230


>U61263-1|AAC50934.1|  632|Homo sapiens acetolactate synthase
           homolog protein.
          Length = 632

 Score = 31.1 bits (67), Expect = 4.0
 Identities = 23/83 (27%), Positives = 39/83 (46%), Gaps = 7/83 (8%)
 Frame = +2

Query: 434 TPSTLRSEQSERKCVKSLHATSLTLTQGGG-----EQVDFLTPLPR--TSRRACHGILPS 592
           T + +++ Q  +  +  L   + TL Q  G     +Q+    PL +   S R    I+P+
Sbjct: 129 TVTAVKNAQMAQSPILLLGGAASTLLQNRGALQAVDQLSLFRPLCKFCVSVRRVRDIVPT 188

Query: 593 ARCLASESESVEEGPVFGDLEVD 661
            R   + ++S   GPVF +L VD
Sbjct: 189 LRAAMAAAQSXTPGPVFVELPVD 211


>BC126913-1|AAI26914.1|  241|Homo sapiens ILVBL protein protein.
          Length = 241

 Score = 30.3 bits (65), Expect = 6.9
 Identities = 23/83 (27%), Positives = 39/83 (46%), Gaps = 7/83 (8%)
 Frame = +2

Query: 434 TPSTLRSEQSERKCVKSLHATSLTLTQGGG-----EQVDFLTPLPR--TSRRACHGILPS 592
           T + +++ Q  +  +  L   + TL Q  G     +Q+    PL +   S R    I+P+
Sbjct: 93  TVTAVKNAQMAQSPILLLGGAASTLLQNRGALQAVDQLSLFRPLCKFCVSVRRVRDIVPT 152

Query: 593 ARCLASESESVEEGPVFGDLEVD 661
            R   + ++S   GPVF +L VD
Sbjct: 153 LRAAMAAAQSGTPGPVFVELPVD 175


>BC011761-1|AAH11761.1|  632|Homo sapiens ilvB (bacterial
           acetolactate synthase)-like protein.
          Length = 632

 Score = 30.3 bits (65), Expect = 6.9
 Identities = 23/83 (27%), Positives = 39/83 (46%), Gaps = 7/83 (8%)
 Frame = +2

Query: 434 TPSTLRSEQSERKCVKSLHATSLTLTQGGG-----EQVDFLTPLPR--TSRRACHGILPS 592
           T + +++ Q  +  +  L   + TL Q  G     +Q+    PL +   S R    I+P+
Sbjct: 129 TVTAVKNAQMAQSPILLLGGAASTLLQNRGALQAVDQLSLFRPLCKFCVSVRRVRDIVPT 188

Query: 593 ARCLASESESVEEGPVFGDLEVD 661
            R   + ++S   GPVF +L VD
Sbjct: 189 LRAAMAAAQSGTPGPVFVELPVD 211


>BC011722-1|AAH11722.1|  632|Homo sapiens ilvB (bacterial
           acetolactate synthase)-like protein.
          Length = 632

 Score = 30.3 bits (65), Expect = 6.9
 Identities = 23/83 (27%), Positives = 39/83 (46%), Gaps = 7/83 (8%)
 Frame = +2

Query: 434 TPSTLRSEQSERKCVKSLHATSLTLTQGGG-----EQVDFLTPLPR--TSRRACHGILPS 592
           T + +++ Q  +  +  L   + TL Q  G     +Q+    PL +   S R    I+P+
Sbjct: 129 TVTAVKNAQMAQSPILLLGGAASTLLQNRGALQAVDQLSLFRPLCKFCVSVRRVRDIVPT 188

Query: 593 ARCLASESESVEEGPVFGDLEVD 661
            R   + ++S   GPVF +L VD
Sbjct: 189 LRAAMAAAQSGTPGPVFVELPVD 211


>AC003956-1|AAB94632.1|  632|Homo sapiens acetolactate synthase
           protein.
          Length = 632

 Score = 30.3 bits (65), Expect = 6.9
 Identities = 23/83 (27%), Positives = 39/83 (46%), Gaps = 7/83 (8%)
 Frame = +2

Query: 434 TPSTLRSEQSERKCVKSLHATSLTLTQGGG-----EQVDFLTPLPR--TSRRACHGILPS 592
           T + +++ Q  +  +  L   + TL Q  G     +Q+    PL +   S R    I+P+
Sbjct: 129 TVTAVKNAQMAQSPILLLGGAASTLLQNRGALQAVDQLSLFRPLCKFCVSVRRVRDIVPT 188

Query: 593 ARCLASESESVEEGPVFGDLEVD 661
            R   + ++S   GPVF +L VD
Sbjct: 189 LRAAMAAAQSGTPGPVFVELPVD 211


>BX322635-1|CAI42530.1|  373|Homo sapiens G protein-coupled receptor
           173 protein.
          Length = 373

 Score = 29.9 bits (64), Expect = 9.1
 Identities = 16/38 (42%), Positives = 23/38 (60%), Gaps = 1/38 (2%)
 Frame = -1

Query: 630 SSTLSLSDAKHRAEGKMPWQALLDV-LGNGVRKSTCSP 520
           ++ LSL   K RA  K P+  LLD+ L +G+R + C P
Sbjct: 40  NAILSLLVLKERALHKAPYYFLLDLCLADGIRSAVCFP 77


>BC009861-1|AAH09861.1|  373|Homo sapiens G protein-coupled receptor
           173 protein.
          Length = 373

 Score = 29.9 bits (64), Expect = 9.1
 Identities = 16/38 (42%), Positives = 23/38 (60%), Gaps = 1/38 (2%)
 Frame = -1

Query: 630 SSTLSLSDAKHRAEGKMPWQALLDV-LGNGVRKSTCSP 520
           ++ LSL   K RA  K P+  LLD+ L +G+R + C P
Sbjct: 40  NAILSLLVLKERALHKAPYYFLLDLCLADGIRSAVCFP 77


>AB040801-1|BAA96647.1|  373|Homo sapiens SREB3 protein.
          Length = 373

 Score = 29.9 bits (64), Expect = 9.1
 Identities = 16/38 (42%), Positives = 23/38 (60%), Gaps = 1/38 (2%)
 Frame = -1

Query: 630 SSTLSLSDAKHRAEGKMPWQALLDV-LGNGVRKSTCSP 520
           ++ LSL   K RA  K P+  LLD+ L +G+R + C P
Sbjct: 40  NAILSLLVLKERALHKAPYYFLLDLCLADGIRSAVCFP 77


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 108,583,738
Number of Sequences: 237096
Number of extensions: 2425428
Number of successful extensions: 10016
Number of sequences better than 10.0: 25
Number of HSP's better than 10.0 without gapping: 9556
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9997
length of database: 76,859,062
effective HSP length: 88
effective length of database: 55,994,614
effective search space used: 8063224416
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).