SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30027
         (765 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

D21853-1|BAA04879.2|  412|Homo sapiens KIAA0111 protein.              176   8e-44
CR456750-1|CAG33031.1|  411|Homo sapiens DDX48 protein.               176   8e-44
BC011151-1|AAH11151.1|  411|Homo sapiens eukaryotic translation ...   176   8e-44
BC004386-1|AAH04386.1|  411|Homo sapiens eukaryotic translation ...   176   8e-44
BC003662-1|AAH03662.1|  411|Homo sapiens eukaryotic translation ...   176   8e-44
X79538-1|CAA56074.1|  411|Homo sapiens translation initiation fa...   175   2e-43
BT009860-1|AAP88862.1|  407|Homo sapiens eukaryotic translation ...   170   5e-42
BC048105-1|AAH48105.1|  408|Homo sapiens eukaryotic translation ...   170   5e-42
BC015842-1|AAH15842.1|  407|Homo sapiens eukaryotic translation ...   170   5e-42
BC013708-1|AAH13708.1|  407|Homo sapiens eukaryotic translation ...   170   5e-42
BC012547-1|AAH12547.1|  408|Homo sapiens eukaryotic translation ...   170   5e-42
D30655-1|BAA06336.1|  407|Homo sapiens eukaryotic initiation fac...   169   9e-42
D13748-1|BAA02897.1|  406|Homo sapiens eukaryotic initiation fac...   168   2e-41
BT019881-1|AAV38684.1|  406|Homo sapiens eukaryotic translation ...   168   2e-41
BT019880-1|AAV38683.1|  406|Homo sapiens eukaryotic translation ...   168   2e-41
BC073752-1|AAH73752.1|  406|Homo sapiens eukaryotic translation ...   168   2e-41
BC009585-1|AAH09585.1|  406|Homo sapiens eukaryotic translation ...   168   2e-41
BC006380-1|AAH06380.1|  473|Homo sapiens Unknown (protein for IM...   168   2e-41
AB209593-1|BAD92830.1|  375|Homo sapiens CD68 antigen variant pr...   168   2e-41
D17532-1|BAA04482.1|  472|Homo sapiens RCK protein.                    87   5e-17
BC065007-1|AAH65007.1|  483|Homo sapiens DDX6 protein protein.         87   5e-17
BC034953-1|AAH34953.1|  824|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    68   4e-11
BC031062-1|AAH31062.1|  824|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    68   4e-11
BC011556-1|AAH11556.1|  824|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    68   4e-11
AL049557-7|CAB55686.2|  824|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    68   4e-11
AK001506-1|BAA91727.1|  824|Homo sapiens protein ( Homo sapiens ...    68   4e-11
AF171063-1|AAF14544.1|  824|Homo sapiens DEAD box RNA helicase G...    68   4e-11
AF155803-1|AAK56799.1|  824|Homo sapiens DEAD-box corepressor DP...    68   4e-11
AF106019-1|AAD42744.1|  824|Homo sapiens DEAD-box protein protein.     68   4e-11
BC006544-1|AAH06544.1|  478|Homo sapiens DEAD (Asp-Glu-Ala-As) b...    67   6e-11
BC005162-1|AAH05162.1|  478|Homo sapiens DEAD (Asp-Glu-Ala-As) b...    67   6e-11
AK223262-1|BAD96982.1|  478|Homo sapiens DDX19-like protein vari...    67   6e-11
AK001988-1|BAA92022.1|  478|Homo sapiens protein ( Homo sapiens ...    67   6e-11
CR533509-1|CAG38540.1|  448|Homo sapiens DDX19 protein.                66   1e-10
BC110805-1|AAI10806.1|  449|Homo sapiens DDX19B protein protein.       66   1e-10
BC010008-1|AAH10008.1|  370|Homo sapiens DEAD (Asp-Glu-Ala-As) b...    66   1e-10
BC003626-1|AAH03626.1|  479|Homo sapiens DEAD (Asp-Glu-Ala-As) b...    66   1e-10
AK223115-1|BAD96835.1|  479|Homo sapiens DEAD (Asp-Glu-Ala-As) b...    66   1e-10
AJ237946-1|CAB52189.1|  479|Homo sapiens DEAD Box Protein 5 prot...    66   1e-10
AF353720-1|AAK40102.1|  370|Homo sapiens testicular DEAD-box hel...    66   1e-10
CR457215-1|CAG33496.1|  479|Homo sapiens DDX19 protein.                65   2e-10
AF183422-1|AAG09691.1|  478|Homo sapiens RNA helicase protein.         65   2e-10
AF029062-1|AAC63046.1|  284|Homo sapiens DEAD-box protein protein.     65   2e-10
Z37166-1|CAA85523.1|  428|Homo sapiens nuclear RNA helicase (DEA...    65   3e-10
BX248516-6|CAM25877.1|  289|Homo sapiens HLA-B associated transc...    65   3e-10
BX248516-5|CAM25876.1|  245|Homo sapiens HLA-B associated transc...    65   3e-10
BX248516-4|CAI41924.2|  425|Homo sapiens HLA-B associated transc...    65   3e-10
BX248516-3|CAI41922.1|  428|Homo sapiens HLA-B associated transc...    65   3e-10
BX001040-6|CAI18634.1|  428|Homo sapiens HLA-B associated transc...    65   3e-10
BT009909-1|AAP88911.1|  428|Homo sapiens HLA-B associated transc...    65   3e-10
BC013006-1|AAH13006.1|  428|Homo sapiens HLA-B associated transc...    65   3e-10
BC000361-1|AAH00361.1|  428|Homo sapiens HLA-B associated transc...    65   3e-10
BA000025-40|BAB63306.1|  428|Homo sapiens putative ATP-dependent...    65   3e-10
AL662847-23|CAO72086.1|  289|Homo sapiens HLA-B associated trans...    65   3e-10
AL662847-22|CAO72085.1|  245|Homo sapiens HLA-B associated trans...    65   3e-10
AL662847-21|CAI17672.2|  425|Homo sapiens HLA-B associated trans...    65   3e-10
AL662847-20|CAI17664.2|  428|Homo sapiens HLA-B associated trans...    65   3e-10
AL662801-6|CAI18282.2|  289|Homo sapiens HLA-B associated transc...    65   3e-10
AL662801-5|CAM25576.1|  245|Homo sapiens HLA-B associated transc...    65   3e-10
AL662801-4|CAI18284.2|  425|Homo sapiens HLA-B associated transc...    65   3e-10
AL662801-3|CAI18280.1|  428|Homo sapiens HLA-B associated transc...    65   3e-10
AK222912-1|BAD96632.1|  428|Homo sapiens HLA-B associated transc...    65   3e-10
AF029061-1|AAB94615.1|  284|Homo sapiens BAT1 protein.                 65   3e-10
AB202112-3|BAE78637.1|  428|Homo sapiens HLA-B associated transc...    65   3e-10
AB103621-3|BAF31287.1|  443|Homo sapiens BAT1 protein protein.         65   3e-10
AB088115-3|BAC54953.1|  428|Homo sapiens HLA-B associated transc...    65   3e-10
U90426-1|AAB50231.1|  427|Homo sapiens nuclear RNA helicase prot...    64   5e-10
BC032128-1|AAH32128.1|  322|Homo sapiens DDX39 protein protein.        64   5e-10
BC001009-1|AAH01009.1|  427|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    64   5e-10
AK026614-1|BAB15509.1|  461|Homo sapiens protein ( Homo sapiens ...    64   5e-10
D26528-1|BAA05534.1|  439|Homo sapiens RNA helicase protein.           63   9e-10
AF136175-1|AAP97265.1|  479|Homo sapiens RNA helicase protein.         62   2e-09
BC050360-1|AAH50360.2|  369|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    62   2e-09
BC035388-1|AAH35388.2|  369|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    62   2e-09
AY735312-1|AAU84667.1|  483|Homo sapiens gonadotropin-regulated ...    62   2e-09
AF155140-1|AAF21371.2|  483|Homo sapiens gonadotropin-regulated ...    62   2e-09
BC041801-1|AAH41801.1|  619|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    61   4e-09
BC016295-1|AAH16295.1|  179|Homo sapiens EIF4A2 protein protein.       61   4e-09
BC014183-1|AAH14183.1|  434|Homo sapiens DDX59 protein protein.        61   4e-09
AL445483-6|CAI17056.1|  619|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    61   4e-09
AL445483-5|CAI17055.1|  580|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    61   4e-09
AF193054-1|AAG22482.1|  312|Homo sapiens unknown protein.              61   4e-09
BC002366-1|AAH02366.1|  820|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    60   6e-09
AF026402-1|AAB87902.1|  820|Homo sapiens U5 snRNP 100 kD protein...    60   6e-09
AB209401-1|BAD92638.1|  313|Homo sapiens DDX19-like protein vari...    60   9e-09
BC002674-1|AAH02674.1|  483|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    59   2e-08
AK223294-1|BAD97014.1|  483|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    59   2e-08
AC002985-2|AAB81544.1|  483|Homo sapiens R27090_2 protein.             59   2e-08
BC130275-1|AAI30276.1|  796|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    58   3e-08
BC126287-1|AAI26288.1|  796|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    58   3e-08
BC068009-1|AAH68009.1|  455|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    58   3e-08
BC016060-1|AAH16060.2|  767|Homo sapiens DDX27 protein protein.        58   3e-08
BC011927-1|AAH11927.2|  767|Homo sapiens DDX27 protein protein.        58   3e-08
BC009379-1|AAH09379.2|  450|Homo sapiens DDX47 protein protein.        58   3e-08
BC009304-1|AAH09304.2|  769|Homo sapiens DDX27 protein protein.        58   3e-08
AY044431-1|AAK95821.1|  796|Homo sapiens RNA helicase-like prote...    58   3e-08
AL357560-1|CAH70236.1|  796|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    58   3e-08
AL136666-1|CAB66601.1|  455|Homo sapiens hypothetical protein pr...    58   3e-08
AL049766-1|CAI22427.1|  796|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    58   3e-08
AK054574-1|BAB70762.1|  455|Homo sapiens protein ( Homo sapiens ...    58   3e-08
AK022979-1|BAB14343.1|  765|Homo sapiens protein ( Homo sapiens ...    58   3e-08
AK001294-1|BAA91606.1|  257|Homo sapiens protein ( Homo sapiens ...    58   3e-08
AJ276704-1|CAC14786.1|  455|Homo sapiens DEAD box protein protein.     58   3e-08
AF336851-1|AAK21271.1|  561|Homo sapiens RNA helicase-like prote...    58   3e-08
AF078843-1|AAF23354.1|  274|Homo sapiens hqp0256 protein protein.      58   3e-08
BX248516-9|CAM25880.1|  236|Homo sapiens HLA-B associated transc...    58   3e-08
BX248516-8|CAM25879.1|  238|Homo sapiens HLA-B associated transc...    58   3e-08
BX248516-7|CAM25878.1|  231|Homo sapiens HLA-B associated transc...    58   3e-08
BX001040-8|CAI18637.1|  205|Homo sapiens HLA-B associated transc...    58   3e-08
BX001040-7|CAI18635.1|  245|Homo sapiens HLA-B associated transc...    58   3e-08
BC000272-1|AAH00272.1|  737|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    58   3e-08
AL662847-26|CAI17670.2|  238|Homo sapiens HLA-B associated trans...    58   3e-08
AL662847-25|CAO72088.1|  231|Homo sapiens HLA-B associated trans...    58   3e-08
AL662847-24|CAO72087.1|  236|Homo sapiens HLA-B associated trans...    58   3e-08
AL662801-9|CAI18278.2|  238|Homo sapiens HLA-B associated transc...    58   3e-08
AL662801-8|CAI18281.2|  231|Homo sapiens HLA-B associated transc...    58   3e-08
AL662801-7|CAI18283.2|  236|Homo sapiens HLA-B associated transc...    58   3e-08
AL359844-2|CAH72376.1|  737|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    58   3e-08
AF334103-1|AAK29402.1|  737|Homo sapiens nucleolar protein GU2 p...    58   3e-08
AB209217-1|BAD92454.1|  310|Homo sapiens HLA-B associated transc...    58   3e-08
EF036507-1|ABO65093.1|  182|Homo sapiens DEAD box polypeptide 47...    58   5e-08
AK222940-1|BAD96660.1|  448|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    58   5e-08
U41387-1|AAB02546.1|  801|Homo sapiens Gu protein protein.             57   6e-08
BC010455-1|AAH10455.1|  316|Homo sapiens DDX39 protein protein.        57   6e-08
BC008071-1|AAH08071.2|  783|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    57   6e-08
AL359844-3|CAH72377.1|  783|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    57   6e-08
BC012304-1|AAH12304.1| 1031|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    56   1e-07
AB018344-1|BAA34521.2| 1058|Homo sapiens KIAA0801 protein protein.     56   1e-07
Z97056-3|CAB09792.1|  650|Homo sapiens DEAD (Asp-Glu-Ala-Asp) bo...    56   1e-07
U59321-1|AAC50787.1|  650|Homo sapiens DEAD-box protein p72 prot...    56   1e-07
CR456432-1|CAG30318.1|  652|Homo sapiens DDX17 protein.                56   1e-07
BC000595-1|AAH00595.2|  729|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    56   1e-07
AB209595-1|BAD92832.1|  737|Homo sapiens DEAD box polypeptide 17...    56   1e-07
AF261917-1|AAF78930.2|  715|Homo sapiens RNA helicase II/Gu prot...    56   2e-07
AK223297-1|BAD97017.1|  363|Homo sapiens nucleolar protein GU2 v...    55   2e-07
AF106680-1|AAD43033.1| 1031|Homo sapiens RNA helicase protein.         54   4e-07
X52104-1|CAA36324.1|  614|Homo sapiens protein ( Human mRNA for ...    54   6e-07
X15729-1|CAA33751.1|  614|Homo sapiens protein ( Human mRNA for ...    54   6e-07
BX571764-1|CAE11890.1|  406|Homo sapiens hypothetical protein pr...    54   6e-07
BT006943-1|AAP35589.1|  614|Homo sapiens DEAD/H (Asp-Glu-Ala-Asp...    54   6e-07
BC016027-1|AAH16027.1|  614|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    54   6e-07
AF015812-1|AAB84094.1|  614|Homo sapiens RNA helicase p68 protein.     54   6e-07
AB209919-1|BAD93156.1|  457|Homo sapiens Hypothetical protein DK...    54   6e-07
U50553-1|AAB95637.1|  662|Homo sapiens helicase like protein 2 p...    54   7e-07
BC034942-1|AAH34942.1|  660|Homo sapiens DDX3Y protein protein.        54   7e-07
BC011819-1|AAH11819.1|  662|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    54   7e-07
AL391647-2|CAI41416.1|  662|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    54   7e-07
AF061337-1|AAC34298.1|  662|Homo sapiens DEAD box RNA helicase D...    54   7e-07
AF000985-1|AAC51832.1|  660|Homo sapiens dead box, Y isoform pro...    54   7e-07
AF000984-1|AAC51831.1|  660|Homo sapiens dead box, Y isoform pro...    54   7e-07
AF000983-1|AAC51830.1|  662|Homo sapiens dead box, X isoform pro...    54   7e-07
AF000982-1|AAC51829.1|  662|Homo sapiens dead box, X isoform pro...    54   7e-07
AB208983-1|BAD92220.1|  674|Homo sapiens DEAD/H (Asp-Glu-Ala-Asp...    54   7e-07
BC005848-1|AAH05848.2|  864|Homo sapiens DDX54 protein protein.        53   1e-06
AY148094-1|AAN59978.1|  865|Homo sapiens DEAD box RNA helicase D...    53   1e-06
AF478457-1|AAL85336.1|  882|Homo sapiens ATP-dependent RNA helic...    53   1e-06
AK074219-1|BAB85021.1|  353|Homo sapiens protein ( Homo sapiens ...    52   3e-06
AB001343-1|BAA20386.1|  111|Homo sapiens DDX10-NUP98 fusion prot...    51   4e-06
BX641072-1|CAE46035.1|  496|Homo sapiens hypothetical protein pr...    50   7e-06
BC030020-1|AAH30020.1|  600|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    50   7e-06
BC015476-1|AAH15476.1|  622|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    50   7e-06
AK222598-1|BAD96318.1|  622|Homo sapiens DEAD-box protein abstra...    50   7e-06
AK027768-1|BAB55355.1|  622|Homo sapiens protein ( Homo sapiens ...    50   7e-06
AK001255-1|BAA91585.1|  622|Homo sapiens protein ( Homo sapiens ...    50   7e-06
AF195417-1|AAF04150.1|  621|Homo sapiens DEAD-box protein abstra...    50   7e-06
X70649-1|CAA49992.1|  740|Homo sapiens member of DEAD box protei...    50   9e-06
EF418571-1|ABN70941.1|  740|Homo sapiens DEAD box polypeptide 1 ...    50   9e-06
EF418570-1|ABN70940.1|  740|Homo sapiens DEAD box polypeptide 1 ...    50   9e-06
BC093081-1|AAH93081.1|  938|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    50   9e-06
BC078667-1|AAH78667.1|  919|Homo sapiens DDX42 protein protein.        50   9e-06
BC053673-1|AAH53673.1|  740|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    50   9e-06
BC015505-1|AAH15505.1|  819|Homo sapiens DDX42 protein protein.        50   9e-06
BC012132-1|AAH12132.1|  740|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    50   9e-06
AF083255-1|AAC32396.1|  709|Homo sapiens RNA helicase-related pr...    50   9e-06
AB036090-1|BAC66466.1|  938|Homo sapiens RNA helicase-related pr...    50   9e-06
BC067878-1|AAH67878.1|  631|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    50   1e-05
BC051703-1|AAH51703.1|  631|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    50   1e-05
AY039237-1|AAK72102.1|  630|Homo sapiens DEAD-box protein CAGE p...    50   1e-05
U28042-1|AAC50823.1|  875|Homo sapiens protein ( Human DEAD box ...    49   2e-05
BC093656-1|AAH93656.1|  875|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    49   2e-05
BC093654-1|AAH93654.1|  875|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    49   2e-05
BC091521-1|AAH91521.1|  875|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    49   2e-05
BC066938-1|AAH66938.1|  648|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    49   2e-05
BC049217-1|AAH49217.1|  745|Homo sapiens DDX10 protein protein.        49   2e-05
AJ278110-1|CAB92442.1|  648|Homo sapiens DEAD-box protein protein.     49   2e-05
AB209884-1|BAD93121.1|  845|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    49   2e-05
AB040537-1|BAB18536.1|  875|Homo sapiens RNA helicase protein.         49   2e-05
BC096826-1|AAH96826.1|  804|Homo sapiens DDX24 protein protein.        48   3e-05
BC009406-1|AAH09406.1|  859|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    48   3e-05
BC008847-1|AAH08847.1|  859|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    48   3e-05
AK025162-1|BAB15079.1|  859|Homo sapiens protein ( Homo sapiens ...    48   3e-05
AF214731-1|AAG02169.1|  859|Homo sapiens ATP-dependent RNA helic...    48   3e-05
AB209382-1|BAD92619.1|  676|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    48   3e-05
BC088362-1|AAH88362.1|  724|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    48   5e-05
AY004154-1|AAF86585.1|  724|Homo sapiens DEAD box RNA helicase p...    48   5e-05
AL137462-1|CAB70750.1|  635|Homo sapiens hypothetical protein pr...    48   5e-05
AF262962-1|AAF72705.1|  724|Homo sapiens VASA protein protein.         48   5e-05
X98743-1|CAA67295.1|  610|Homo sapiens RNA helicase protein.           47   8e-05
CR457060-1|CAG33341.1|  610|Homo sapiens DDX18 protein.                47   8e-05
BC024739-1|AAH24739.1|  670|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    47   8e-05
BC003360-1|AAH03360.1|  670|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    47   8e-05
BC001238-1|AAH01238.1|  670|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    47   8e-05
AK001467-1|BAA91709.1|  670|Homo sapiens protein ( Homo sapiens ...    47   8e-05
AC009404-1|AAX88947.1|  546|Homo sapiens unknown protein.              47   8e-05
AF145022-1|AAP97274.1|  454|Homo sapiens ATP-dependent RNA helic...    46   1e-04
AF134475-1|AAP97252.1|  486|Homo sapiens ATP-dependent RNA helic...    46   1e-04
BC047455-1|AAH47455.1|  690|Homo sapiens DDX4 protein protein.         46   1e-04
AK131442-1|BAD18588.1|  267|Homo sapiens protein ( Homo sapiens ...    46   1e-04
AK091227-1|BAC03616.1|  408|Homo sapiens protein ( Homo sapiens ...    46   1e-04
AB046815-1|BAB13421.1|  471|Homo sapiens KIAA1595 protein protein.     46   1e-04
CR457213-1|CAG33494.1|  547|Homo sapiens DDX56 protein.                46   2e-04
BC001235-1|AAH01235.1|  547|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    46   2e-04
AK022774-1|BAB14238.1|  547|Homo sapiens protein ( Homo sapiens ...    46   2e-04
AJ131712-1|CAB87992.1|  547|Homo sapiens nucleolar RNA-helicase ...    46   2e-04
AF247666-1|AAG36876.1|  547|Homo sapiens DEAD-box RNA helicase p...    46   2e-04
AY207392-1|AAO66460.1|  101|Homo sapiens eukaryotic translation ...    44   6e-04
AK222662-1|BAD96382.1|  547|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    44   6e-04
BC012726-1|AAH12726.2|  777|Homo sapiens DDX31 protein protein.        43   0.001
AL354735-2|CAI16565.1|  775|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    43   0.001
AL354735-1|CAI16564.1|  851|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    43   0.001
AL160165-3|CAH70532.1|  775|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    43   0.001
AL160165-2|CAH70531.1|  851|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    43   0.001
AL160165-1|CAH70530.1|  585|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    43   0.001
AK027484-1|BAB55146.1|  585|Homo sapiens protein ( Homo sapiens ...    43   0.001
AK023695-1|BAB14644.1|  556|Homo sapiens protein ( Homo sapiens ...    43   0.001
AF427339-1|AAL26549.1|  851|Homo sapiens DEAD/DEXH helicase DDX3...    43   0.001
AF335569-1|AAQ14890.1|  758|Homo sapiens helicain C protein.           43   0.001
AF335568-1|AAQ14889.1|  851|Homo sapiens helicain B protein.           43   0.001
BX248516-15|CAM25884.1|  187|Homo sapiens HLA-B associated trans...    42   0.002
BX001040-10|CAI18638.1|  187|Homo sapiens HLA-B associated trans...    42   0.002
AL662847-32|CAO72093.1|  187|Homo sapiens HLA-B associated trans...    42   0.002
AL662801-15|CAM25579.1|  187|Homo sapiens HLA-B associated trans...    42   0.002
BC041785-1|AAH41785.1|  599|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    42   0.002
AL445483-3|CAI17051.1|  205|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    42   0.002
AK093661-1|BAC04214.1|  360|Homo sapiens protein ( Homo sapiens ...    42   0.002
AK027002-1|BAB15620.1|  674|Homo sapiens protein ( Homo sapiens ...    42   0.002
AK001652-1|BAA91812.1|  491|Homo sapiens protein ( Homo sapiens ...    42   0.002
AJ010840-1|CAA09374.1|  420|Homo sapiens ATP-dependent RNA helic...    42   0.002
AB208938-1|BAD92175.1|  512|Homo sapiens ATP-dependent RNA helic...    42   0.002
AB000267-1|BAA20379.1|  124|Homo sapiens NUP98-DDX10 fusion prot...    42   0.002
BC000210-1|AAH00210.1|  467|Homo sapiens DDX50 protein protein.        42   0.003
BC024273-1|AAH24273.1|  540|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    40   0.007
AK002144-1|BAA92106.1|  540|Homo sapiens protein ( Homo sapiens ...    40   0.007
AF329821-1|AAG59833.1|  540|Homo sapiens putative DEAD-box helic...    40   0.007
AK097078-1|BAC04942.1|  666|Homo sapiens protein ( Homo sapiens ...    40   0.010
BC040185-1|AAH40185.1|  666|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    39   0.023
AY776161-1|AAV52794.1|  362|Homo sapiens unknown protein.              39   0.023
AK131260-1|BAD18438.1|  528|Homo sapiens protein ( Homo sapiens ...    38   0.030
BC000979-1|AAH00979.2|  254|Homo sapiens DDX49 protein protein.        38   0.039
BC039826-1|AAH39826.1|  187|Homo sapiens DDX6 protein protein.         37   0.069
Y14768-15|CAA75074.1|  144|Homo sapiens BAT1 protein.                  36   0.12 
AK056044-1|BAB71082.1|  189|Homo sapiens protein ( Homo sapiens ...    33   1.5  
M13149-1|AAA52694.1|  525|Homo sapiens HRG protein.                    32   2.6  
BC069574-1|AAH69574.1|  525|Homo sapiens histidine-rich glycopro...    32   2.6  
AB005803-1|BAA21613.1|  525|Homo sapiens histidine-rich glycopro...    32   2.6  
BC067092-1|AAH67092.1|  237|Homo sapiens IGKC protein protein.         31   6.0  
BC053351-1|AAH53351.1|  129|Homo sapiens distal-less homeobox 1 ...    31   6.0  
BC036189-1|AAH36189.2|  255|Homo sapiens distal-less homeobox 1 ...    31   6.0  
AY257976-1|AAO91939.1|  255|Homo sapiens transcription factor DL...    31   6.0  
AL358780-2|CAI13978.2|  818|Homo sapiens novel protein (FLJ16611...    31   6.0  
AK223116-1|BAD96836.1|  408|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ...    31   6.0  
AK131456-1|BAD18601.1|  762|Homo sapiens protein ( Homo sapiens ...    31   6.0  
AK095266-1|BAC04515.1|  183|Homo sapiens protein ( Homo sapiens ...    31   6.0  
AK000603-1|BAA91284.1|  406|Homo sapiens protein ( Homo sapiens ...    31   6.0  
AC015976-2|AAY14732.1|  235|Homo sapiens unknown protein.              31   6.0  
AB234866-1|BAE93016.1|  827|Homo sapiens DLN-1 protein.                31   6.0  
BX248516-11|CAI41927.2|  125|Homo sapiens HLA-B associated trans...    30   7.9  
AL662847-28|CAO72090.1|  125|Homo sapiens HLA-B associated trans...    30   7.9  
AL662801-11|CAM25577.1|  125|Homo sapiens HLA-B associated trans...    30   7.9  

>D21853-1|BAA04879.2|  412|Homo sapiens KIAA0111 protein.
          Length = 412

 Score =  176 bits (428), Expect = 8e-44
 Identities = 104/214 (48%), Positives = 134/214 (62%), Gaps = 11/214 (5%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTATFSIS+LQ +D  +RE QALILAPTRELA QIQK ++ALGD++N +CHACIGGTNV
Sbjct: 88  GKTATFSISVLQCLDIQVRETQALILAPTRELAVQIQKGLLALGDYMNVQCHACIGGTNV 147

Query: 181 REDIRQLESGVHVVVGTPGRVYDMILVVRFMPTPSNFLFLMKLMKCCPEVSRTRSMMSSR 360
            EDIR+L+ G HVV GTPGRV+DMI   R + T +     +K++     +     M++  
Sbjct: 148 GEDIRKLDYGQHVVAGTPGRVFDMIR-RRSLRTRA-----IKML----VLDEADEMLNKG 197

Query: 361 FCQLMFKSYYSLLPCLMMYWKYLDAL*EIL----------YAYLYRRKSLPWKVLNN-FT 507
           F + ++  Y  L P   +         EIL             L +R  L  + +   F 
Sbjct: 198 FKEQIYDVYRYLPPATQVVLISATLPHEILEMTNKFMTDPIRILVKRDELTLEGIKQFFV 257

Query: 508 CIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKV 609
            +E EEWK +TLCDLYDTL+I QAVIFCNT+RKV
Sbjct: 258 AVEREEWKFDTLCDLYDTLTITQAVIFCNTKRKV 291



 Score =  116 bits (280), Expect = 7e-26
 Identities = 68/169 (40%), Positives = 99/169 (58%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           RR+L    IK+ VLDEADEML++GFK+QI+DV++ L    QV+L+SAT+P ++LE++  F
Sbjct: 174 RRSLRTRAIKMLVLDEADEMLNKGFKEQIYDVYRYLPPATQVVLISATLPHEILEMTNKF 233

Query: 438 MRDPVRILVQKEELTLEGIKQFYMH*IRRMEAGNSV*PV*YTVYCTSCNFLQHPSQGGIG 617
           M DP+RILV+++ELTLEGIKQF++   R     +++  +  T+  T      +  +    
Sbjct: 234 MTDPIRILVKRDELTLEGIKQFFVAVEREEWKFDTLCDLYDTLTITQAVIFCNTKRKVDW 293

Query: 618 SLNLCICVTLLYLLCMGDMDQREPEVIMKAVSYWLLLVS*FTTDLWARG 764
                           GDM Q+E E IMK        V   +TD+WARG
Sbjct: 294 LTEKMREANFTVSSMHGDMPQKERESIMKEFRSGASRVL-ISTDVWARG 341



 Score = 33.1 bits (72), Expect = 1.1
 Identities = 13/19 (68%), Positives = 15/19 (78%)
 Frame = +2

Query: 611 DWLTESMHLRDFTVSAMHG 667
           DWLTE M   +FTVS+MHG
Sbjct: 292 DWLTEKMREANFTVSSMHG 310


>CR456750-1|CAG33031.1|  411|Homo sapiens DDX48 protein.
          Length = 411

 Score =  176 bits (428), Expect = 8e-44
 Identities = 104/214 (48%), Positives = 134/214 (62%), Gaps = 11/214 (5%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTATFSIS+LQ +D  +RE QALILAPTRELA QIQK ++ALGD++N +CHACIGGTNV
Sbjct: 87  GKTATFSISVLQCLDIQVRETQALILAPTRELAVQIQKGLLALGDYMNVQCHACIGGTNV 146

Query: 181 REDIRQLESGVHVVVGTPGRVYDMILVVRFMPTPSNFLFLMKLMKCCPEVSRTRSMMSSR 360
            EDIR+L+ G HVV GTPGRV+DMI   R + T +     +K++     +     M++  
Sbjct: 147 GEDIRKLDYGQHVVAGTPGRVFDMIR-RRSLRTRA-----IKML----VLDEADEMLNKG 196

Query: 361 FCQLMFKSYYSLLPCLMMYWKYLDAL*EIL----------YAYLYRRKSLPWKVLNN-FT 507
           F + ++  Y  L P   +         EIL             L +R  L  + +   F 
Sbjct: 197 FKEQIYDVYRYLPPATQVVLISATLPHEILEMTNKFMTDPIRILVKRDELTLEGIKQFFV 256

Query: 508 CIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKV 609
            +E EEWK +TLCDLYDTL+I QAVIFCNT+RKV
Sbjct: 257 AVEREEWKFDTLCDLYDTLTITQAVIFCNTKRKV 290



 Score =  116 bits (280), Expect = 7e-26
 Identities = 68/169 (40%), Positives = 99/169 (58%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           RR+L    IK+ VLDEADEML++GFK+QI+DV++ L    QV+L+SAT+P ++LE++  F
Sbjct: 173 RRSLRTRAIKMLVLDEADEMLNKGFKEQIYDVYRYLPPATQVVLISATLPHEILEMTNKF 232

Query: 438 MRDPVRILVQKEELTLEGIKQFYMH*IRRMEAGNSV*PV*YTVYCTSCNFLQHPSQGGIG 617
           M DP+RILV+++ELTLEGIKQF++   R     +++  +  T+  T      +  +    
Sbjct: 233 MTDPIRILVKRDELTLEGIKQFFVAVEREEWKFDTLCDLYDTLTITQAVIFCNTKRKVDW 292

Query: 618 SLNLCICVTLLYLLCMGDMDQREPEVIMKAVSYWLLLVS*FTTDLWARG 764
                           GDM Q+E E IMK        V   +TD+WARG
Sbjct: 293 LTEKMREANFTVSSMHGDMPQKERESIMKEFRSGASRVL-ISTDVWARG 340



 Score = 33.1 bits (72), Expect = 1.1
 Identities = 13/19 (68%), Positives = 15/19 (78%)
 Frame = +2

Query: 611 DWLTESMHLRDFTVSAMHG 667
           DWLTE M   +FTVS+MHG
Sbjct: 291 DWLTEKMREANFTVSSMHG 309


>BC011151-1|AAH11151.1|  411|Homo sapiens eukaryotic translation
           initiation factor 4A, isoform 3 protein.
          Length = 411

 Score =  176 bits (428), Expect = 8e-44
 Identities = 104/214 (48%), Positives = 134/214 (62%), Gaps = 11/214 (5%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTATFSIS+LQ +D  +RE QALILAPTRELA QIQK ++ALGD++N +CHACIGGTNV
Sbjct: 87  GKTATFSISVLQCLDIQVRETQALILAPTRELAVQIQKGLLALGDYMNVQCHACIGGTNV 146

Query: 181 REDIRQLESGVHVVVGTPGRVYDMILVVRFMPTPSNFLFLMKLMKCCPEVSRTRSMMSSR 360
            EDIR+L+ G HVV GTPGRV+DMI   R + T +     +K++     +     M++  
Sbjct: 147 GEDIRKLDYGQHVVAGTPGRVFDMIR-RRSLRTRA-----IKML----VLDEADEMLNKG 196

Query: 361 FCQLMFKSYYSLLPCLMMYWKYLDAL*EIL----------YAYLYRRKSLPWKVLNN-FT 507
           F + ++  Y  L P   +         EIL             L +R  L  + +   F 
Sbjct: 197 FKEQIYDVYRYLPPATQVVLISATLPHEILEMTNKFMTDPIRILVKRDELTLEGIKQFFV 256

Query: 508 CIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKV 609
            +E EEWK +TLCDLYDTL+I QAVIFCNT+RKV
Sbjct: 257 AVEREEWKFDTLCDLYDTLTITQAVIFCNTKRKV 290



 Score =  116 bits (280), Expect = 7e-26
 Identities = 68/169 (40%), Positives = 99/169 (58%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           RR+L    IK+ VLDEADEML++GFK+QI+DV++ L    QV+L+SAT+P ++LE++  F
Sbjct: 173 RRSLRTRAIKMLVLDEADEMLNKGFKEQIYDVYRYLPPATQVVLISATLPHEILEMTNKF 232

Query: 438 MRDPVRILVQKEELTLEGIKQFYMH*IRRMEAGNSV*PV*YTVYCTSCNFLQHPSQGGIG 617
           M DP+RILV+++ELTLEGIKQF++   R     +++  +  T+  T      +  +    
Sbjct: 233 MTDPIRILVKRDELTLEGIKQFFVAVEREEWKFDTLCDLYDTLTITQAVIFCNTKRKVDW 292

Query: 618 SLNLCICVTLLYLLCMGDMDQREPEVIMKAVSYWLLLVS*FTTDLWARG 764
                           GDM Q+E E IMK        V   +TD+WARG
Sbjct: 293 LTEKMREANFTVSSMHGDMPQKERESIMKEFRSGASRVL-ISTDVWARG 340



 Score = 33.1 bits (72), Expect = 1.1
 Identities = 13/19 (68%), Positives = 15/19 (78%)
 Frame = +2

Query: 611 DWLTESMHLRDFTVSAMHG 667
           DWLTE M   +FTVS+MHG
Sbjct: 291 DWLTEKMREANFTVSSMHG 309


>BC004386-1|AAH04386.1|  411|Homo sapiens eukaryotic translation
           initiation factor 4A, isoform 3 protein.
          Length = 411

 Score =  176 bits (428), Expect = 8e-44
 Identities = 104/214 (48%), Positives = 134/214 (62%), Gaps = 11/214 (5%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTATFSIS+LQ +D  +RE QALILAPTRELA QIQK ++ALGD++N +CHACIGGTNV
Sbjct: 87  GKTATFSISVLQCLDIQVRETQALILAPTRELAVQIQKGLLALGDYMNVQCHACIGGTNV 146

Query: 181 REDIRQLESGVHVVVGTPGRVYDMILVVRFMPTPSNFLFLMKLMKCCPEVSRTRSMMSSR 360
            EDIR+L+ G HVV GTPGRV+DMI   R + T +     +K++     +     M++  
Sbjct: 147 GEDIRKLDYGQHVVAGTPGRVFDMIR-RRSLRTRA-----IKML----VLDEADEMLNKG 196

Query: 361 FCQLMFKSYYSLLPCLMMYWKYLDAL*EIL----------YAYLYRRKSLPWKVLNN-FT 507
           F + ++  Y  L P   +         EIL             L +R  L  + +   F 
Sbjct: 197 FKEQIYDVYRYLPPATQVVLISATLPHEILEMTNKFMTDPIRILVKRDELTLEGIKQFFV 256

Query: 508 CIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKV 609
            +E EEWK +TLCDLYDTL+I QAVIFCNT+RKV
Sbjct: 257 AVEREEWKFDTLCDLYDTLTITQAVIFCNTKRKV 290



 Score =  116 bits (280), Expect = 7e-26
 Identities = 68/169 (40%), Positives = 99/169 (58%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           RR+L    IK+ VLDEADEML++GFK+QI+DV++ L    QV+L+SAT+P ++LE++  F
Sbjct: 173 RRSLRTRAIKMLVLDEADEMLNKGFKEQIYDVYRYLPPATQVVLISATLPHEILEMTNKF 232

Query: 438 MRDPVRILVQKEELTLEGIKQFYMH*IRRMEAGNSV*PV*YTVYCTSCNFLQHPSQGGIG 617
           M DP+RILV+++ELTLEGIKQF++   R     +++  +  T+  T      +  +    
Sbjct: 233 MTDPIRILVKRDELTLEGIKQFFVAVEREEWKFDTLCDLYDTLTITQAVIFCNTKRKVDW 292

Query: 618 SLNLCICVTLLYLLCMGDMDQREPEVIMKAVSYWLLLVS*FTTDLWARG 764
                           GDM Q+E E IMK        V   +TD+WARG
Sbjct: 293 LTEKMREANFTVSSMHGDMPQKERESIMKEFRSGASRVL-ISTDVWARG 340



 Score = 33.1 bits (72), Expect = 1.1
 Identities = 13/19 (68%), Positives = 15/19 (78%)
 Frame = +2

Query: 611 DWLTESMHLRDFTVSAMHG 667
           DWLTE M   +FTVS+MHG
Sbjct: 291 DWLTEKMREANFTVSSMHG 309


>BC003662-1|AAH03662.1|  411|Homo sapiens eukaryotic translation
           initiation factor 4A, isoform 3 protein.
          Length = 411

 Score =  176 bits (428), Expect = 8e-44
 Identities = 104/214 (48%), Positives = 134/214 (62%), Gaps = 11/214 (5%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTATFSIS+LQ +D  +RE QALILAPTRELA QIQK ++ALGD++N +CHACIGGTNV
Sbjct: 87  GKTATFSISVLQCLDIQVRETQALILAPTRELAVQIQKGLLALGDYMNVQCHACIGGTNV 146

Query: 181 REDIRQLESGVHVVVGTPGRVYDMILVVRFMPTPSNFLFLMKLMKCCPEVSRTRSMMSSR 360
            EDIR+L+ G HVV GTPGRV+DMI   R + T +     +K++     +     M++  
Sbjct: 147 GEDIRKLDYGQHVVAGTPGRVFDMIR-RRSLRTRA-----IKML----VLDEADEMLNKG 196

Query: 361 FCQLMFKSYYSLLPCLMMYWKYLDAL*EIL----------YAYLYRRKSLPWKVLNN-FT 507
           F + ++  Y  L P   +         EIL             L +R  L  + +   F 
Sbjct: 197 FKEQIYDVYRYLPPATQVVLISATLPHEILEMTNKFMTDPIRILVKRDELTLEGIKQFFV 256

Query: 508 CIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKV 609
            +E EEWK +TLCDLYDTL+I QAVIFCNT+RKV
Sbjct: 257 AVEREEWKFDTLCDLYDTLTITQAVIFCNTKRKV 290



 Score =  116 bits (280), Expect = 7e-26
 Identities = 68/169 (40%), Positives = 99/169 (58%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           RR+L    IK+ VLDEADEML++GFK+QI+DV++ L    QV+L+SAT+P ++LE++  F
Sbjct: 173 RRSLRTRAIKMLVLDEADEMLNKGFKEQIYDVYRYLPPATQVVLISATLPHEILEMTNKF 232

Query: 438 MRDPVRILVQKEELTLEGIKQFYMH*IRRMEAGNSV*PV*YTVYCTSCNFLQHPSQGGIG 617
           M DP+RILV+++ELTLEGIKQF++   R     +++  +  T+  T      +  +    
Sbjct: 233 MTDPIRILVKRDELTLEGIKQFFVAVEREEWKFDTLCDLYDTLTITQAVIFCNTKRKVDW 292

Query: 618 SLNLCICVTLLYLLCMGDMDQREPEVIMKAVSYWLLLVS*FTTDLWARG 764
                           GDM Q+E E IMK        V   +TD+WARG
Sbjct: 293 LTEKMREANFTVSSMHGDMPQKERESIMKEFRSGASRVL-ISTDVWARG 340



 Score = 33.1 bits (72), Expect = 1.1
 Identities = 13/19 (68%), Positives = 15/19 (78%)
 Frame = +2

Query: 611 DWLTESMHLRDFTVSAMHG 667
           DWLTE M   +FTVS+MHG
Sbjct: 291 DWLTEKMREANFTVSSMHG 309


>X79538-1|CAA56074.1|  411|Homo sapiens translation initiation
           factor protein.
          Length = 411

 Score =  175 bits (425), Expect = 2e-43
 Identities = 102/208 (49%), Positives = 130/208 (62%), Gaps = 5/208 (2%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTATFSIS+LQ +D  +RE QALILAPTRELA QIQK ++ALGD++N +CHACIGGTNV
Sbjct: 87  GKTATFSISVLQCLDIQVRETQALILAPTRELAVQIQKGLLALGDYMNVQCHACIGGTNV 146

Query: 181 REDIRQLESGVHVVVGTPGRVYDMILVVRFMPTPSNFLFLMKLMKCCPEVSRTRSMMSSR 360
            EDIR+L+ G HVV GTPGRV+DMI            L L +  +   +  + +     R
Sbjct: 147 GEDIRKLDYGQHVVAGTPGRVFDMIRRRSLRTRAIKMLVLDEADEMLNKGFKEQIYDVYR 206

Query: 361 F----CQLMFKSYYSLLPCLMMYWKYLDAL*EILYAYLYRRKSLPWKVLNN-FTCIELEE 525
           +     Q++  S       L M  K++     I    L +R  L  + +   F  +E EE
Sbjct: 207 YLPSATQVVLISATLPHEILEMTNKFMTDPIRI----LVKRDELTLEGIKQFFVAVEREE 262

Query: 526 WKLETLCDLYDTLSIAQAVIFCNTRRKV 609
           WK +TLCDLYDTL+I QAVIFCNT+RKV
Sbjct: 263 WKFDTLCDLYDTLTITQAVIFCNTKRKV 290



 Score =  117 bits (282), Expect = 4e-26
 Identities = 68/169 (40%), Positives = 100/169 (59%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           RR+L    IK+ VLDEADEML++GFK+QI+DV++ L +  QV+L+SAT+P ++LE++  F
Sbjct: 173 RRSLRTRAIKMLVLDEADEMLNKGFKEQIYDVYRYLPSATQVVLISATLPHEILEMTNKF 232

Query: 438 MRDPVRILVQKEELTLEGIKQFYMH*IRRMEAGNSV*PV*YTVYCTSCNFLQHPSQGGIG 617
           M DP+RILV+++ELTLEGIKQF++   R     +++  +  T+  T      +  +    
Sbjct: 233 MTDPIRILVKRDELTLEGIKQFFVAVEREEWKFDTLCDLYDTLTITQAVIFCNTKRKVDW 292

Query: 618 SLNLCICVTLLYLLCMGDMDQREPEVIMKAVSYWLLLVS*FTTDLWARG 764
                           GDM Q+E E IMK        V   +TD+WARG
Sbjct: 293 LTEKMREANFTVSSMHGDMPQKERESIMKEFRSGASRVL-ISTDVWARG 340



 Score = 33.1 bits (72), Expect = 1.1
 Identities = 13/19 (68%), Positives = 15/19 (78%)
 Frame = +2

Query: 611 DWLTESMHLRDFTVSAMHG 667
           DWLTE M   +FTVS+MHG
Sbjct: 291 DWLTEKMREANFTVSSMHG 309


>BT009860-1|AAP88862.1|  407|Homo sapiens eukaryotic translation
           initiation factor 4A, isoform 2 protein.
          Length = 407

 Score =  170 bits (413), Expect = 5e-42
 Identities = 98/208 (47%), Positives = 137/208 (65%), Gaps = 5/208 (2%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTATF+ISILQQ++   +E QAL+LAPTRELAQQIQKV++ALGD++ A CHACIGGTNV
Sbjct: 82  GKTATFAISILQQLEIEFKETQALVLAPTRELAQQIQKVILALGDYMGATCHACIGGTNV 141

Query: 181 REDIRQLES-GVHVVVGTPGRVYDMILVVRFMPTPSNFLFLMKLMKCCPEVSRTRSMMSS 357
           R ++++L++   H+VVGTPGRV+DM L  R++ +P  ++ +  L +    +SR       
Sbjct: 142 RNEMQKLQAEAPHIVVGTPGRVFDM-LNRRYL-SP-KWIKMFVLDEADEMLSRGFKDQIY 198

Query: 358 RFCQLMFKSYYSLLPCLMMYWKYLDAL*EIL---YAYLYRRKSLPWKVLNNFTC-IELEE 525
              Q +  S   +L    M    L+   + +      L +++ L  + +  F   +E EE
Sbjct: 199 EIFQKLNTSIQVVLLSATMPTDVLEVTKKFMRDPIRILVKKEELTLEGIKQFYINVEREE 258

Query: 526 WKLETLCDLYDTLSIAQAVIFCNTRRKV 609
           WKL+TLCDLY+TL+I QAVIF NTRRKV
Sbjct: 259 WKLDTLCDLYETLTITQAVIFLNTRRKV 286



 Score =  135 bits (327), Expect = 1e-31
 Identities = 81/169 (47%), Positives = 105/169 (62%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           RR L    IK+FVLDEADEMLSRGFKDQI+++F+ L+  +QV+LLSATMP DVLEV++ F
Sbjct: 169 RRYLSPKWIKMFVLDEADEMLSRGFKDQIYEIFQKLNTSIQVVLLSATMPTDVLEVTKKF 228

Query: 438 MRDPVRILVQKEELTLEGIKQFYMH*IRRMEAGNSV*PV*YTVYCTSCNFLQHPSQGGIG 617
           MRDP+RILV+KEELTLEGIKQFY++  R     +++  +  T+  T      +  +    
Sbjct: 229 MRDPIRILVKKEELTLEGIKQFYINVEREEWKLDTLCDLYETLTITQAVIFLNTRRKVDW 288

Query: 618 SLNLCICVTLLYLLCMGDMDQREPEVIMKAVSYWLLLVS*FTTDLWARG 764
                           GDMDQ+E +VIM+        V   TTDL ARG
Sbjct: 289 LTEKMHARDFTVSALHGDMDQKERDVIMREFRSGSSRVL-ITTDLLARG 336



 Score = 42.3 bits (95), Expect = 0.002
 Identities = 23/55 (41%), Positives = 31/55 (56%), Gaps = 3/55 (5%)
 Frame = +2

Query: 512 LN*KNGSWKLCVTCMIH---CLLHKL*FSATPVARWDWLTESMHLRDFTVSAMHG 667
           +N +   WKL   C ++    +   + F  T   + DWLTE MH RDFTVSA+HG
Sbjct: 252 INVEREEWKLDTLCDLYETLTITQAVIFLNTR-RKVDWLTEKMHARDFTVSALHG 305


>BC048105-1|AAH48105.1|  408|Homo sapiens eukaryotic translation
           initiation factor 4A, isoform 2 protein.
          Length = 408

 Score =  170 bits (413), Expect = 5e-42
 Identities = 98/208 (47%), Positives = 137/208 (65%), Gaps = 5/208 (2%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTATF+ISILQQ++   +E QAL+LAPTRELAQQIQKV++ALGD++ A CHACIGGTNV
Sbjct: 83  GKTATFAISILQQLEIEFKETQALVLAPTRELAQQIQKVILALGDYMGATCHACIGGTNV 142

Query: 181 REDIRQLES-GVHVVVGTPGRVYDMILVVRFMPTPSNFLFLMKLMKCCPEVSRTRSMMSS 357
           R ++++L++   H+VVGTPGRV+DM L  R++ +P  ++ +  L +    +SR       
Sbjct: 143 RNEMQKLQAEAPHIVVGTPGRVFDM-LNRRYL-SP-KWIKMFVLDEADEMLSRGFKDQIY 199

Query: 358 RFCQLMFKSYYSLLPCLMMYWKYLDAL*EIL---YAYLYRRKSLPWKVLNNFTC-IELEE 525
              Q +  S   +L    M    L+   + +      L +++ L  + +  F   +E EE
Sbjct: 200 EIFQKLNTSIQVVLLSATMPTDVLEVTKKFMRDPIRILVKKEELTLEGIKQFYINVEREE 259

Query: 526 WKLETLCDLYDTLSIAQAVIFCNTRRKV 609
           WKL+TLCDLY+TL+I QAVIF NTRRKV
Sbjct: 260 WKLDTLCDLYETLTITQAVIFLNTRRKV 287



 Score =  135 bits (327), Expect = 1e-31
 Identities = 81/169 (47%), Positives = 105/169 (62%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           RR L    IK+FVLDEADEMLSRGFKDQI+++F+ L+  +QV+LLSATMP DVLEV++ F
Sbjct: 170 RRYLSPKWIKMFVLDEADEMLSRGFKDQIYEIFQKLNTSIQVVLLSATMPTDVLEVTKKF 229

Query: 438 MRDPVRILVQKEELTLEGIKQFYMH*IRRMEAGNSV*PV*YTVYCTSCNFLQHPSQGGIG 617
           MRDP+RILV+KEELTLEGIKQFY++  R     +++  +  T+  T      +  +    
Sbjct: 230 MRDPIRILVKKEELTLEGIKQFYINVEREEWKLDTLCDLYETLTITQAVIFLNTRRKVDW 289

Query: 618 SLNLCICVTLLYLLCMGDMDQREPEVIMKAVSYWLLLVS*FTTDLWARG 764
                           GDMDQ+E +VIM+        V   TTDL ARG
Sbjct: 290 LTEKMHARDFTVSALHGDMDQKERDVIMREFRSGSSRVL-ITTDLLARG 337



 Score = 42.3 bits (95), Expect = 0.002
 Identities = 23/55 (41%), Positives = 31/55 (56%), Gaps = 3/55 (5%)
 Frame = +2

Query: 512 LN*KNGSWKLCVTCMIH---CLLHKL*FSATPVARWDWLTESMHLRDFTVSAMHG 667
           +N +   WKL   C ++    +   + F  T   + DWLTE MH RDFTVSA+HG
Sbjct: 253 INVEREEWKLDTLCDLYETLTITQAVIFLNTR-RKVDWLTEKMHARDFTVSALHG 306


>BC015842-1|AAH15842.1|  407|Homo sapiens eukaryotic translation
           initiation factor 4A, isoform 2 protein.
          Length = 407

 Score =  170 bits (413), Expect = 5e-42
 Identities = 98/208 (47%), Positives = 137/208 (65%), Gaps = 5/208 (2%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTATF+ISILQQ++   +E QAL+LAPTRELAQQIQKV++ALGD++ A CHACIGGTNV
Sbjct: 82  GKTATFAISILQQLEIEFKETQALVLAPTRELAQQIQKVILALGDYMGATCHACIGGTNV 141

Query: 181 REDIRQLES-GVHVVVGTPGRVYDMILVVRFMPTPSNFLFLMKLMKCCPEVSRTRSMMSS 357
           R ++++L++   H+VVGTPGRV+DM L  R++ +P  ++ +  L +    +SR       
Sbjct: 142 RNEMQKLQAEAPHIVVGTPGRVFDM-LNRRYL-SP-KWIKMFVLDEADEMLSRGFKDQIY 198

Query: 358 RFCQLMFKSYYSLLPCLMMYWKYLDAL*EIL---YAYLYRRKSLPWKVLNNFTC-IELEE 525
              Q +  S   +L    M    L+   + +      L +++ L  + +  F   +E EE
Sbjct: 199 EIFQKLNTSIQVVLLSATMPTDVLEVTKKFMRDPIRILVKKEELTLEGIKQFYINVEREE 258

Query: 526 WKLETLCDLYDTLSIAQAVIFCNTRRKV 609
           WKL+TLCDLY+TL+I QAVIF NTRRKV
Sbjct: 259 WKLDTLCDLYETLTITQAVIFLNTRRKV 286



 Score =  135 bits (327), Expect = 1e-31
 Identities = 81/169 (47%), Positives = 105/169 (62%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           RR L    IK+FVLDEADEMLSRGFKDQI+++F+ L+  +QV+LLSATMP DVLEV++ F
Sbjct: 169 RRYLSPKWIKMFVLDEADEMLSRGFKDQIYEIFQKLNTSIQVVLLSATMPTDVLEVTKKF 228

Query: 438 MRDPVRILVQKEELTLEGIKQFYMH*IRRMEAGNSV*PV*YTVYCTSCNFLQHPSQGGIG 617
           MRDP+RILV+KEELTLEGIKQFY++  R     +++  +  T+  T      +  +    
Sbjct: 229 MRDPIRILVKKEELTLEGIKQFYINVEREEWKLDTLCDLYETLTITQAVIFLNTRRKVDW 288

Query: 618 SLNLCICVTLLYLLCMGDMDQREPEVIMKAVSYWLLLVS*FTTDLWARG 764
                           GDMDQ+E +VIM+        V   TTDL ARG
Sbjct: 289 LTEKMHARDFTVSALHGDMDQKERDVIMREFRSGSSRVL-ITTDLLARG 336



 Score = 42.3 bits (95), Expect = 0.002
 Identities = 23/55 (41%), Positives = 31/55 (56%), Gaps = 3/55 (5%)
 Frame = +2

Query: 512 LN*KNGSWKLCVTCMIH---CLLHKL*FSATPVARWDWLTESMHLRDFTVSAMHG 667
           +N +   WKL   C ++    +   + F  T   + DWLTE MH RDFTVSA+HG
Sbjct: 252 INVEREEWKLDTLCDLYETLTITQAVIFLNTR-RKVDWLTEKMHARDFTVSALHG 305


>BC013708-1|AAH13708.1|  407|Homo sapiens eukaryotic translation
           initiation factor 4A, isoform 2 protein.
          Length = 407

 Score =  170 bits (413), Expect = 5e-42
 Identities = 98/208 (47%), Positives = 137/208 (65%), Gaps = 5/208 (2%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTATF+ISILQQ++   +E QAL+LAPTRELAQQIQKV++ALGD++ A CHACIGGTNV
Sbjct: 82  GKTATFAISILQQLEIEFKETQALVLAPTRELAQQIQKVILALGDYMGATCHACIGGTNV 141

Query: 181 REDIRQLES-GVHVVVGTPGRVYDMILVVRFMPTPSNFLFLMKLMKCCPEVSRTRSMMSS 357
           R ++++L++   H+VVGTPGRV+DM L  R++ +P  ++ +  L +    +SR       
Sbjct: 142 RNEMQKLQAEAPHIVVGTPGRVFDM-LNRRYL-SP-KWIKMFVLDEADEMLSRGFKDQIY 198

Query: 358 RFCQLMFKSYYSLLPCLMMYWKYLDAL*EIL---YAYLYRRKSLPWKVLNNFTC-IELEE 525
              Q +  S   +L    M    L+   + +      L +++ L  + +  F   +E EE
Sbjct: 199 EIFQKLNTSIQVVLLSATMPTDVLEVTKKFMRDPIRILVKKEELTLEGIKQFYINVEREE 258

Query: 526 WKLETLCDLYDTLSIAQAVIFCNTRRKV 609
           WKL+TLCDLY+TL+I QAVIF NTRRKV
Sbjct: 259 WKLDTLCDLYETLTITQAVIFLNTRRKV 286



 Score =  135 bits (327), Expect = 1e-31
 Identities = 81/169 (47%), Positives = 105/169 (62%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           RR L    IK+FVLDEADEMLSRGFKDQI+++F+ L+  +QV+LLSATMP DVLEV++ F
Sbjct: 169 RRYLSPKWIKMFVLDEADEMLSRGFKDQIYEIFQKLNTSIQVVLLSATMPTDVLEVTKKF 228

Query: 438 MRDPVRILVQKEELTLEGIKQFYMH*IRRMEAGNSV*PV*YTVYCTSCNFLQHPSQGGIG 617
           MRDP+RILV+KEELTLEGIKQFY++  R     +++  +  T+  T      +  +    
Sbjct: 229 MRDPIRILVKKEELTLEGIKQFYINVEREEWKLDTLCDLYETLTITQAVIFLNTRRKVDW 288

Query: 618 SLNLCICVTLLYLLCMGDMDQREPEVIMKAVSYWLLLVS*FTTDLWARG 764
                           GDMDQ+E +VIM+        V   TTDL ARG
Sbjct: 289 LTEKMHARDFTVSALHGDMDQKERDVIMREFRSGSSRVL-ITTDLLARG 336



 Score = 42.3 bits (95), Expect = 0.002
 Identities = 23/55 (41%), Positives = 31/55 (56%), Gaps = 3/55 (5%)
 Frame = +2

Query: 512 LN*KNGSWKLCVTCMIH---CLLHKL*FSATPVARWDWLTESMHLRDFTVSAMHG 667
           +N +   WKL   C ++    +   + F  T   + DWLTE MH RDFTVSA+HG
Sbjct: 252 INVEREEWKLDTLCDLYETLTITQAVIFLNTR-RKVDWLTEKMHARDFTVSALHG 305


>BC012547-1|AAH12547.1|  408|Homo sapiens eukaryotic translation
           initiation factor 4A, isoform 2 protein.
          Length = 408

 Score =  170 bits (413), Expect = 5e-42
 Identities = 98/208 (47%), Positives = 137/208 (65%), Gaps = 5/208 (2%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTATF+ISILQQ++   +E QAL+LAPTRELAQQIQKV++ALGD++ A CHACIGGTNV
Sbjct: 83  GKTATFAISILQQLEIEFKETQALVLAPTRELAQQIQKVILALGDYMGATCHACIGGTNV 142

Query: 181 REDIRQLES-GVHVVVGTPGRVYDMILVVRFMPTPSNFLFLMKLMKCCPEVSRTRSMMSS 357
           R ++++L++   H+VVGTPGRV+DM L  R++ +P  ++ +  L +    +SR       
Sbjct: 143 RNEMQKLQAEAPHIVVGTPGRVFDM-LNRRYL-SP-KWIKMFVLDEADEMLSRGFKDQIY 199

Query: 358 RFCQLMFKSYYSLLPCLMMYWKYLDAL*EIL---YAYLYRRKSLPWKVLNNFTC-IELEE 525
              Q +  S   +L    M    L+   + +      L +++ L  + +  F   +E EE
Sbjct: 200 EIFQKLNTSIQVVLLSATMPTDVLEVTKKFMRDPIRILVKKEELTLEGIKQFYINVEREE 259

Query: 526 WKLETLCDLYDTLSIAQAVIFCNTRRKV 609
           WKL+TLCDLY+TL+I QAVIF NTRRKV
Sbjct: 260 WKLDTLCDLYETLTITQAVIFLNTRRKV 287



 Score =  135 bits (327), Expect = 1e-31
 Identities = 81/169 (47%), Positives = 105/169 (62%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           RR L    IK+FVLDEADEMLSRGFKDQI+++F+ L+  +QV+LLSATMP DVLEV++ F
Sbjct: 170 RRYLSPKWIKMFVLDEADEMLSRGFKDQIYEIFQKLNTSIQVVLLSATMPTDVLEVTKKF 229

Query: 438 MRDPVRILVQKEELTLEGIKQFYMH*IRRMEAGNSV*PV*YTVYCTSCNFLQHPSQGGIG 617
           MRDP+RILV+KEELTLEGIKQFY++  R     +++  +  T+  T      +  +    
Sbjct: 230 MRDPIRILVKKEELTLEGIKQFYINVEREEWKLDTLCDLYETLTITQAVIFLNTRRKVDW 289

Query: 618 SLNLCICVTLLYLLCMGDMDQREPEVIMKAVSYWLLLVS*FTTDLWARG 764
                           GDMDQ+E +VIM+        V   TTDL ARG
Sbjct: 290 LTEKMHARDFTVSALHGDMDQKERDVIMREFRSGSSRVL-ITTDLLARG 337



 Score = 42.3 bits (95), Expect = 0.002
 Identities = 23/55 (41%), Positives = 31/55 (56%), Gaps = 3/55 (5%)
 Frame = +2

Query: 512 LN*KNGSWKLCVTCMIH---CLLHKL*FSATPVARWDWLTESMHLRDFTVSAMHG 667
           +N +   WKL   C ++    +   + F  T   + DWLTE MH RDFTVSA+HG
Sbjct: 253 INVEREEWKLDTLCDLYETLTITQAVIFLNTR-RKVDWLTEKMHARDFTVSALHG 306


>D30655-1|BAA06336.1|  407|Homo sapiens eukaryotic initiation factor
           4AII protein.
          Length = 407

 Score =  169 bits (411), Expect = 9e-42
 Identities = 97/208 (46%), Positives = 136/208 (65%), Gaps = 5/208 (2%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTATF+ISILQQ++   +E QAL+LAPTRELAQQIQKV++ALGD++ A CHACIGGTNV
Sbjct: 82  GKTATFAISILQQLEIEFKETQALVLAPTRELAQQIQKVILALGDYMGATCHACIGGTNV 141

Query: 181 REDIRQLES-GVHVVVGTPGRVYDMILVVRFMPTPSNFLFLMKLMKCCPEVSRTRSMMSS 357
           R ++++L++   H+VVGTPGRV+DM L  R++ +P  ++ +  L +    +SR       
Sbjct: 142 RNEMQKLQAEAPHIVVGTPGRVFDM-LNRRYL-SP-KWIKMFVLDEADEMLSRGFKDQIY 198

Query: 358 RFCQLMFKSYYSLLPCLMMYWKYLDAL*EIL---YAYLYRRKSLPWKVLNNFTC-IELEE 525
              Q +  S   +     M    L+   + +      L +++ L  + +  F   +E EE
Sbjct: 199 EIFQKLNTSIQVVFASATMPTDVLEVTKKFMRDPIRILVKKEELTLEGIKQFYINVEREE 258

Query: 526 WKLETLCDLYDTLSIAQAVIFCNTRRKV 609
           WKL+TLCDLY+TL+I QAVIF NTRRKV
Sbjct: 259 WKLDTLCDLYETLTITQAVIFLNTRRKV 286



 Score =  132 bits (318), Expect = 2e-30
 Identities = 79/169 (46%), Positives = 103/169 (60%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           RR L    IK+FVLDEADEMLSRGFKDQI+++F+ L+  +QV+  SATMP DVLEV++ F
Sbjct: 169 RRYLSPKWIKMFVLDEADEMLSRGFKDQIYEIFQKLNTSIQVVFASATMPTDVLEVTKKF 228

Query: 438 MRDPVRILVQKEELTLEGIKQFYMH*IRRMEAGNSV*PV*YTVYCTSCNFLQHPSQGGIG 617
           MRDP+RILV+KEELTLEGIKQFY++  R     +++  +  T+  T      +  +    
Sbjct: 229 MRDPIRILVKKEELTLEGIKQFYINVEREEWKLDTLCDLYETLTITQAVIFLNTRRKVDW 288

Query: 618 SLNLCICVTLLYLLCMGDMDQREPEVIMKAVSYWLLLVS*FTTDLWARG 764
                           GDMDQ+E +VIM+        V   TTDL ARG
Sbjct: 289 LTEKMHARDFTVSALHGDMDQKERDVIMREFRSGSSRVL-ITTDLLARG 336



 Score = 42.3 bits (95), Expect = 0.002
 Identities = 23/55 (41%), Positives = 31/55 (56%), Gaps = 3/55 (5%)
 Frame = +2

Query: 512 LN*KNGSWKLCVTCMIH---CLLHKL*FSATPVARWDWLTESMHLRDFTVSAMHG 667
           +N +   WKL   C ++    +   + F  T   + DWLTE MH RDFTVSA+HG
Sbjct: 252 INVEREEWKLDTLCDLYETLTITQAVIFLNTR-RKVDWLTEKMHARDFTVSALHG 305


>D13748-1|BAA02897.1|  406|Homo sapiens eukaryotic initiation factor
           4AI protein.
          Length = 406

 Score =  168 bits (409), Expect = 2e-41
 Identities = 99/209 (47%), Positives = 139/209 (66%), Gaps = 6/209 (2%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTATF+ISILQQI+  ++  QAL+LAPTRELAQQIQKVV+ALGD++ A CHACIGGTNV
Sbjct: 81  GKTATFAISILQQIELDLKATQALVLAPTRELAQQIQKVVMALGDYMGASCHACIGGTNV 140

Query: 181 REDIRQLE-SGVHVVVGTPGRVYDMILVVRFMPTPSNFLFLMKLMKCCPEVSR-TRSMMS 354
           R ++++L+    H++VGTPGRV+DM L  R++ +P  ++ +  L +    +SR  +  + 
Sbjct: 141 RAEVQKLQMEAPHIIVGTPGRVFDM-LNRRYL-SP-KYIKMFVLDEADEMLSRGFKDQIY 197

Query: 355 SRFCQLMFKSYYSLLPCLMMYWKYLDAL*EIL---YAYLYRRKSLPWKVLNNFTC-IELE 522
             F +L   +   LL   M     L+   + +      L +++ L  + +  F   +E E
Sbjct: 198 DIFQKLNSNTQVVLLSATMPS-DVLEVTKKFMRDPIRILVKKEELTLEGIRQFYINVERE 256

Query: 523 EWKLETLCDLYDTLSIAQAVIFCNTRRKV 609
           EWKL+TLCDLY+TL+I QAVIF NTRRKV
Sbjct: 257 EWKLDTLCDLYETLTITQAVIFINTRRKV 285



 Score =  135 bits (327), Expect = 1e-31
 Identities = 81/169 (47%), Positives = 106/169 (62%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           RR L    IK+FVLDEADEMLSRGFKDQI+D+F+ L+++ QV+LLSATMP DVLEV++ F
Sbjct: 168 RRYLSPKYIKMFVLDEADEMLSRGFKDQIYDIFQKLNSNTQVVLLSATMPSDVLEVTKKF 227

Query: 438 MRDPVRILVQKEELTLEGIKQFYMH*IRRMEAGNSV*PV*YTVYCTSCNFLQHPSQGGIG 617
           MRDP+RILV+KEELTLEGI+QFY++  R     +++  +  T+  T      +  +    
Sbjct: 228 MRDPIRILVKKEELTLEGIRQFYINVEREEWKLDTLCDLYETLTITQAVIFINTRRKVDW 287

Query: 618 SLNLCICVTLLYLLCMGDMDQREPEVIMKAVSYWLLLVS*FTTDLWARG 764
                           GDMDQ+E +VIM+        V   TTDL ARG
Sbjct: 288 LTEKMHARDFTVSAMHGDMDQKERDVIMREFRSGSSRVL-ITTDLLARG 335



 Score = 43.6 bits (98), Expect = 8e-04
 Identities = 24/55 (43%), Positives = 31/55 (56%), Gaps = 3/55 (5%)
 Frame = +2

Query: 512 LN*KNGSWKLCVTCMIH---CLLHKL*FSATPVARWDWLTESMHLRDFTVSAMHG 667
           +N +   WKL   C ++    +   + F  T   + DWLTE MH RDFTVSAMHG
Sbjct: 251 INVEREEWKLDTLCDLYETLTITQAVIFINTR-RKVDWLTEKMHARDFTVSAMHG 304


>BT019881-1|AAV38684.1|  406|Homo sapiens eukaryotic translation
           initiation factor 4A, isoform 1 protein.
          Length = 406

 Score =  168 bits (409), Expect = 2e-41
 Identities = 99/209 (47%), Positives = 139/209 (66%), Gaps = 6/209 (2%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTATF+ISILQQI+  ++  QAL+LAPTRELAQQIQKVV+ALGD++ A CHACIGGTNV
Sbjct: 81  GKTATFAISILQQIELDLKATQALVLAPTRELAQQIQKVVMALGDYMGASCHACIGGTNV 140

Query: 181 REDIRQLE-SGVHVVVGTPGRVYDMILVVRFMPTPSNFLFLMKLMKCCPEVSR-TRSMMS 354
           R ++++L+    H++VGTPGRV+DM L  R++ +P  ++ +  L +    +SR  +  + 
Sbjct: 141 RAEVQKLQMEAPHIIVGTPGRVFDM-LNRRYL-SP-KYIKMFVLDEADEMLSRGFKDQIY 197

Query: 355 SRFCQLMFKSYYSLLPCLMMYWKYLDAL*EIL---YAYLYRRKSLPWKVLNNFTC-IELE 522
             F +L   +   LL   M     L+   + +      L +++ L  + +  F   +E E
Sbjct: 198 DIFQKLNSNTQVVLLSATMPS-DVLEVTKKFMRDPIRILVKKEELTLEGIRQFYINVERE 256

Query: 523 EWKLETLCDLYDTLSIAQAVIFCNTRRKV 609
           EWKL+TLCDLY+TL+I QAVIF NTRRKV
Sbjct: 257 EWKLDTLCDLYETLTITQAVIFINTRRKV 285



 Score =  135 bits (327), Expect = 1e-31
 Identities = 81/169 (47%), Positives = 106/169 (62%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           RR L    IK+FVLDEADEMLSRGFKDQI+D+F+ L+++ QV+LLSATMP DVLEV++ F
Sbjct: 168 RRYLSPKYIKMFVLDEADEMLSRGFKDQIYDIFQKLNSNTQVVLLSATMPSDVLEVTKKF 227

Query: 438 MRDPVRILVQKEELTLEGIKQFYMH*IRRMEAGNSV*PV*YTVYCTSCNFLQHPSQGGIG 617
           MRDP+RILV+KEELTLEGI+QFY++  R     +++  +  T+  T      +  +    
Sbjct: 228 MRDPIRILVKKEELTLEGIRQFYINVEREEWKLDTLCDLYETLTITQAVIFINTRRKVDW 287

Query: 618 SLNLCICVTLLYLLCMGDMDQREPEVIMKAVSYWLLLVS*FTTDLWARG 764
                           GDMDQ+E +VIM+        V   TTDL ARG
Sbjct: 288 LTEKMHARDFTVSAMHGDMDQKERDVIMREFRSGSSRVL-ITTDLLARG 335



 Score = 43.6 bits (98), Expect = 8e-04
 Identities = 24/55 (43%), Positives = 31/55 (56%), Gaps = 3/55 (5%)
 Frame = +2

Query: 512 LN*KNGSWKLCVTCMIH---CLLHKL*FSATPVARWDWLTESMHLRDFTVSAMHG 667
           +N +   WKL   C ++    +   + F  T   + DWLTE MH RDFTVSAMHG
Sbjct: 251 INVEREEWKLDTLCDLYETLTITQAVIFINTR-RKVDWLTEKMHARDFTVSAMHG 304


>BT019880-1|AAV38683.1|  406|Homo sapiens eukaryotic translation
           initiation factor 4A, isoform 1 protein.
          Length = 406

 Score =  168 bits (409), Expect = 2e-41
 Identities = 99/209 (47%), Positives = 139/209 (66%), Gaps = 6/209 (2%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTATF+ISILQQI+  ++  QAL+LAPTRELAQQIQKVV+ALGD++ A CHACIGGTNV
Sbjct: 81  GKTATFAISILQQIELDLKATQALVLAPTRELAQQIQKVVMALGDYMGASCHACIGGTNV 140

Query: 181 REDIRQLE-SGVHVVVGTPGRVYDMILVVRFMPTPSNFLFLMKLMKCCPEVSR-TRSMMS 354
           R ++++L+    H++VGTPGRV+DM L  R++ +P  ++ +  L +    +SR  +  + 
Sbjct: 141 RAEVQKLQMEAPHIIVGTPGRVFDM-LNRRYL-SP-KYIKMFVLDEADEMLSRGFKDQIY 197

Query: 355 SRFCQLMFKSYYSLLPCLMMYWKYLDAL*EIL---YAYLYRRKSLPWKVLNNFTC-IELE 522
             F +L   +   LL   M     L+   + +      L +++ L  + +  F   +E E
Sbjct: 198 DIFQKLNSNTQVVLLSATMPS-DVLEVTKKFMRDPIRILVKKEELTLEGIRQFYINVERE 256

Query: 523 EWKLETLCDLYDTLSIAQAVIFCNTRRKV 609
           EWKL+TLCDLY+TL+I QAVIF NTRRKV
Sbjct: 257 EWKLDTLCDLYETLTITQAVIFINTRRKV 285



 Score =  135 bits (327), Expect = 1e-31
 Identities = 81/169 (47%), Positives = 106/169 (62%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           RR L    IK+FVLDEADEMLSRGFKDQI+D+F+ L+++ QV+LLSATMP DVLEV++ F
Sbjct: 168 RRYLSPKYIKMFVLDEADEMLSRGFKDQIYDIFQKLNSNTQVVLLSATMPSDVLEVTKKF 227

Query: 438 MRDPVRILVQKEELTLEGIKQFYMH*IRRMEAGNSV*PV*YTVYCTSCNFLQHPSQGGIG 617
           MRDP+RILV+KEELTLEGI+QFY++  R     +++  +  T+  T      +  +    
Sbjct: 228 MRDPIRILVKKEELTLEGIRQFYINVEREEWKLDTLCDLYETLTITQAVIFINTRRKVDW 287

Query: 618 SLNLCICVTLLYLLCMGDMDQREPEVIMKAVSYWLLLVS*FTTDLWARG 764
                           GDMDQ+E +VIM+        V   TTDL ARG
Sbjct: 288 LTEKMHARDFTVSAMHGDMDQKERDVIMREFRSGSSRVL-ITTDLLARG 335



 Score = 43.6 bits (98), Expect = 8e-04
 Identities = 24/55 (43%), Positives = 31/55 (56%), Gaps = 3/55 (5%)
 Frame = +2

Query: 512 LN*KNGSWKLCVTCMIH---CLLHKL*FSATPVARWDWLTESMHLRDFTVSAMHG 667
           +N +   WKL   C ++    +   + F  T   + DWLTE MH RDFTVSAMHG
Sbjct: 251 INVEREEWKLDTLCDLYETLTITQAVIFINTR-RKVDWLTEKMHARDFTVSAMHG 304


>BC073752-1|AAH73752.1|  406|Homo sapiens eukaryotic translation
           initiation factor 4A, isoform 1 protein.
          Length = 406

 Score =  168 bits (409), Expect = 2e-41
 Identities = 99/209 (47%), Positives = 139/209 (66%), Gaps = 6/209 (2%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTATF+ISILQQI+  ++  QAL+LAPTRELAQQIQKVV+ALGD++ A CHACIGGTNV
Sbjct: 81  GKTATFAISILQQIELDLKATQALVLAPTRELAQQIQKVVMALGDYMGASCHACIGGTNV 140

Query: 181 REDIRQLE-SGVHVVVGTPGRVYDMILVVRFMPTPSNFLFLMKLMKCCPEVSR-TRSMMS 354
           R ++++L+    H++VGTPGRV+DM L  R++ +P  ++ +  L +    +SR  +  + 
Sbjct: 141 RAEVQKLQMEAPHIIVGTPGRVFDM-LNRRYL-SP-KYIKMFVLDEADEMLSRGFKDQIY 197

Query: 355 SRFCQLMFKSYYSLLPCLMMYWKYLDAL*EIL---YAYLYRRKSLPWKVLNNFTC-IELE 522
             F +L   +   LL   M     L+   + +      L +++ L  + +  F   +E E
Sbjct: 198 DIFQKLNSNTQVVLLSATMPS-DVLEVTKKFMRDPIRILVKKEELTLEGIRQFYINVERE 256

Query: 523 EWKLETLCDLYDTLSIAQAVIFCNTRRKV 609
           EWKL+TLCDLY+TL+I QAVIF NTRRKV
Sbjct: 257 EWKLDTLCDLYETLTITQAVIFINTRRKV 285



 Score =  135 bits (327), Expect = 1e-31
 Identities = 81/169 (47%), Positives = 106/169 (62%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           RR L    IK+FVLDEADEMLSRGFKDQI+D+F+ L+++ QV+LLSATMP DVLEV++ F
Sbjct: 168 RRYLSPKYIKMFVLDEADEMLSRGFKDQIYDIFQKLNSNTQVVLLSATMPSDVLEVTKKF 227

Query: 438 MRDPVRILVQKEELTLEGIKQFYMH*IRRMEAGNSV*PV*YTVYCTSCNFLQHPSQGGIG 617
           MRDP+RILV+KEELTLEGI+QFY++  R     +++  +  T+  T      +  +    
Sbjct: 228 MRDPIRILVKKEELTLEGIRQFYINVEREEWKLDTLCDLYETLTITQAVIFINTRRKVDW 287

Query: 618 SLNLCICVTLLYLLCMGDMDQREPEVIMKAVSYWLLLVS*FTTDLWARG 764
                           GDMDQ+E +VIM+        V   TTDL ARG
Sbjct: 288 LTEKMHARDFTVSAMHGDMDQKERDVIMREFRSGSSRVL-ITTDLLARG 335



 Score = 43.6 bits (98), Expect = 8e-04
 Identities = 24/55 (43%), Positives = 31/55 (56%), Gaps = 3/55 (5%)
 Frame = +2

Query: 512 LN*KNGSWKLCVTCMIH---CLLHKL*FSATPVARWDWLTESMHLRDFTVSAMHG 667
           +N +   WKL   C ++    +   + F  T   + DWLTE MH RDFTVSAMHG
Sbjct: 251 INVEREEWKLDTLCDLYETLTITQAVIFINTR-RKVDWLTEKMHARDFTVSAMHG 304


>BC009585-1|AAH09585.1|  406|Homo sapiens eukaryotic translation
           initiation factor 4A, isoform 1 protein.
          Length = 406

 Score =  168 bits (409), Expect = 2e-41
 Identities = 99/209 (47%), Positives = 139/209 (66%), Gaps = 6/209 (2%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTATF+ISILQQI+  ++  QAL+LAPTRELAQQIQKVV+ALGD++ A CHACIGGTNV
Sbjct: 81  GKTATFAISILQQIELDLKATQALVLAPTRELAQQIQKVVMALGDYMGASCHACIGGTNV 140

Query: 181 REDIRQLE-SGVHVVVGTPGRVYDMILVVRFMPTPSNFLFLMKLMKCCPEVSR-TRSMMS 354
           R ++++L+    H++VGTPGRV+DM L  R++ +P  ++ +  L +    +SR  +  + 
Sbjct: 141 RAEVQKLQMEAPHIIVGTPGRVFDM-LNRRYL-SP-KYIKMFVLDEADEMLSRGFKDQIY 197

Query: 355 SRFCQLMFKSYYSLLPCLMMYWKYLDAL*EIL---YAYLYRRKSLPWKVLNNFTC-IELE 522
             F +L   +   LL   M     L+   + +      L +++ L  + +  F   +E E
Sbjct: 198 DIFQKLNSNTQVVLLSATMPS-DVLEVTKKFMRDPIRILVKKEELTLEGIRQFYINVERE 256

Query: 523 EWKLETLCDLYDTLSIAQAVIFCNTRRKV 609
           EWKL+TLCDLY+TL+I QAVIF NTRRKV
Sbjct: 257 EWKLDTLCDLYETLTITQAVIFINTRRKV 285



 Score =  135 bits (327), Expect = 1e-31
 Identities = 81/169 (47%), Positives = 106/169 (62%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           RR L    IK+FVLDEADEMLSRGFKDQI+D+F+ L+++ QV+LLSATMP DVLEV++ F
Sbjct: 168 RRYLSPKYIKMFVLDEADEMLSRGFKDQIYDIFQKLNSNTQVVLLSATMPSDVLEVTKKF 227

Query: 438 MRDPVRILVQKEELTLEGIKQFYMH*IRRMEAGNSV*PV*YTVYCTSCNFLQHPSQGGIG 617
           MRDP+RILV+KEELTLEGI+QFY++  R     +++  +  T+  T      +  +    
Sbjct: 228 MRDPIRILVKKEELTLEGIRQFYINVEREEWKLDTLCDLYETLTITQAVIFINTRRKVDW 287

Query: 618 SLNLCICVTLLYLLCMGDMDQREPEVIMKAVSYWLLLVS*FTTDLWARG 764
                           GDMDQ+E +VIM+        V   TTDL ARG
Sbjct: 288 LTEKMHARDFTVSAMHGDMDQKERDVIMREFRSGSSRVL-ITTDLLARG 335



 Score = 43.6 bits (98), Expect = 8e-04
 Identities = 24/55 (43%), Positives = 31/55 (56%), Gaps = 3/55 (5%)
 Frame = +2

Query: 512 LN*KNGSWKLCVTCMIH---CLLHKL*FSATPVARWDWLTESMHLRDFTVSAMHG 667
           +N +   WKL   C ++    +   + F  T   + DWLTE MH RDFTVSAMHG
Sbjct: 251 INVEREEWKLDTLCDLYETLTITQAVIFINTR-RKVDWLTEKMHARDFTVSAMHG 304


>BC006380-1|AAH06380.1|  473|Homo sapiens Unknown (protein for
           IMAGE:4099962) protein.
          Length = 473

 Score =  168 bits (409), Expect = 2e-41
 Identities = 99/209 (47%), Positives = 139/209 (66%), Gaps = 6/209 (2%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTATF+ISILQQI+  ++  QAL+LAPTRELAQQIQKVV+ALGD++ A CHACIGGTNV
Sbjct: 148 GKTATFAISILQQIELDLKATQALVLAPTRELAQQIQKVVMALGDYMGASCHACIGGTNV 207

Query: 181 REDIRQLE-SGVHVVVGTPGRVYDMILVVRFMPTPSNFLFLMKLMKCCPEVSR-TRSMMS 354
           R ++++L+    H++VGTPGRV+DM L  R++ +P  ++ +  L +    +SR  +  + 
Sbjct: 208 RAEVQKLQMEAPHIIVGTPGRVFDM-LNRRYL-SP-KYIKMFVLDEADEMLSRGFKDQIY 264

Query: 355 SRFCQLMFKSYYSLLPCLMMYWKYLDAL*EIL---YAYLYRRKSLPWKVLNNFTC-IELE 522
             F +L   +   LL   M     L+   + +      L +++ L  + +  F   +E E
Sbjct: 265 DIFQKLNSNTQVVLLSATMPS-DVLEVTKKFMRDPIRILVKKEELTLEGIRQFYINVERE 323

Query: 523 EWKLETLCDLYDTLSIAQAVIFCNTRRKV 609
           EWKL+TLCDLY+TL+I QAVIF NTRRKV
Sbjct: 324 EWKLDTLCDLYETLTITQAVIFINTRRKV 352



 Score =  135 bits (327), Expect = 1e-31
 Identities = 81/169 (47%), Positives = 106/169 (62%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           RR L    IK+FVLDEADEMLSRGFKDQI+D+F+ L+++ QV+LLSATMP DVLEV++ F
Sbjct: 235 RRYLSPKYIKMFVLDEADEMLSRGFKDQIYDIFQKLNSNTQVVLLSATMPSDVLEVTKKF 294

Query: 438 MRDPVRILVQKEELTLEGIKQFYMH*IRRMEAGNSV*PV*YTVYCTSCNFLQHPSQGGIG 617
           MRDP+RILV+KEELTLEGI+QFY++  R     +++  +  T+  T      +  +    
Sbjct: 295 MRDPIRILVKKEELTLEGIRQFYINVEREEWKLDTLCDLYETLTITQAVIFINTRRKVDW 354

Query: 618 SLNLCICVTLLYLLCMGDMDQREPEVIMKAVSYWLLLVS*FTTDLWARG 764
                           GDMDQ+E +VIM+        V   TTDL ARG
Sbjct: 355 LTEKMHARDFTVSAMHGDMDQKERDVIMREFRSGSSRVL-ITTDLLARG 402



 Score = 43.6 bits (98), Expect = 8e-04
 Identities = 24/55 (43%), Positives = 31/55 (56%), Gaps = 3/55 (5%)
 Frame = +2

Query: 512 LN*KNGSWKLCVTCMIH---CLLHKL*FSATPVARWDWLTESMHLRDFTVSAMHG 667
           +N +   WKL   C ++    +   + F  T   + DWLTE MH RDFTVSAMHG
Sbjct: 318 INVEREEWKLDTLCDLYETLTITQAVIFINTR-RKVDWLTEKMHARDFTVSAMHG 371


>AB209593-1|BAD92830.1|  375|Homo sapiens CD68 antigen variant
           protein.
          Length = 375

 Score =  168 bits (409), Expect = 2e-41
 Identities = 99/209 (47%), Positives = 139/209 (66%), Gaps = 6/209 (2%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTATF+ISILQQI+  ++  QAL+LAPTRELAQQIQKVV+ALGD++ A CHACIGGTNV
Sbjct: 79  GKTATFAISILQQIELDLKATQALVLAPTRELAQQIQKVVMALGDYMGASCHACIGGTNV 138

Query: 181 REDIRQLE-SGVHVVVGTPGRVYDMILVVRFMPTPSNFLFLMKLMKCCPEVSR-TRSMMS 354
           R ++++L+    H++VGTPGRV+DM L  R++ +P  ++ +  L +    +SR  +  + 
Sbjct: 139 RAEVQKLQMEAPHIIVGTPGRVFDM-LNRRYL-SP-KYIKMFVLDEADEMLSRGFKDQIY 195

Query: 355 SRFCQLMFKSYYSLLPCLMMYWKYLDAL*EIL---YAYLYRRKSLPWKVLNNFTC-IELE 522
             F +L   +   LL   M     L+   + +      L +++ L  + +  F   +E E
Sbjct: 196 DIFQKLNSNTQVVLLSATMPS-DVLEVTKKFMRDPIRILVKKEELTLEGIRQFYINVERE 254

Query: 523 EWKLETLCDLYDTLSIAQAVIFCNTRRKV 609
           EWKL+TLCDLY+TL+I QAVIF NTRRKV
Sbjct: 255 EWKLDTLCDLYETLTITQAVIFINTRRKV 283



 Score =  130 bits (314), Expect = 5e-30
 Identities = 61/85 (71%), Positives = 76/85 (89%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           RR L    IK+FVLDEADEMLSRGFKDQI+D+F+ L+++ QV+LLSATMP DVLEV++ F
Sbjct: 166 RRYLSPKYIKMFVLDEADEMLSRGFKDQIYDIFQKLNSNTQVVLLSATMPSDVLEVTKKF 225

Query: 438 MRDPVRILVQKEELTLEGIKQFYMH 512
           MRDP+RILV+KEELTLEGI+QFY++
Sbjct: 226 MRDPIRILVKKEELTLEGIRQFYIN 250



 Score = 37.9 bits (84), Expect = 0.039
 Identities = 22/53 (41%), Positives = 29/53 (54%), Gaps = 3/53 (5%)
 Frame = +2

Query: 512 LN*KNGSWKLCVTCMIH---CLLHKL*FSATPVARWDWLTESMHLRDFTVSAM 661
           +N +   WKL   C ++    +   + F  T   + DWLTE MH RDFTVSAM
Sbjct: 249 INVEREEWKLDTLCDLYETLTITQAVIFINTR-RKVDWLTEKMHARDFTVSAM 300


>D17532-1|BAA04482.1|  472|Homo sapiens RCK protein.
          Length = 472

 Score = 87.4 bits (207), Expect = 5e-17
 Identities = 59/208 (28%), Positives = 104/208 (50%), Gaps = 3/208 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLN-AKCHACIGGTN 177
           GK+  + I +L+++D      QA+++ PTRELA Q+ ++ I +  H+  AK  A  GGTN
Sbjct: 134 GKSGAYLIPLLERLDLKKDNIQAMVIVPTRELALQVSQICIQVSKHMGGAKVMATTGGTN 193

Query: 178 VREDIRQLESGVHVVVGTPGRVYDMILVVRFMPTPSNFLFLMKLMKCCPE--VSRTRSMM 351
           +R+DI +L+  VHVV+ TPGR+ D+I            + L +  K   +  V     ++
Sbjct: 194 LRDDIMRLDDTVHVVIATPGRILDLIKKGVAKVDHVQMIVLDEADKLLSQDFVQIMEDII 253

Query: 352 SSRFCQLMFKSYYSLLPCLMMYWKYLDAL*EILYAYLYRRKSLPWKVLNNFTCIELEEWK 531
            +         Y +  P  +   K++++  +  Y  +   + L  K +  +     E  K
Sbjct: 254 LTLPKNRQILLYSATFP--LSVQKFMNSHLQKPYE-INLMEELTLKGVTQYYAYVTERQK 310

Query: 532 LETLCDLYDTLSIAQAVIFCNTRRKVGL 615
           +  L  L+  L I Q++IFCN+ ++V L
Sbjct: 311 VHCLNTLFSRLQINQSIIFCNSSQRVEL 338



 Score = 56.4 bits (130), Expect = 1e-07
 Identities = 29/83 (34%), Positives = 49/83 (59%)
 Frame = +3

Query: 282 IKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRIL 461
           +++ VLDEAD++LS+ F   + D+   L  + Q++L SAT P  V +     ++ P  I 
Sbjct: 229 VQMIVLDEADKLLSQDFVQIMEDIILTLPKNRQILLYSATFPLSVQKFMNSHLQKPYEIN 288

Query: 462 VQKEELTLEGIKQFYMH*IRRME 530
           +  EELTL+G+ Q+Y +   R +
Sbjct: 289 LM-EELTLKGVTQYYAYVTERQK 310


>BC065007-1|AAH65007.1|  483|Homo sapiens DDX6 protein protein.
          Length = 483

 Score = 87.4 bits (207), Expect = 5e-17
 Identities = 59/208 (28%), Positives = 104/208 (50%), Gaps = 3/208 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLN-AKCHACIGGTN 177
           GK+  + I +L+++D      QA+++ PTRELA Q+ ++ I +  H+  AK  A  GGTN
Sbjct: 145 GKSGAYLIPLLERLDLKKDNIQAMVIVPTRELALQVSQICIQVSKHMGGAKVMATTGGTN 204

Query: 178 VREDIRQLESGVHVVVGTPGRVYDMILVVRFMPTPSNFLFLMKLMKCCPE--VSRTRSMM 351
           +R+DI +L+  VHVV+ TPGR+ D+I            + L +  K   +  V     ++
Sbjct: 205 LRDDIMRLDDTVHVVIATPGRILDLIKKGVAKVDHVQMIVLDEADKLLSQDFVQIMEDII 264

Query: 352 SSRFCQLMFKSYYSLLPCLMMYWKYLDAL*EILYAYLYRRKSLPWKVLNNFTCIELEEWK 531
            +         Y +  P  +   K++++  +  Y  +   + L  K +  +     E  K
Sbjct: 265 LTLPKNRQILLYSATFP--LSVQKFMNSHLQKPYE-INLMEELTLKGVTQYYAYVTERQK 321

Query: 532 LETLCDLYDTLSIAQAVIFCNTRRKVGL 615
           +  L  L+  L I Q++IFCN+ ++V L
Sbjct: 322 VHCLNTLFSRLQINQSIIFCNSSQRVEL 349



 Score = 56.4 bits (130), Expect = 1e-07
 Identities = 29/83 (34%), Positives = 49/83 (59%)
 Frame = +3

Query: 282 IKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRIL 461
           +++ VLDEAD++LS+ F   + D+   L  + Q++L SAT P  V +     ++ P  I 
Sbjct: 240 VQMIVLDEADKLLSQDFVQIMEDIILTLPKNRQILLYSATFPLSVQKFMNSHLQKPYEIN 299

Query: 462 VQKEELTLEGIKQFYMH*IRRME 530
           +  EELTL+G+ Q+Y +   R +
Sbjct: 300 LM-EELTLKGVTQYYAYVTERQK 321


>BC034953-1|AAH34953.1|  824|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 20 protein.
          Length = 824

 Score = 67.7 bits (158), Expect = 4e-11
 Identities = 36/86 (41%), Positives = 50/86 (58%), Gaps = 1/86 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNA-KCHACIGGTN 177
           GKT  FS   L  +       Q LILAPTRE+A QI  V+ A+G  +   +CH  IGGT 
Sbjct: 111 GKTCVFSTIALDSLVLENLSTQILILAPTREIAVQIHSVITAIGIKMEGLECHVFIGGTP 170

Query: 178 VREDIRQLESGVHVVVGTPGRVYDMI 255
           + +D  +L+   H+ VG+PGR+  +I
Sbjct: 171 LSQDKTRLKK-CHIAVGSPGRIKQLI 195



 Score = 64.1 bits (149), Expect = 5e-10
 Identities = 30/81 (37%), Positives = 53/81 (65%), Gaps = 1/81 (1%)
 Frame = +3

Query: 267 LHANTIKLFVLDEADEMLSRG-FKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMR 443
           L+  +I+LF+LDEAD++L  G F++QI+ ++  L A  Q++ +SAT P+ +      +MR
Sbjct: 200 LNPGSIRLFILDEADKLLEEGSFQEQINWIYSSLPASKQMLAVSATYPEFLANALTKYMR 259

Query: 444 DPVRILVQKEELTLEGIKQFY 506
           DP  + +   + +L G+KQ+Y
Sbjct: 260 DPTFVRLNSSDPSLIGLKQYY 280


>BC031062-1|AAH31062.1|  824|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 20 protein.
          Length = 824

 Score = 67.7 bits (158), Expect = 4e-11
 Identities = 36/86 (41%), Positives = 50/86 (58%), Gaps = 1/86 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNA-KCHACIGGTN 177
           GKT  FS   L  +       Q LILAPTRE+A QI  V+ A+G  +   +CH  IGGT 
Sbjct: 111 GKTCVFSTIALDSLVLENLSTQILILAPTREIAVQIHSVITAIGIKMEGLECHVFIGGTP 170

Query: 178 VREDIRQLESGVHVVVGTPGRVYDMI 255
           + +D  +L+   H+ VG+PGR+  +I
Sbjct: 171 LSQDKTRLKK-CHIAVGSPGRIKQLI 195



 Score = 64.1 bits (149), Expect = 5e-10
 Identities = 30/81 (37%), Positives = 53/81 (65%), Gaps = 1/81 (1%)
 Frame = +3

Query: 267 LHANTIKLFVLDEADEMLSRG-FKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMR 443
           L+  +I+LF+LDEAD++L  G F++QI+ ++  L A  Q++ +SAT P+ +      +MR
Sbjct: 200 LNPGSIRLFILDEADKLLEEGSFQEQINWIYSSLPASKQMLAVSATYPEFLANALTKYMR 259

Query: 444 DPVRILVQKEELTLEGIKQFY 506
           DP  + +   + +L G+KQ+Y
Sbjct: 260 DPTFVRLNSSDPSLIGLKQYY 280


>BC011556-1|AAH11556.1|  824|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 20 protein.
          Length = 824

 Score = 67.7 bits (158), Expect = 4e-11
 Identities = 36/86 (41%), Positives = 50/86 (58%), Gaps = 1/86 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNA-KCHACIGGTN 177
           GKT  FS   L  +       Q LILAPTRE+A QI  V+ A+G  +   +CH  IGGT 
Sbjct: 111 GKTCVFSTIALDSLVLENLSTQILILAPTREIAVQIHSVITAIGIKMEGLECHVFIGGTP 170

Query: 178 VREDIRQLESGVHVVVGTPGRVYDMI 255
           + +D  +L+   H+ VG+PGR+  +I
Sbjct: 171 LSQDKTRLKK-CHIAVGSPGRIKQLI 195



 Score = 64.1 bits (149), Expect = 5e-10
 Identities = 30/81 (37%), Positives = 53/81 (65%), Gaps = 1/81 (1%)
 Frame = +3

Query: 267 LHANTIKLFVLDEADEMLSRG-FKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMR 443
           L+  +I+LF+LDEAD++L  G F++QI+ ++  L A  Q++ +SAT P+ +      +MR
Sbjct: 200 LNPGSIRLFILDEADKLLEEGSFQEQINWIYSSLPASKQMLAVSATYPEFLANALTKYMR 259

Query: 444 DPVRILVQKEELTLEGIKQFY 506
           DP  + +   + +L G+KQ+Y
Sbjct: 260 DPTFVRLNSSDPSLIGLKQYY 280


>AL049557-7|CAB55686.2|  824|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 20 protein.
          Length = 824

 Score = 67.7 bits (158), Expect = 4e-11
 Identities = 36/86 (41%), Positives = 50/86 (58%), Gaps = 1/86 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNA-KCHACIGGTN 177
           GKT  FS   L  +       Q LILAPTRE+A QI  V+ A+G  +   +CH  IGGT 
Sbjct: 111 GKTCVFSTIALDSLVLENLSTQILILAPTREIAVQIHSVITAIGIKMEGLECHVFIGGTP 170

Query: 178 VREDIRQLESGVHVVVGTPGRVYDMI 255
           + +D  +L+   H+ VG+PGR+  +I
Sbjct: 171 LSQDKTRLKK-CHIAVGSPGRIKQLI 195



 Score = 64.1 bits (149), Expect = 5e-10
 Identities = 30/81 (37%), Positives = 53/81 (65%), Gaps = 1/81 (1%)
 Frame = +3

Query: 267 LHANTIKLFVLDEADEMLSRG-FKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMR 443
           L+  +I+LF+LDEAD++L  G F++QI+ ++  L A  Q++ +SAT P+ +      +MR
Sbjct: 200 LNPGSIRLFILDEADKLLEEGSFQEQINWIYSSLPASKQMLAVSATYPEFLANALTKYMR 259

Query: 444 DPVRILVQKEELTLEGIKQFY 506
           DP  + +   + +L G+KQ+Y
Sbjct: 260 DPTFVRLNSSDPSLIGLKQYY 280


>AK001506-1|BAA91727.1|  824|Homo sapiens protein ( Homo sapiens
           cDNA FLJ10644 fis, clone NT2RP2005763, weakly similar to
           EUKARYOTIC INITIATION FACTOR 4A. ).
          Length = 824

 Score = 67.7 bits (158), Expect = 4e-11
 Identities = 36/86 (41%), Positives = 50/86 (58%), Gaps = 1/86 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNA-KCHACIGGTN 177
           GKT  FS   L  +       Q LILAPTRE+A QI  V+ A+G  +   +CH  IGGT 
Sbjct: 111 GKTCVFSTIALDSLVLENLSTQILILAPTREIAVQIHSVITAIGIKMEGLECHVFIGGTP 170

Query: 178 VREDIRQLESGVHVVVGTPGRVYDMI 255
           + +D  +L+   H+ VG+PGR+  +I
Sbjct: 171 LSQDKTRLKK-CHIAVGSPGRIKQLI 195



 Score = 62.1 bits (144), Expect = 2e-09
 Identities = 30/81 (37%), Positives = 52/81 (64%), Gaps = 1/81 (1%)
 Frame = +3

Query: 267 LHANTIKLFVLDEADEMLSRG-FKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMR 443
           L+  +I+LF+LDEAD++L  G F++QI+ ++  L A  Q++ +SAT P+ +      +MR
Sbjct: 200 LNPGSIRLFILDEADKLLEEGSFQEQINWIYSSLPASKQMLAVSATYPEFLANALTKYMR 259

Query: 444 DPVRILVQKEELTLEGIKQFY 506
           DP  + +   + +L G+KQ Y
Sbjct: 260 DPTFVRLNSSDPSLIGLKQCY 280


>AF171063-1|AAF14544.1|  824|Homo sapiens DEAD box RNA helicase
           Gemin3 protein.
          Length = 824

 Score = 67.7 bits (158), Expect = 4e-11
 Identities = 36/86 (41%), Positives = 50/86 (58%), Gaps = 1/86 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNA-KCHACIGGTN 177
           GKT  FS   L  +       Q LILAPTRE+A QI  V+ A+G  +   +CH  IGGT 
Sbjct: 111 GKTCVFSTIALDSLVLENLSTQILILAPTREIAVQIHSVITAIGIKMEGLECHVFIGGTP 170

Query: 178 VREDIRQLESGVHVVVGTPGRVYDMI 255
           + +D  +L+   H+ VG+PGR+  +I
Sbjct: 171 LSQDKTRLKK-CHIAVGSPGRIKQLI 195



 Score = 64.1 bits (149), Expect = 5e-10
 Identities = 30/81 (37%), Positives = 53/81 (65%), Gaps = 1/81 (1%)
 Frame = +3

Query: 267 LHANTIKLFVLDEADEMLSRG-FKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMR 443
           L+  +I+LF+LDEAD++L  G F++QI+ ++  L A  Q++ +SAT P+ +      +MR
Sbjct: 200 LNPGSIRLFILDEADKLLEEGSFQEQINWIYSSLPASKQMLAVSATYPEFLANALTKYMR 259

Query: 444 DPVRILVQKEELTLEGIKQFY 506
           DP  + +   + +L G+KQ+Y
Sbjct: 260 DPTFVRLNSSDPSLIGLKQYY 280


>AF155803-1|AAK56799.1|  824|Homo sapiens DEAD-box corepressor DP103
           protein.
          Length = 824

 Score = 67.7 bits (158), Expect = 4e-11
 Identities = 36/86 (41%), Positives = 50/86 (58%), Gaps = 1/86 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNA-KCHACIGGTN 177
           GKT  FS   L  +       Q LILAPTRE+A QI  V+ A+G  +   +CH  IGGT 
Sbjct: 111 GKTCVFSTIALDSLVLENLSTQILILAPTREIAVQIHSVITAIGIKMEGLECHVFIGGTP 170

Query: 178 VREDIRQLESGVHVVVGTPGRVYDMI 255
           + +D  +L+   H+ VG+PGR+  +I
Sbjct: 171 LSQDKTRLKK-CHIAVGSPGRIKQLI 195



 Score = 64.1 bits (149), Expect = 5e-10
 Identities = 30/81 (37%), Positives = 53/81 (65%), Gaps = 1/81 (1%)
 Frame = +3

Query: 267 LHANTIKLFVLDEADEMLSRG-FKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMR 443
           L+  +I+LF+LDEAD++L  G F++QI+ ++  L A  Q++ +SAT P+ +      +MR
Sbjct: 200 LNPGSIRLFILDEADKLLEEGSFQEQINWIYSSLPASKQMLAVSATYPEFLANALTKYMR 259

Query: 444 DPVRILVQKEELTLEGIKQFY 506
           DP  + +   + +L G+KQ+Y
Sbjct: 260 DPTFVRLNSSDPSLIGLKQYY 280


>AF106019-1|AAD42744.1|  824|Homo sapiens DEAD-box protein protein.
          Length = 824

 Score = 67.7 bits (158), Expect = 4e-11
 Identities = 36/86 (41%), Positives = 50/86 (58%), Gaps = 1/86 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNA-KCHACIGGTN 177
           GKT  FS   L  +       Q LILAPTRE+A QI  V+ A+G  +   +CH  IGGT 
Sbjct: 111 GKTCVFSTIALDSLVLENLSTQILILAPTREIAVQIHSVITAIGIKMEGLECHVFIGGTP 170

Query: 178 VREDIRQLESGVHVVVGTPGRVYDMI 255
           + +D  +L+   H+ VG+PGR+  +I
Sbjct: 171 LSQDKTRLKK-CHIAVGSPGRIKQLI 195



 Score = 64.1 bits (149), Expect = 5e-10
 Identities = 30/81 (37%), Positives = 53/81 (65%), Gaps = 1/81 (1%)
 Frame = +3

Query: 267 LHANTIKLFVLDEADEMLSRG-FKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMR 443
           L+  +I+LF+LDEAD++L  G F++QI+ ++  L A  Q++ +SAT P+ +      +MR
Sbjct: 200 LNPGSIRLFILDEADKLLEEGSFQEQINWIYSSLPASKQMLAVSATYPEFLANALTKYMR 259

Query: 444 DPVRILVQKEELTLEGIKQFY 506
           DP  + +   + +L G+KQ+Y
Sbjct: 260 DPTFVRLNSSDPSLIGLKQYY 280


>BC006544-1|AAH06544.1|  478|Homo sapiens DEAD (Asp-Glu-Ala-As) box
           polypeptide 19A protein.
          Length = 478

 Score = 67.3 bits (157), Expect = 6e-11
 Identities = 58/211 (27%), Positives = 101/211 (47%), Gaps = 10/211 (4%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGD-HLNAKCHACIGGTN 177
           GKTA F +++L +++ S R  Q L L+PT ELA Q  KV+  +G  +   K    + G  
Sbjct: 142 GKTAAFVLAMLSRVEPSDRYPQCLCLSPTYELALQTGKVIEQMGKFYPELKLAYAVRGNK 201

Query: 178 VREDIRQLESGVHVVVGTPGRVYDMILVVRFMPTPSNFLFLMKL--MKCCPEVSRTRSM- 348
           +    R  +    +V+GTPG V D    ++F+      +F++    +    +  + +S+ 
Sbjct: 202 LE---RGQKISEQIVIGTPGTVLDWCSKLKFIDPKKIKVFVLDEADVMIATQGHQDQSIR 258

Query: 349 ---MSSRFCQ-LMFKSYYSLLPCLMMYWKYLDAL*EILYAYLYRRKSLPWKVLNNF--TC 510
              M  R CQ L+F + +         WK+   +         +R+      +  +   C
Sbjct: 259 IQRMLPRNCQMLLFSATFE-----DSVWKFAQKVVPDPNVIKLKREEETLDTIKQYYVLC 313

Query: 511 IELEEWKLETLCDLYDTLSIAQAVIFCNTRR 603
              +E K + LC+LY  ++IAQA+IFC+TR+
Sbjct: 314 SSRDE-KFQALCNLYGAITIAQAMIFCHTRK 343



 Score = 60.1 bits (139), Expect = 9e-09
 Identities = 32/77 (41%), Positives = 53/77 (68%), Gaps = 1/77 (1%)
 Frame = +3

Query: 282 IKLFVLDEADEMLS-RGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRI 458
           IK+FVLDEAD M++ +G +DQ   + ++L  + Q++L SAT  D V + ++  + DP  I
Sbjct: 235 IKVFVLDEADVMIATQGHQDQSIRIQRMLPRNCQMLLFSATFEDSVWKFAQKVVPDPNVI 294

Query: 459 LVQKEELTLEGIKQFYM 509
            +++EE TL+ IKQ+Y+
Sbjct: 295 KLKREEETLDTIKQYYV 311


>BC005162-1|AAH05162.1|  478|Homo sapiens DEAD (Asp-Glu-Ala-As) box
           polypeptide 19A protein.
          Length = 478

 Score = 67.3 bits (157), Expect = 6e-11
 Identities = 58/211 (27%), Positives = 101/211 (47%), Gaps = 10/211 (4%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGD-HLNAKCHACIGGTN 177
           GKTA F +++L +++ S R  Q L L+PT ELA Q  KV+  +G  +   K    + G  
Sbjct: 142 GKTAAFVLAMLSRVEPSDRYPQCLCLSPTYELALQTGKVIEQMGKFYPELKLAYAVRGNK 201

Query: 178 VREDIRQLESGVHVVVGTPGRVYDMILVVRFMPTPSNFLFLMKL--MKCCPEVSRTRSM- 348
           +    R  +    +V+GTPG V D    ++F+      +F++    +    +  + +S+ 
Sbjct: 202 LE---RGQKISEQIVIGTPGTVLDWCSKLKFIDPKKIKVFVLDEADVMIATQGHQDQSIR 258

Query: 349 ---MSSRFCQ-LMFKSYYSLLPCLMMYWKYLDAL*EILYAYLYRRKSLPWKVLNNF--TC 510
              M  R CQ L+F + +         WK+   +         +R+      +  +   C
Sbjct: 259 IQRMLPRNCQMLLFSATFE-----DSVWKFAQKVVPDPNVIKLKREEETLDTIKQYYVLC 313

Query: 511 IELEEWKLETLCDLYDTLSIAQAVIFCNTRR 603
              +E K + LC+LY  ++IAQA+IFC+TR+
Sbjct: 314 SSRDE-KFQALCNLYGAITIAQAMIFCHTRK 343



 Score = 60.1 bits (139), Expect = 9e-09
 Identities = 32/77 (41%), Positives = 53/77 (68%), Gaps = 1/77 (1%)
 Frame = +3

Query: 282 IKLFVLDEADEMLS-RGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRI 458
           IK+FVLDEAD M++ +G +DQ   + ++L  + Q++L SAT  D V + ++  + DP  I
Sbjct: 235 IKVFVLDEADVMIATQGHQDQSIRIQRMLPRNCQMLLFSATFEDSVWKFAQKVVPDPNVI 294

Query: 459 LVQKEELTLEGIKQFYM 509
            +++EE TL+ IKQ+Y+
Sbjct: 295 KLKREEETLDTIKQYYV 311


>AK223262-1|BAD96982.1|  478|Homo sapiens DDX19-like protein variant
           protein.
          Length = 478

 Score = 67.3 bits (157), Expect = 6e-11
 Identities = 58/211 (27%), Positives = 101/211 (47%), Gaps = 10/211 (4%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGD-HLNAKCHACIGGTN 177
           GKTA F +++L +++ S R  Q L L+PT ELA Q  KV+  +G  +   K    + G  
Sbjct: 142 GKTAAFVLAMLSRVEPSDRYPQCLCLSPTYELALQTGKVIEQMGKFYPELKLAYAVRGNK 201

Query: 178 VREDIRQLESGVHVVVGTPGRVYDMILVVRFMPTPSNFLFLMKL--MKCCPEVSRTRSM- 348
           +    R  +    +V+GTPG V D    ++F+      +F++    +    +  + +S+ 
Sbjct: 202 LE---RGQKISEQIVIGTPGTVLDWCSKLKFIDPKKIKVFVLDEADVMIATQGHQDQSIR 258

Query: 349 ---MSSRFCQ-LMFKSYYSLLPCLMMYWKYLDAL*EILYAYLYRRKSLPWKVLNNF--TC 510
              M  R CQ L+F + +         WK+   +         +R+      +  +   C
Sbjct: 259 IQRMLPRNCQMLLFSATFE-----DSVWKFAQKVVPDPNVIKLKREEETLDTIKQYYVLC 313

Query: 511 IELEEWKLETLCDLYDTLSIAQAVIFCNTRR 603
              +E K + LC+LY  ++IAQA+IFC+TR+
Sbjct: 314 SSRDE-KFQALCNLYGAITIAQAMIFCHTRK 343



 Score = 60.1 bits (139), Expect = 9e-09
 Identities = 32/77 (41%), Positives = 53/77 (68%), Gaps = 1/77 (1%)
 Frame = +3

Query: 282 IKLFVLDEADEMLS-RGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRI 458
           IK+FVLDEAD M++ +G +DQ   + ++L  + Q++L SAT  D V + ++  + DP  I
Sbjct: 235 IKVFVLDEADVMIATQGHQDQSIRIQRMLPRNCQMLLFSATFEDSVWKFAQKVVPDPNVI 294

Query: 459 LVQKEELTLEGIKQFYM 509
            +++EE TL+ IKQ+Y+
Sbjct: 295 KLKREEETLDTIKQYYV 311


>AK001988-1|BAA92022.1|  478|Homo sapiens protein ( Homo sapiens
           cDNA FLJ11126 fis, clone PLACE1006196, weakly similar to
           PUTATIVE ATP-DEPENDENT RNA HELICASE C12C2.06. ).
          Length = 478

 Score = 67.3 bits (157), Expect = 6e-11
 Identities = 58/211 (27%), Positives = 101/211 (47%), Gaps = 10/211 (4%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGD-HLNAKCHACIGGTN 177
           GKTA F +++L +++ S R  Q L L+PT ELA Q  KV+  +G  +   K    + G  
Sbjct: 142 GKTAAFVLAMLSRVEPSDRYPQCLCLSPTYELALQTGKVIEQMGKFYPELKLAYAVRGNK 201

Query: 178 VREDIRQLESGVHVVVGTPGRVYDMILVVRFMPTPSNFLFLMKL--MKCCPEVSRTRSM- 348
           +    R  +    +V+GTPG V D    ++F+      +F++    +    +  + +S+ 
Sbjct: 202 LE---RGQKISEQIVIGTPGTVLDWCSKLKFIDPKKIKVFVLDEADVMIATQGHQDQSIR 258

Query: 349 ---MSSRFCQ-LMFKSYYSLLPCLMMYWKYLDAL*EILYAYLYRRKSLPWKVLNNF--TC 510
              M  R CQ L+F + +         WK+   +         +R+      +  +   C
Sbjct: 259 IQRMLPRNCQMLLFSATFE-----DSVWKFAQKVVPDPNVIKLKREEETLDTIKQYYVLC 313

Query: 511 IELEEWKLETLCDLYDTLSIAQAVIFCNTRR 603
              +E K + LC+LY  ++IAQA+IFC+TR+
Sbjct: 314 SSRDE-KFQALCNLYGAITIAQAMIFCHTRK 343



 Score = 60.1 bits (139), Expect = 9e-09
 Identities = 32/77 (41%), Positives = 53/77 (68%), Gaps = 1/77 (1%)
 Frame = +3

Query: 282 IKLFVLDEADEMLS-RGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRI 458
           IK+FVLDEAD M++ +G +DQ   + ++L  + Q++L SAT  D V + ++  + DP  I
Sbjct: 235 IKVFVLDEADVMIATQGHQDQSIRIQRMLPRNCQMLLFSATFEDSVWKFAQKVVPDPNVI 294

Query: 459 LVQKEELTLEGIKQFYM 509
            +++EE TL+ IKQ+Y+
Sbjct: 295 KLKREEETLDTIKQYYV 311


>CR533509-1|CAG38540.1|  448|Homo sapiens DDX19 protein.
          Length = 448

 Score = 66.5 bits (155), Expect = 1e-10
 Identities = 57/211 (27%), Positives = 101/211 (47%), Gaps = 10/211 (4%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGD-HLNAKCHACIGGTN 177
           GKTA F +++L Q++ + +  Q L L+PT ELA Q  KV+  +G  +   K    + G  
Sbjct: 112 GKTAAFVLAMLSQVEPANKYPQCLCLSPTYELALQTGKVIEQMGKFYPELKLAYAVRGNK 171

Query: 178 VREDIRQLESGVHVVVGTPGRVYDMILVVRFMPTPSNFLFLMKL--MKCCPEVSRTRSM- 348
           +    R  +    +V+GTPG V D    ++F+      +F++    +    +  + +S+ 
Sbjct: 172 LE---RGQKISEQIVIGTPGTVLDWCSKLKFIDPKKIKVFVLDEADVMIATQGHQDQSIR 228

Query: 349 ---MSSRFCQ-LMFKSYYSLLPCLMMYWKYLDAL*EILYAYLYRRKSLPWKVLNNF--TC 510
              M  R CQ L+F + +         WK+   +         +R+      +  +   C
Sbjct: 229 IQRMLPRNCQMLLFSATFE-----DSVWKFAQKVVPDPNVIKLKREEETLDTIKQYYVLC 283

Query: 511 IELEEWKLETLCDLYDTLSIAQAVIFCNTRR 603
              +E K + LC+LY  ++IAQA+IFC+TR+
Sbjct: 284 SSRDE-KFQALCNLYGAITIAQAMIFCHTRK 313



 Score = 60.1 bits (139), Expect = 9e-09
 Identities = 32/77 (41%), Positives = 53/77 (68%), Gaps = 1/77 (1%)
 Frame = +3

Query: 282 IKLFVLDEADEMLS-RGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRI 458
           IK+FVLDEAD M++ +G +DQ   + ++L  + Q++L SAT  D V + ++  + DP  I
Sbjct: 205 IKVFVLDEADVMIATQGHQDQSIRIQRMLPRNCQMLLFSATFEDSVWKFAQKVVPDPNVI 264

Query: 459 LVQKEELTLEGIKQFYM 509
            +++EE TL+ IKQ+Y+
Sbjct: 265 KLKREEETLDTIKQYYV 281


>BC110805-1|AAI10806.1|  449|Homo sapiens DDX19B protein protein.
          Length = 449

 Score = 66.5 bits (155), Expect = 1e-10
 Identities = 57/211 (27%), Positives = 101/211 (47%), Gaps = 10/211 (4%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGD-HLNAKCHACIGGTN 177
           GKTA F +++L Q++ + +  Q L L+PT ELA Q  KV+  +G  +   K    + G  
Sbjct: 113 GKTAAFVLAMLSQVEPANKYPQCLCLSPTYELALQTGKVIEQMGKFYPELKLAYAVRGNK 172

Query: 178 VREDIRQLESGVHVVVGTPGRVYDMILVVRFMPTPSNFLFLMKL--MKCCPEVSRTRSM- 348
           +    R  +    +V+GTPG V D    ++F+      +F++    +    +  + +S+ 
Sbjct: 173 LE---RGQKISEQIVIGTPGTVLDWCSKLKFIDPKKIKVFVLDEADVMIATQGHQDQSIR 229

Query: 349 ---MSSRFCQ-LMFKSYYSLLPCLMMYWKYLDAL*EILYAYLYRRKSLPWKVLNNF--TC 510
              M  R CQ L+F + +         WK+   +         +R+      +  +   C
Sbjct: 230 IQRMLPRNCQMLLFSATFE-----DSVWKFAQKVVPDPNVIKLKREEETLDTIKQYYVLC 284

Query: 511 IELEEWKLETLCDLYDTLSIAQAVIFCNTRR 603
              +E K + LC+LY  ++IAQA+IFC+TR+
Sbjct: 285 SSRDE-KFQALCNLYGAITIAQAMIFCHTRK 314



 Score = 60.1 bits (139), Expect = 9e-09
 Identities = 32/77 (41%), Positives = 53/77 (68%), Gaps = 1/77 (1%)
 Frame = +3

Query: 282 IKLFVLDEADEMLS-RGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRI 458
           IK+FVLDEAD M++ +G +DQ   + ++L  + Q++L SAT  D V + ++  + DP  I
Sbjct: 206 IKVFVLDEADVMIATQGHQDQSIRIQRMLPRNCQMLLFSATFEDSVWKFAQKVVPDPNVI 265

Query: 459 LVQKEELTLEGIKQFYM 509
            +++EE TL+ IKQ+Y+
Sbjct: 266 KLKREEETLDTIKQYYV 282


>BC010008-1|AAH10008.1|  370|Homo sapiens DEAD (Asp-Glu-Ala-As) box
           polypeptide 19B protein.
          Length = 370

 Score = 66.5 bits (155), Expect = 1e-10
 Identities = 57/211 (27%), Positives = 101/211 (47%), Gaps = 10/211 (4%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGD-HLNAKCHACIGGTN 177
           GKTA F +++L Q++ + +  Q L L+PT ELA Q  KV+  +G  +   K    + G  
Sbjct: 34  GKTAAFVLAMLSQVEPANKYPQCLCLSPTYELALQTGKVIEQMGKFYPELKLAYAVRGNK 93

Query: 178 VREDIRQLESGVHVVVGTPGRVYDMILVVRFMPTPSNFLFLMKL--MKCCPEVSRTRSM- 348
           +    R  +    +V+GTPG V D    ++F+      +F++    +    +  + +S+ 
Sbjct: 94  LE---RGQKISEQIVIGTPGTVLDWCSKLKFIDPKKIKVFVLDEADVMIATQGHQDQSIR 150

Query: 349 ---MSSRFCQ-LMFKSYYSLLPCLMMYWKYLDAL*EILYAYLYRRKSLPWKVLNNF--TC 510
              M  R CQ L+F + +         WK+   +         +R+      +  +   C
Sbjct: 151 IQRMLPRNCQMLLFSATFE-----DSVWKFAQKVVPDPNVIKLKREEETLDTIKQYYVLC 205

Query: 511 IELEEWKLETLCDLYDTLSIAQAVIFCNTRR 603
              +E K + LC+LY  ++IAQA+IFC+TR+
Sbjct: 206 SSRDE-KFQALCNLYGAITIAQAMIFCHTRK 235



 Score = 60.1 bits (139), Expect = 9e-09
 Identities = 32/77 (41%), Positives = 53/77 (68%), Gaps = 1/77 (1%)
 Frame = +3

Query: 282 IKLFVLDEADEMLS-RGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRI 458
           IK+FVLDEAD M++ +G +DQ   + ++L  + Q++L SAT  D V + ++  + DP  I
Sbjct: 127 IKVFVLDEADVMIATQGHQDQSIRIQRMLPRNCQMLLFSATFEDSVWKFAQKVVPDPNVI 186

Query: 459 LVQKEELTLEGIKQFYM 509
            +++EE TL+ IKQ+Y+
Sbjct: 187 KLKREEETLDTIKQYYV 203


>BC003626-1|AAH03626.1|  479|Homo sapiens DEAD (Asp-Glu-Ala-As) box
           polypeptide 19B protein.
          Length = 479

 Score = 66.5 bits (155), Expect = 1e-10
 Identities = 57/211 (27%), Positives = 101/211 (47%), Gaps = 10/211 (4%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGD-HLNAKCHACIGGTN 177
           GKTA F +++L Q++ + +  Q L L+PT ELA Q  KV+  +G  +   K    + G  
Sbjct: 143 GKTAAFVLAMLSQVEPANKYPQCLCLSPTYELALQTGKVIEQMGKFYPELKLAYAVRGNK 202

Query: 178 VREDIRQLESGVHVVVGTPGRVYDMILVVRFMPTPSNFLFLMKL--MKCCPEVSRTRSM- 348
           +    R  +    +V+GTPG V D    ++F+      +F++    +    +  + +S+ 
Sbjct: 203 LE---RGQKISEQIVIGTPGTVLDWCSKLKFIDPKKIKVFVLDEADVMIATQGHQDQSIR 259

Query: 349 ---MSSRFCQ-LMFKSYYSLLPCLMMYWKYLDAL*EILYAYLYRRKSLPWKVLNNF--TC 510
              M  R CQ L+F + +         WK+   +         +R+      +  +   C
Sbjct: 260 IQRMLPRNCQMLLFSATFE-----DSVWKFAQKVVPDPNVIKLKREEETLDTIKQYYVLC 314

Query: 511 IELEEWKLETLCDLYDTLSIAQAVIFCNTRR 603
              +E K + LC+LY  ++IAQA+IFC+TR+
Sbjct: 315 SSRDE-KFQALCNLYGAITIAQAMIFCHTRK 344



 Score = 60.1 bits (139), Expect = 9e-09
 Identities = 32/77 (41%), Positives = 53/77 (68%), Gaps = 1/77 (1%)
 Frame = +3

Query: 282 IKLFVLDEADEMLS-RGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRI 458
           IK+FVLDEAD M++ +G +DQ   + ++L  + Q++L SAT  D V + ++  + DP  I
Sbjct: 236 IKVFVLDEADVMIATQGHQDQSIRIQRMLPRNCQMLLFSATFEDSVWKFAQKVVPDPNVI 295

Query: 459 LVQKEELTLEGIKQFYM 509
            +++EE TL+ IKQ+Y+
Sbjct: 296 KLKREEETLDTIKQYYV 312


>AK223115-1|BAD96835.1|  479|Homo sapiens DEAD (Asp-Glu-Ala-As) box
           polypeptide 19 variant protein.
          Length = 479

 Score = 66.5 bits (155), Expect = 1e-10
 Identities = 57/211 (27%), Positives = 101/211 (47%), Gaps = 10/211 (4%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGD-HLNAKCHACIGGTN 177
           GKTA F +++L Q++ + +  Q L L+PT ELA Q  KV+  +G  +   K    + G  
Sbjct: 143 GKTAAFVLAMLSQVEPANKYPQCLCLSPTYELALQTGKVIEQMGKFYPELKLAYAVRGNK 202

Query: 178 VREDIRQLESGVHVVVGTPGRVYDMILVVRFMPTPSNFLFLMKL--MKCCPEVSRTRSM- 348
           +    R  +    +V+GTPG V D    ++F+      +F++    +    +  + +S+ 
Sbjct: 203 LE---RGQKISEQIVIGTPGTVLDWCSKLKFIDPKKIKVFVLDEADVMIATQGHQDQSIR 259

Query: 349 ---MSSRFCQ-LMFKSYYSLLPCLMMYWKYLDAL*EILYAYLYRRKSLPWKVLNNF--TC 510
              M  R CQ L+F + +         WK+   +         +R+      +  +   C
Sbjct: 260 IQRMLPRNCQMLLFSATFE-----DSVWKFAQKVVPDPNVIKLKREEETLDTIKQYYVLC 314

Query: 511 IELEEWKLETLCDLYDTLSIAQAVIFCNTRR 603
              +E K + LC+LY  ++IAQA+IFC+TR+
Sbjct: 315 SSRDE-KFQALCNLYGAITIAQAMIFCHTRK 344



 Score = 60.1 bits (139), Expect = 9e-09
 Identities = 32/77 (41%), Positives = 53/77 (68%), Gaps = 1/77 (1%)
 Frame = +3

Query: 282 IKLFVLDEADEMLS-RGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRI 458
           IK+FVLDEAD M++ +G +DQ   + ++L  + Q++L SAT  D V + ++  + DP  I
Sbjct: 236 IKVFVLDEADVMIATQGHQDQSIRIQRMLPRNCQMLLFSATFEDSVWKFAQKVVPDPNVI 295

Query: 459 LVQKEELTLEGIKQFYM 509
            +++EE TL+ IKQ+Y+
Sbjct: 296 KLKREEETLDTIKQYYV 312


>AJ237946-1|CAB52189.1|  479|Homo sapiens DEAD Box Protein 5
           protein.
          Length = 479

 Score = 66.5 bits (155), Expect = 1e-10
 Identities = 57/211 (27%), Positives = 101/211 (47%), Gaps = 10/211 (4%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGD-HLNAKCHACIGGTN 177
           GKTA F +++L Q++ + +  Q L L+PT ELA Q  KV+  +G  +   K    + G  
Sbjct: 143 GKTAAFVLAMLSQVEPANKYPQCLCLSPTYELALQTGKVIEQMGKFYPELKLAYAVRGNK 202

Query: 178 VREDIRQLESGVHVVVGTPGRVYDMILVVRFMPTPSNFLFLMKL--MKCCPEVSRTRSM- 348
           +    R  +    +V+GTPG V D    ++F+      +F++    +    +  + +S+ 
Sbjct: 203 LE---RGQKISEQIVIGTPGTVLDWCSKLKFIDPKKIKVFVLDEADVMIATQGHQDQSIR 259

Query: 349 ---MSSRFCQ-LMFKSYYSLLPCLMMYWKYLDAL*EILYAYLYRRKSLPWKVLNNF--TC 510
              M  R CQ L+F + +         WK+   +         +R+      +  +   C
Sbjct: 260 IQRMLPRNCQMLLFSATFE-----DSVWKFAQKVVPDPNVIKLKREEETLDTIKQYYVLC 314

Query: 511 IELEEWKLETLCDLYDTLSIAQAVIFCNTRR 603
              +E K + LC+LY  ++IAQA+IFC+TR+
Sbjct: 315 SSRDE-KFQALCNLYGAITIAQAMIFCHTRK 344



 Score = 60.1 bits (139), Expect = 9e-09
 Identities = 32/77 (41%), Positives = 53/77 (68%), Gaps = 1/77 (1%)
 Frame = +3

Query: 282 IKLFVLDEADEMLS-RGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRI 458
           IK+FVLDEAD M++ +G +DQ   + ++L  + Q++L SAT  D V + ++  + DP  I
Sbjct: 236 IKVFVLDEADVMIATQGHQDQSIRIQRMLPRNCQMLLFSATFEDSVWKFAQKVVPDPNVI 295

Query: 459 LVQKEELTLEGIKQFYM 509
            +++EE TL+ IKQ+Y+
Sbjct: 296 KLKREEETLDTIKQYYV 312


>AF353720-1|AAK40102.1|  370|Homo sapiens testicular DEAD-box
           helicase protein protein.
          Length = 370

 Score = 66.5 bits (155), Expect = 1e-10
 Identities = 57/211 (27%), Positives = 101/211 (47%), Gaps = 10/211 (4%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGD-HLNAKCHACIGGTN 177
           GKTA F +++L Q++ + +  Q L L+PT ELA Q  KV+  +G  +   K    + G  
Sbjct: 34  GKTAAFVLAMLSQVEPANKYPQCLCLSPTYELALQTGKVIEQMGKFYPELKLAYAVRGNK 93

Query: 178 VREDIRQLESGVHVVVGTPGRVYDMILVVRFMPTPSNFLFLMKL--MKCCPEVSRTRSM- 348
           +    R  +    +V+GTPG V D    ++F+      +F++    +    +  + +S+ 
Sbjct: 94  LE---RGQKISEQIVIGTPGTVLDWCSKLKFIDPKKIKVFVLDEADVMIATQGHQDQSIR 150

Query: 349 ---MSSRFCQ-LMFKSYYSLLPCLMMYWKYLDAL*EILYAYLYRRKSLPWKVLNNF--TC 510
              M  R CQ L+F + +         WK+   +         +R+      +  +   C
Sbjct: 151 IQRMLPRNCQMLLFSATFE-----DSVWKFAQKVVPDPNVIKLKREEETLDTIKQYYVLC 205

Query: 511 IELEEWKLETLCDLYDTLSIAQAVIFCNTRR 603
              +E K + LC+LY  ++IAQA+IFC+TR+
Sbjct: 206 SSRDE-KFQALCNLYGAITIAQAMIFCHTRK 235



 Score = 60.1 bits (139), Expect = 9e-09
 Identities = 32/77 (41%), Positives = 53/77 (68%), Gaps = 1/77 (1%)
 Frame = +3

Query: 282 IKLFVLDEADEMLS-RGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRI 458
           IK+FVLDEAD M++ +G +DQ   + ++L  + Q++L SAT  D V + ++  + DP  I
Sbjct: 127 IKVFVLDEADVMIATQGHQDQSIRIQRMLPRNCQMLLFSATFEDSVWKFAQKVVPDPNVI 186

Query: 459 LVQKEELTLEGIKQFYM 509
            +++EE TL+ IKQ+Y+
Sbjct: 187 KLKREEETLDTIKQYYV 203


>CR457215-1|CAG33496.1|  479|Homo sapiens DDX19 protein.
          Length = 479

 Score = 65.3 bits (152), Expect = 2e-10
 Identities = 57/211 (27%), Positives = 100/211 (47%), Gaps = 10/211 (4%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGD-HLNAKCHACIGGTN 177
           GKTA F +++L Q++ + +  Q L L+PT ELA Q  KV+  +G  +   K    + G  
Sbjct: 143 GKTAAFVLAMLSQVEPANKYPQCLCLSPTYELALQTGKVIEQMGKFYPELKLAYAVRGNK 202

Query: 178 VREDIRQLESGVHVVVGTPGRVYDMILVVRFMPTPSNFLFLMKL--MKCCPEVSRTRSM- 348
           +    R  +    +V+GTPG V D    ++F+      +F++    +    +  + +S+ 
Sbjct: 203 LE---RGQKISEQIVIGTPGTVLDWCSKLKFIDPKKIKVFVLDEADVMIATQGHQDQSIR 259

Query: 349 ---MSSRFCQ-LMFKSYYSLLPCLMMYWKYLDAL*EILYAYLYRRKSLPWKVLNNF--TC 510
              M  R CQ L+F + +         WK+   +         +R+      +  +   C
Sbjct: 260 IQRMLPRNCQMLLFSATFE-----DSVWKFAQKVVPDPNVIKLKREEETLDTIKQYYVLC 314

Query: 511 IELEEWKLETLCDLYDTLSIAQAVIFCNTRR 603
              +E K + LC+LY   +IAQA+IFC+TR+
Sbjct: 315 SSRDE-KFQALCNLYGATTIAQAMIFCHTRK 344



 Score = 60.1 bits (139), Expect = 9e-09
 Identities = 32/77 (41%), Positives = 53/77 (68%), Gaps = 1/77 (1%)
 Frame = +3

Query: 282 IKLFVLDEADEMLS-RGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRI 458
           IK+FVLDEAD M++ +G +DQ   + ++L  + Q++L SAT  D V + ++  + DP  I
Sbjct: 236 IKVFVLDEADVMIATQGHQDQSIRIQRMLPRNCQMLLFSATFEDSVWKFAQKVVPDPNVI 295

Query: 459 LVQKEELTLEGIKQFYM 509
            +++EE TL+ IKQ+Y+
Sbjct: 296 KLKREEETLDTIKQYYV 312


>AF183422-1|AAG09691.1|  478|Homo sapiens RNA helicase protein.
          Length = 478

 Score = 65.3 bits (152), Expect = 2e-10
 Identities = 57/211 (27%), Positives = 100/211 (47%), Gaps = 10/211 (4%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGD-HLNAKCHACIGGTN 177
           GKTA F +++L +++ S R  Q L L+PT ELA Q  KV+  +G  +   K    + G  
Sbjct: 142 GKTAAFVLAMLSRVEPSDRYPQCLCLSPTYELALQTGKVIEQMGKFYPELKLAYAVRGNK 201

Query: 178 VREDIRQLESGVHVVVGTPGRVYDMILVVRFMPTPSNFLFLMKL--MKCCPEVSRTRSM- 348
           +    R  +    +V+G PG V D    ++F+      +F++    +    +  + +S+ 
Sbjct: 202 LE---RGQKISEQIVIGNPGTVLDWCSKLKFIDPKKIKVFVLDEADVMIATQGHQDQSIR 258

Query: 349 ---MSSRFCQ-LMFKSYYSLLPCLMMYWKYLDAL*EILYAYLYRRKSLPWKVLNNF--TC 510
              M  R CQ L+F + +         WK+   +         +R+      +  +   C
Sbjct: 259 IQRMLPRNCQMLLFSATFE-----DSVWKFAQKVVPDPNVIKLKREEETLDTIKQYYVLC 313

Query: 511 IELEEWKLETLCDLYDTLSIAQAVIFCNTRR 603
              +E K + LC+LY  ++IAQA+IFC+TR+
Sbjct: 314 SSRDE-KFQALCNLYGAITIAQAMIFCHTRK 343



 Score = 60.1 bits (139), Expect = 9e-09
 Identities = 32/77 (41%), Positives = 53/77 (68%), Gaps = 1/77 (1%)
 Frame = +3

Query: 282 IKLFVLDEADEMLS-RGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRI 458
           IK+FVLDEAD M++ +G +DQ   + ++L  + Q++L SAT  D V + ++  + DP  I
Sbjct: 235 IKVFVLDEADVMIATQGHQDQSIRIQRMLPRNCQMLLFSATFEDSVWKFAQKVVPDPNVI 294

Query: 459 LVQKEELTLEGIKQFYM 509
            +++EE TL+ IKQ+Y+
Sbjct: 295 KLKREEETLDTIKQYYV 311


>AF029062-1|AAC63046.1|  284|Homo sapiens DEAD-box protein protein.
          Length = 284

 Score = 65.3 bits (152), Expect = 2e-10
 Identities = 31/85 (36%), Positives = 56/85 (65%), Gaps = 2/85 (2%)
 Frame = +3

Query: 261 RALHANTIKLFVLDEADEMLSR-GFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           ++L+   IK F+LDE D+ML +   +  + ++F++   + QV++ SAT+  ++  V R F
Sbjct: 39  KSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPXEKQVMMFSATLSKEIRPVCRKF 98

Query: 438 MRDPVRILVQKE-ELTLEGIKQFYM 509
           M+DP+ I V  E +LTL G++Q+Y+
Sbjct: 99  MQDPMEIFVDDETKLTLHGLQQYYV 123


>Z37166-1|CAA85523.1|  428|Homo sapiens nuclear RNA helicase (DEAD
           family) protein.
          Length = 428

 Score = 64.9 bits (151), Expect = 3e-10
 Identities = 31/85 (36%), Positives = 56/85 (65%), Gaps = 2/85 (2%)
 Frame = +3

Query: 261 RALHANTIKLFVLDEADEMLSR-GFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           ++L+   IK F+LDE D+ML +   +  + ++F++   + QV++ SAT+  ++  V R F
Sbjct: 183 KSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSKEIRPVCRKF 242

Query: 438 MRDPVRILVQKE-ELTLEGIKQFYM 509
           M+DP+ I V  E +LTL G++Q+Y+
Sbjct: 243 MQDPMEIFVDDETKLTLHGLQQYYV 267



 Score = 58.0 bits (134), Expect = 3e-08
 Identities = 31/83 (37%), Positives = 47/83 (56%), Gaps = 2/83 (2%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTN 177
           GKTA F ++ LQQ++    +   L++  TRELA QI K       ++ N K     GG +
Sbjct: 94  GKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLS 153

Query: 178 VREDIRQLESGV-HVVVGTPGRV 243
           +++D   L+    H+VVGTPGR+
Sbjct: 154 IKKDEEVLKKNCPHIVVGTPGRI 176


>BX248516-6|CAM25877.1|  289|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 289

 Score = 64.9 bits (151), Expect = 3e-10
 Identities = 31/85 (36%), Positives = 56/85 (65%), Gaps = 2/85 (2%)
 Frame = +3

Query: 261 RALHANTIKLFVLDEADEMLSR-GFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           ++L+   IK F+LDE D+ML +   +  + ++F++   + QV++ SAT+  ++  V R F
Sbjct: 183 KSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSKEIRPVCRKF 242

Query: 438 MRDPVRILVQKE-ELTLEGIKQFYM 509
           M+DP+ I V  E +LTL G++Q+Y+
Sbjct: 243 MQDPMEIFVDDETKLTLHGLQQYYV 267



 Score = 58.0 bits (134), Expect = 3e-08
 Identities = 31/83 (37%), Positives = 47/83 (56%), Gaps = 2/83 (2%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTN 177
           GKTA F ++ LQQ++    +   L++  TRELA QI K       ++ N K     GG +
Sbjct: 94  GKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLS 153

Query: 178 VREDIRQLESGV-HVVVGTPGRV 243
           +++D   L+    H+VVGTPGR+
Sbjct: 154 IKKDEEVLKKNCPHIVVGTPGRI 176


>BX248516-5|CAM25876.1|  245|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 245

 Score = 64.9 bits (151), Expect = 3e-10
 Identities = 31/85 (36%), Positives = 56/85 (65%), Gaps = 2/85 (2%)
 Frame = +3

Query: 261 RALHANTIKLFVLDEADEMLSR-GFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           ++L+   IK F+LDE D+ML +   +  + ++F++   + QV++ SAT+  ++  V R F
Sbjct: 105 KSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSKEIRPVCRKF 164

Query: 438 MRDPVRILVQKE-ELTLEGIKQFYM 509
           M+DP+ I V  E +LTL G++Q+Y+
Sbjct: 165 MQDPMEIFVDDETKLTLHGLQQYYV 189


>BX248516-4|CAI41924.2|  425|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 425

 Score = 64.9 bits (151), Expect = 3e-10
 Identities = 31/85 (36%), Positives = 56/85 (65%), Gaps = 2/85 (2%)
 Frame = +3

Query: 261 RALHANTIKLFVLDEADEMLSR-GFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           ++L+   IK F+LDE D+ML +   +  + ++F++   + QV++ SAT+  ++  V R F
Sbjct: 183 KSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSKEIRPVCRKF 242

Query: 438 MRDPVRILVQKE-ELTLEGIKQFYM 509
           M+DP+ I V  E +LTL G++Q+Y+
Sbjct: 243 MQDPMEIFVDDETKLTLHGLQQYYV 267



 Score = 58.0 bits (134), Expect = 3e-08
 Identities = 31/83 (37%), Positives = 47/83 (56%), Gaps = 2/83 (2%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTN 177
           GKTA F ++ LQQ++    +   L++  TRELA QI K       ++ N K     GG +
Sbjct: 94  GKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLS 153

Query: 178 VREDIRQLESGV-HVVVGTPGRV 243
           +++D   L+    H+VVGTPGR+
Sbjct: 154 IKKDEEVLKKNCPHIVVGTPGRI 176


>BX248516-3|CAI41922.1|  428|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 428

 Score = 64.9 bits (151), Expect = 3e-10
 Identities = 31/85 (36%), Positives = 56/85 (65%), Gaps = 2/85 (2%)
 Frame = +3

Query: 261 RALHANTIKLFVLDEADEMLSR-GFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           ++L+   IK F+LDE D+ML +   +  + ++F++   + QV++ SAT+  ++  V R F
Sbjct: 183 KSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSKEIRPVCRKF 242

Query: 438 MRDPVRILVQKE-ELTLEGIKQFYM 509
           M+DP+ I V  E +LTL G++Q+Y+
Sbjct: 243 MQDPMEIFVDDETKLTLHGLQQYYV 267



 Score = 58.0 bits (134), Expect = 3e-08
 Identities = 31/83 (37%), Positives = 47/83 (56%), Gaps = 2/83 (2%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTN 177
           GKTA F ++ LQQ++    +   L++  TRELA QI K       ++ N K     GG +
Sbjct: 94  GKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLS 153

Query: 178 VREDIRQLESGV-HVVVGTPGRV 243
           +++D   L+    H+VVGTPGR+
Sbjct: 154 IKKDEEVLKKNCPHIVVGTPGRI 176


>BX001040-6|CAI18634.1|  428|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 428

 Score = 64.9 bits (151), Expect = 3e-10
 Identities = 31/85 (36%), Positives = 56/85 (65%), Gaps = 2/85 (2%)
 Frame = +3

Query: 261 RALHANTIKLFVLDEADEMLSR-GFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           ++L+   IK F+LDE D+ML +   +  + ++F++   + QV++ SAT+  ++  V R F
Sbjct: 183 KSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSKEIRPVCRKF 242

Query: 438 MRDPVRILVQKE-ELTLEGIKQFYM 509
           M+DP+ I V  E +LTL G++Q+Y+
Sbjct: 243 MQDPMEIFVDDETKLTLHGLQQYYV 267



 Score = 58.0 bits (134), Expect = 3e-08
 Identities = 31/83 (37%), Positives = 47/83 (56%), Gaps = 2/83 (2%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTN 177
           GKTA F ++ LQQ++    +   L++  TRELA QI K       ++ N K     GG +
Sbjct: 94  GKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLS 153

Query: 178 VREDIRQLESGV-HVVVGTPGRV 243
           +++D   L+    H+VVGTPGR+
Sbjct: 154 IKKDEEVLKKNCPHIVVGTPGRI 176


>BT009909-1|AAP88911.1|  428|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 428

 Score = 64.9 bits (151), Expect = 3e-10
 Identities = 31/85 (36%), Positives = 56/85 (65%), Gaps = 2/85 (2%)
 Frame = +3

Query: 261 RALHANTIKLFVLDEADEMLSR-GFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           ++L+   IK F+LDE D+ML +   +  + ++F++   + QV++ SAT+  ++  V R F
Sbjct: 183 KSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSKEIRPVCRKF 242

Query: 438 MRDPVRILVQKE-ELTLEGIKQFYM 509
           M+DP+ I V  E +LTL G++Q+Y+
Sbjct: 243 MQDPMEIFVDDETKLTLHGLQQYYV 267



 Score = 58.0 bits (134), Expect = 3e-08
 Identities = 31/83 (37%), Positives = 47/83 (56%), Gaps = 2/83 (2%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTN 177
           GKTA F ++ LQQ++    +   L++  TRELA QI K       ++ N K     GG +
Sbjct: 94  GKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLS 153

Query: 178 VREDIRQLESGV-HVVVGTPGRV 243
           +++D   L+    H+VVGTPGR+
Sbjct: 154 IKKDEEVLKKNCPHIVVGTPGRI 176


>BC013006-1|AAH13006.1|  428|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 428

 Score = 64.9 bits (151), Expect = 3e-10
 Identities = 31/85 (36%), Positives = 56/85 (65%), Gaps = 2/85 (2%)
 Frame = +3

Query: 261 RALHANTIKLFVLDEADEMLSR-GFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           ++L+   IK F+LDE D+ML +   +  + ++F++   + QV++ SAT+  ++  V R F
Sbjct: 183 KSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSKEIRPVCRKF 242

Query: 438 MRDPVRILVQKE-ELTLEGIKQFYM 509
           M+DP+ I V  E +LTL G++Q+Y+
Sbjct: 243 MQDPMEIFVDDETKLTLHGLQQYYV 267



 Score = 58.0 bits (134), Expect = 3e-08
 Identities = 31/83 (37%), Positives = 47/83 (56%), Gaps = 2/83 (2%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTN 177
           GKTA F ++ LQQ++    +   L++  TRELA QI K       ++ N K     GG +
Sbjct: 94  GKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLS 153

Query: 178 VREDIRQLESGV-HVVVGTPGRV 243
           +++D   L+    H+VVGTPGR+
Sbjct: 154 IKKDEEVLKKNCPHIVVGTPGRI 176


>BC000361-1|AAH00361.1|  428|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 428

 Score = 64.9 bits (151), Expect = 3e-10
 Identities = 31/85 (36%), Positives = 56/85 (65%), Gaps = 2/85 (2%)
 Frame = +3

Query: 261 RALHANTIKLFVLDEADEMLSR-GFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           ++L+   IK F+LDE D+ML +   +  + ++F++   + QV++ SAT+  ++  V R F
Sbjct: 183 KSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSKEIRPVCRKF 242

Query: 438 MRDPVRILVQKE-ELTLEGIKQFYM 509
           M+DP+ I V  E +LTL G++Q+Y+
Sbjct: 243 MQDPMEIFVDDETKLTLHGLQQYYV 267



 Score = 58.0 bits (134), Expect = 3e-08
 Identities = 31/83 (37%), Positives = 47/83 (56%), Gaps = 2/83 (2%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTN 177
           GKTA F ++ LQQ++    +   L++  TRELA QI K       ++ N K     GG +
Sbjct: 94  GKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLS 153

Query: 178 VREDIRQLESGV-HVVVGTPGRV 243
           +++D   L+    H+VVGTPGR+
Sbjct: 154 IKKDEEVLKKNCPHIVVGTPGRI 176


>BA000025-40|BAB63306.1|  428|Homo sapiens putative ATP-dependent
           RNA helicase protein.
          Length = 428

 Score = 64.9 bits (151), Expect = 3e-10
 Identities = 31/85 (36%), Positives = 56/85 (65%), Gaps = 2/85 (2%)
 Frame = +3

Query: 261 RALHANTIKLFVLDEADEMLSR-GFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           ++L+   IK F+LDE D+ML +   +  + ++F++   + QV++ SAT+  ++  V R F
Sbjct: 183 KSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSKEIRPVCRKF 242

Query: 438 MRDPVRILVQKE-ELTLEGIKQFYM 509
           M+DP+ I V  E +LTL G++Q+Y+
Sbjct: 243 MQDPMEIFVDDETKLTLHGLQQYYV 267



 Score = 58.0 bits (134), Expect = 3e-08
 Identities = 31/83 (37%), Positives = 47/83 (56%), Gaps = 2/83 (2%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTN 177
           GKTA F ++ LQQ++    +   L++  TRELA QI K       ++ N K     GG +
Sbjct: 94  GKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLS 153

Query: 178 VREDIRQLESGV-HVVVGTPGRV 243
           +++D   L+    H+VVGTPGR+
Sbjct: 154 IKKDEEVLKKNCPHIVVGTPGRI 176


>AL662847-23|CAO72086.1|  289|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 289

 Score = 64.9 bits (151), Expect = 3e-10
 Identities = 31/85 (36%), Positives = 56/85 (65%), Gaps = 2/85 (2%)
 Frame = +3

Query: 261 RALHANTIKLFVLDEADEMLSR-GFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           ++L+   IK F+LDE D+ML +   +  + ++F++   + QV++ SAT+  ++  V R F
Sbjct: 183 KSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSKEIRPVCRKF 242

Query: 438 MRDPVRILVQKE-ELTLEGIKQFYM 509
           M+DP+ I V  E +LTL G++Q+Y+
Sbjct: 243 MQDPMEIFVDDETKLTLHGLQQYYV 267



 Score = 58.0 bits (134), Expect = 3e-08
 Identities = 31/83 (37%), Positives = 47/83 (56%), Gaps = 2/83 (2%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTN 177
           GKTA F ++ LQQ++    +   L++  TRELA QI K       ++ N K     GG +
Sbjct: 94  GKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLS 153

Query: 178 VREDIRQLESGV-HVVVGTPGRV 243
           +++D   L+    H+VVGTPGR+
Sbjct: 154 IKKDEEVLKKNCPHIVVGTPGRI 176


>AL662847-22|CAO72085.1|  245|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 245

 Score = 64.9 bits (151), Expect = 3e-10
 Identities = 31/85 (36%), Positives = 56/85 (65%), Gaps = 2/85 (2%)
 Frame = +3

Query: 261 RALHANTIKLFVLDEADEMLSR-GFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           ++L+   IK F+LDE D+ML +   +  + ++F++   + QV++ SAT+  ++  V R F
Sbjct: 105 KSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSKEIRPVCRKF 164

Query: 438 MRDPVRILVQKE-ELTLEGIKQFYM 509
           M+DP+ I V  E +LTL G++Q+Y+
Sbjct: 165 MQDPMEIFVDDETKLTLHGLQQYYV 189


>AL662847-21|CAI17672.2|  425|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 425

 Score = 64.9 bits (151), Expect = 3e-10
 Identities = 31/85 (36%), Positives = 56/85 (65%), Gaps = 2/85 (2%)
 Frame = +3

Query: 261 RALHANTIKLFVLDEADEMLSR-GFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           ++L+   IK F+LDE D+ML +   +  + ++F++   + QV++ SAT+  ++  V R F
Sbjct: 183 KSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSKEIRPVCRKF 242

Query: 438 MRDPVRILVQKE-ELTLEGIKQFYM 509
           M+DP+ I V  E +LTL G++Q+Y+
Sbjct: 243 MQDPMEIFVDDETKLTLHGLQQYYV 267



 Score = 58.0 bits (134), Expect = 3e-08
 Identities = 31/83 (37%), Positives = 47/83 (56%), Gaps = 2/83 (2%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTN 177
           GKTA F ++ LQQ++    +   L++  TRELA QI K       ++ N K     GG +
Sbjct: 94  GKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLS 153

Query: 178 VREDIRQLESGV-HVVVGTPGRV 243
           +++D   L+    H+VVGTPGR+
Sbjct: 154 IKKDEEVLKKNCPHIVVGTPGRI 176


>AL662847-20|CAI17664.2|  428|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 428

 Score = 64.9 bits (151), Expect = 3e-10
 Identities = 31/85 (36%), Positives = 56/85 (65%), Gaps = 2/85 (2%)
 Frame = +3

Query: 261 RALHANTIKLFVLDEADEMLSR-GFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           ++L+   IK F+LDE D+ML +   +  + ++F++   + QV++ SAT+  ++  V R F
Sbjct: 183 KSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSKEIRPVCRKF 242

Query: 438 MRDPVRILVQKE-ELTLEGIKQFYM 509
           M+DP+ I V  E +LTL G++Q+Y+
Sbjct: 243 MQDPMEIFVDDETKLTLHGLQQYYV 267



 Score = 58.0 bits (134), Expect = 3e-08
 Identities = 31/83 (37%), Positives = 47/83 (56%), Gaps = 2/83 (2%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTN 177
           GKTA F ++ LQQ++    +   L++  TRELA QI K       ++ N K     GG +
Sbjct: 94  GKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLS 153

Query: 178 VREDIRQLESGV-HVVVGTPGRV 243
           +++D   L+    H+VVGTPGR+
Sbjct: 154 IKKDEEVLKKNCPHIVVGTPGRI 176


>AL662801-6|CAI18282.2|  289|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 289

 Score = 64.9 bits (151), Expect = 3e-10
 Identities = 31/85 (36%), Positives = 56/85 (65%), Gaps = 2/85 (2%)
 Frame = +3

Query: 261 RALHANTIKLFVLDEADEMLSR-GFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           ++L+   IK F+LDE D+ML +   +  + ++F++   + QV++ SAT+  ++  V R F
Sbjct: 183 KSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSKEIRPVCRKF 242

Query: 438 MRDPVRILVQKE-ELTLEGIKQFYM 509
           M+DP+ I V  E +LTL G++Q+Y+
Sbjct: 243 MQDPMEIFVDDETKLTLHGLQQYYV 267



 Score = 58.0 bits (134), Expect = 3e-08
 Identities = 31/83 (37%), Positives = 47/83 (56%), Gaps = 2/83 (2%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTN 177
           GKTA F ++ LQQ++    +   L++  TRELA QI K       ++ N K     GG +
Sbjct: 94  GKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLS 153

Query: 178 VREDIRQLESGV-HVVVGTPGRV 243
           +++D   L+    H+VVGTPGR+
Sbjct: 154 IKKDEEVLKKNCPHIVVGTPGRI 176


>AL662801-5|CAM25576.1|  245|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 245

 Score = 64.9 bits (151), Expect = 3e-10
 Identities = 31/85 (36%), Positives = 56/85 (65%), Gaps = 2/85 (2%)
 Frame = +3

Query: 261 RALHANTIKLFVLDEADEMLSR-GFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           ++L+   IK F+LDE D+ML +   +  + ++F++   + QV++ SAT+  ++  V R F
Sbjct: 105 KSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSKEIRPVCRKF 164

Query: 438 MRDPVRILVQKE-ELTLEGIKQFYM 509
           M+DP+ I V  E +LTL G++Q+Y+
Sbjct: 165 MQDPMEIFVDDETKLTLHGLQQYYV 189


>AL662801-4|CAI18284.2|  425|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 425

 Score = 64.9 bits (151), Expect = 3e-10
 Identities = 31/85 (36%), Positives = 56/85 (65%), Gaps = 2/85 (2%)
 Frame = +3

Query: 261 RALHANTIKLFVLDEADEMLSR-GFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           ++L+   IK F+LDE D+ML +   +  + ++F++   + QV++ SAT+  ++  V R F
Sbjct: 183 KSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSKEIRPVCRKF 242

Query: 438 MRDPVRILVQKE-ELTLEGIKQFYM 509
           M+DP+ I V  E +LTL G++Q+Y+
Sbjct: 243 MQDPMEIFVDDETKLTLHGLQQYYV 267



 Score = 58.0 bits (134), Expect = 3e-08
 Identities = 31/83 (37%), Positives = 47/83 (56%), Gaps = 2/83 (2%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTN 177
           GKTA F ++ LQQ++    +   L++  TRELA QI K       ++ N K     GG +
Sbjct: 94  GKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLS 153

Query: 178 VREDIRQLESGV-HVVVGTPGRV 243
           +++D   L+    H+VVGTPGR+
Sbjct: 154 IKKDEEVLKKNCPHIVVGTPGRI 176


>AL662801-3|CAI18280.1|  428|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 428

 Score = 64.9 bits (151), Expect = 3e-10
 Identities = 31/85 (36%), Positives = 56/85 (65%), Gaps = 2/85 (2%)
 Frame = +3

Query: 261 RALHANTIKLFVLDEADEMLSR-GFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           ++L+   IK F+LDE D+ML +   +  + ++F++   + QV++ SAT+  ++  V R F
Sbjct: 183 KSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSKEIRPVCRKF 242

Query: 438 MRDPVRILVQKE-ELTLEGIKQFYM 509
           M+DP+ I V  E +LTL G++Q+Y+
Sbjct: 243 MQDPMEIFVDDETKLTLHGLQQYYV 267



 Score = 58.0 bits (134), Expect = 3e-08
 Identities = 31/83 (37%), Positives = 47/83 (56%), Gaps = 2/83 (2%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTN 177
           GKTA F ++ LQQ++    +   L++  TRELA QI K       ++ N K     GG +
Sbjct: 94  GKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLS 153

Query: 178 VREDIRQLESGV-HVVVGTPGRV 243
           +++D   L+    H+VVGTPGR+
Sbjct: 154 IKKDEEVLKKNCPHIVVGTPGRI 176


>AK222912-1|BAD96632.1|  428|Homo sapiens HLA-B associated
           transcript 1 variant protein.
          Length = 428

 Score = 64.9 bits (151), Expect = 3e-10
 Identities = 31/85 (36%), Positives = 56/85 (65%), Gaps = 2/85 (2%)
 Frame = +3

Query: 261 RALHANTIKLFVLDEADEMLSR-GFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           ++L+   IK F+LDE D+ML +   +  + ++F++   + QV++ SAT+  ++  V R F
Sbjct: 183 KSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSKEIRPVCRKF 242

Query: 438 MRDPVRILVQKE-ELTLEGIKQFYM 509
           M+DP+ I V  E +LTL G++Q+Y+
Sbjct: 243 MQDPMEIFVDDETKLTLHGLQQYYV 267



 Score = 58.0 bits (134), Expect = 3e-08
 Identities = 31/83 (37%), Positives = 47/83 (56%), Gaps = 2/83 (2%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTN 177
           GKTA F ++ LQQ++    +   L++  TRELA QI K       ++ N K     GG +
Sbjct: 94  GKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLS 153

Query: 178 VREDIRQLESGV-HVVVGTPGRV 243
           +++D   L+    H+VVGTPGR+
Sbjct: 154 IKKDEEVLKKNCPHIVVGTPGRI 176


>AF029061-1|AAB94615.1|  284|Homo sapiens BAT1 protein.
          Length = 284

 Score = 64.9 bits (151), Expect = 3e-10
 Identities = 31/85 (36%), Positives = 56/85 (65%), Gaps = 2/85 (2%)
 Frame = +3

Query: 261 RALHANTIKLFVLDEADEMLSR-GFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           ++L+   IK F+LDE D+ML +   +  + ++F++   + QV++ SAT+  ++  V R F
Sbjct: 39  KSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSKEIRPVCRKF 98

Query: 438 MRDPVRILVQKE-ELTLEGIKQFYM 509
           M+DP+ I V  E +LTL G++Q+Y+
Sbjct: 99  MQDPMEIFVDDETKLTLHGLQQYYV 123


>AB202112-3|BAE78637.1|  428|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 428

 Score = 64.9 bits (151), Expect = 3e-10
 Identities = 31/85 (36%), Positives = 56/85 (65%), Gaps = 2/85 (2%)
 Frame = +3

Query: 261 RALHANTIKLFVLDEADEMLSR-GFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           ++L+   IK F+LDE D+ML +   +  + ++F++   + QV++ SAT+  ++  V R F
Sbjct: 183 KSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSKEIRPVCRKF 242

Query: 438 MRDPVRILVQKE-ELTLEGIKQFYM 509
           M+DP+ I V  E +LTL G++Q+Y+
Sbjct: 243 MQDPMEIFVDDETKLTLHGLQQYYV 267



 Score = 58.0 bits (134), Expect = 3e-08
 Identities = 31/83 (37%), Positives = 47/83 (56%), Gaps = 2/83 (2%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTN 177
           GKTA F ++ LQQ++    +   L++  TRELA QI K       ++ N K     GG +
Sbjct: 94  GKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLS 153

Query: 178 VREDIRQLESGV-HVVVGTPGRV 243
           +++D   L+    H+VVGTPGR+
Sbjct: 154 IKKDEEVLKKNCPHIVVGTPGRI 176


>AB103621-3|BAF31287.1|  443|Homo sapiens BAT1 protein protein.
          Length = 443

 Score = 64.9 bits (151), Expect = 3e-10
 Identities = 31/85 (36%), Positives = 56/85 (65%), Gaps = 2/85 (2%)
 Frame = +3

Query: 261 RALHANTIKLFVLDEADEMLSR-GFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           ++L+   IK F+LDE D+ML +   +  + ++F++   + QV++ SAT+  ++  V R F
Sbjct: 198 KSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSKEIRPVCRKF 257

Query: 438 MRDPVRILVQKE-ELTLEGIKQFYM 509
           M+DP+ I V  E +LTL G++Q+Y+
Sbjct: 258 MQDPMEIFVDDETKLTLHGLQQYYV 282



 Score = 42.3 bits (95), Expect = 0.002
 Identities = 31/98 (31%), Positives = 47/98 (47%), Gaps = 17/98 (17%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRE---------------CQALILAPTRELAQQIQKVVIALGD 135
           GKTA F ++ LQQ++    +                  L++  TRELA QI K       
Sbjct: 94  GKTAVFVLATLQQLEPVTGQVYLGRVLGRGFWLGLVSVLVMCHTRELAFQISKEYERFSK 153

Query: 136 HL-NAKCHACIGGTNVREDIRQLESGV-HVVVGTPGRV 243
           ++ N K     GG ++++D   L+    H+VVGTPGR+
Sbjct: 154 YMPNVKVAVFFGGLSIKKDEEVLKKNCPHIVVGTPGRI 191


>AB088115-3|BAC54953.1|  428|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 428

 Score = 64.9 bits (151), Expect = 3e-10
 Identities = 31/85 (36%), Positives = 56/85 (65%), Gaps = 2/85 (2%)
 Frame = +3

Query: 261 RALHANTIKLFVLDEADEMLSR-GFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           ++L+   IK F+LDE D+ML +   +  + ++F++   + QV++ SAT+  ++  V R F
Sbjct: 183 KSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSKEIRPVCRKF 242

Query: 438 MRDPVRILVQKE-ELTLEGIKQFYM 509
           M+DP+ I V  E +LTL G++Q+Y+
Sbjct: 243 MQDPMEIFVDDETKLTLHGLQQYYV 267



 Score = 58.0 bits (134), Expect = 3e-08
 Identities = 31/83 (37%), Positives = 47/83 (56%), Gaps = 2/83 (2%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTN 177
           GKTA F ++ LQQ++    +   L++  TRELA QI K       ++ N K     GG +
Sbjct: 94  GKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLS 153

Query: 178 VREDIRQLESGV-HVVVGTPGRV 243
           +++D   L+    H+VVGTPGR+
Sbjct: 154 IKKDEEVLKKNCPHIVVGTPGRI 176


>U90426-1|AAB50231.1|  427|Homo sapiens nuclear RNA helicase
           protein.
          Length = 427

 Score = 64.1 bits (149), Expect = 5e-10
 Identities = 30/85 (35%), Positives = 53/85 (62%), Gaps = 2/85 (2%)
 Frame = +3

Query: 261 RALHANTIKLFVLDEADEMLSR-GFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           R+     +K FVLDE D+ML +   +  + ++F++   + Q ++ SAT+  D+  V R F
Sbjct: 182 RSFSLKNVKHFVLDECDKMLEQLDMRRDVQEIFRLTPHEKQCMMFSATLSKDIRPVCRKF 241

Query: 438 MRDPVRILVQKE-ELTLEGIKQFYM 509
           M+DP+ + V  E +LTL G++Q+Y+
Sbjct: 242 MQDPMEVFVDDETKLTLHGLQQYYV 266



 Score = 56.4 bits (130), Expect = 1e-07
 Identities = 31/87 (35%), Positives = 49/87 (56%), Gaps = 2/87 (2%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTN 177
           GKTA F ++ LQQI+    +   L++  TRELA QI K       ++ + K     GG +
Sbjct: 93  GKTAVFVLATLQQIEPVNGQVTVLVMCHTRELAFQISKEYERFSKYMPSVKVSVFFGGLS 152

Query: 178 VREDIRQLESGV-HVVVGTPGRVYDMI 255
           +++D   ++    HVVVGTPGR+  ++
Sbjct: 153 IKKDEEVMKKNCPHVVVGTPGRILALV 179


>BC032128-1|AAH32128.1|  322|Homo sapiens DDX39 protein protein.
          Length = 322

 Score = 64.1 bits (149), Expect = 5e-10
 Identities = 30/85 (35%), Positives = 53/85 (62%), Gaps = 2/85 (2%)
 Frame = +3

Query: 261 RALHANTIKLFVLDEADEMLSR-GFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           R+     +K FVLDE D+ML +   +  + ++F++   + Q ++ SAT+  D+  V R F
Sbjct: 182 RSFSLKNVKHFVLDECDKMLEQLDMRRDVQEIFRLTPHEKQCMMFSATLSKDIRPVCRKF 241

Query: 438 MRDPVRILVQKE-ELTLEGIKQFYM 509
           M+DP+ + V  E +LTL G++Q+Y+
Sbjct: 242 MQDPMEVFVDDETKLTLHGLQQYYV 266



 Score = 57.2 bits (132), Expect = 6e-08
 Identities = 32/87 (36%), Positives = 49/87 (56%), Gaps = 2/87 (2%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTN 177
           GKTA F ++ LQQI+    +   L++  TRELA QI K       ++ + K     GG +
Sbjct: 93  GKTAVFVLATLQQIEPVNGQVTVLVMCHTRELAFQISKEYERFSKYMPSVKVSVFFGGLS 152

Query: 178 VREDIRQLESGV-HVVVGTPGRVYDMI 255
           +++D   L+    HVVVGTPGR+  ++
Sbjct: 153 IKKDEEVLKKNCPHVVVGTPGRILALV 179


>BC001009-1|AAH01009.1|  427|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 39 protein.
          Length = 427

 Score = 64.1 bits (149), Expect = 5e-10
 Identities = 30/85 (35%), Positives = 53/85 (62%), Gaps = 2/85 (2%)
 Frame = +3

Query: 261 RALHANTIKLFVLDEADEMLSR-GFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           R+     +K FVLDE D+ML +   +  + ++F++   + Q ++ SAT+  D+  V R F
Sbjct: 182 RSFSLKNVKHFVLDECDKMLEQLDMRRDVQEIFRLTPHEKQCMMFSATLSKDIRPVCRKF 241

Query: 438 MRDPVRILVQKE-ELTLEGIKQFYM 509
           M+DP+ + V  E +LTL G++Q+Y+
Sbjct: 242 MQDPMEVFVDDETKLTLHGLQQYYV 266



 Score = 57.2 bits (132), Expect = 6e-08
 Identities = 32/87 (36%), Positives = 49/87 (56%), Gaps = 2/87 (2%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTN 177
           GKTA F ++ LQQI+    +   L++  TRELA QI K       ++ + K     GG +
Sbjct: 93  GKTAVFVLATLQQIEPVNGQVTVLVMCHTRELAFQISKEYERFSKYMPSVKVSVFFGGLS 152

Query: 178 VREDIRQLESGV-HVVVGTPGRVYDMI 255
           +++D   L+    HVVVGTPGR+  ++
Sbjct: 153 IKKDEEVLKKNCPHVVVGTPGRILALV 179


>AK026614-1|BAB15509.1|  461|Homo sapiens protein ( Homo sapiens
           cDNA: FLJ22961 fis, clone KAT10214. ).
          Length = 461

 Score = 64.1 bits (149), Expect = 5e-10
 Identities = 30/85 (35%), Positives = 53/85 (62%), Gaps = 2/85 (2%)
 Frame = +3

Query: 261 RALHANTIKLFVLDEADEMLSR-GFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           R+     +K FVLDE D+ML +   +  + ++F++   + Q ++ SAT+  D+  V R F
Sbjct: 216 RSFSLKNVKHFVLDECDKMLEQLDMRRDVQEIFRLTPHEKQCMMFSATLSKDIRPVCRKF 275

Query: 438 MRDPVRILVQKE-ELTLEGIKQFYM 509
           M+DP+ + V  E +LTL G++Q+Y+
Sbjct: 276 MQDPMEVFVDDETKLTLHGLQQYYV 300



 Score = 57.2 bits (132), Expect = 6e-08
 Identities = 32/87 (36%), Positives = 49/87 (56%), Gaps = 2/87 (2%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTN 177
           GKTA F ++ LQQI+    +   L++  TRELA QI K       ++ + K     GG +
Sbjct: 127 GKTAVFVLATLQQIEPVNGQVTVLVMCHTRELAFQISKEYERFSKYMPSVKVSVFFGGLS 186

Query: 178 VREDIRQLESGV-HVVVGTPGRVYDMI 255
           +++D   L+    HVVVGTPGR+  ++
Sbjct: 187 IKKDEEVLKKNCPHVVVGTPGRILALV 213


>D26528-1|BAA05534.1|  439|Homo sapiens RNA helicase protein.
          Length = 439

 Score = 63.3 bits (147), Expect = 9e-10
 Identities = 35/86 (40%), Positives = 49/86 (56%), Gaps = 1/86 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKT  F + IL +ID  +++ Q LILAP++ELA Q   V    G  ++    + IGG N 
Sbjct: 44  GKTLAFLLPILSRIDPKVKQTQVLILAPSQELAMQTTAVAREWGALVDVSVTSLIGGANG 103

Query: 181 REDIRQLESG-VHVVVGTPGRVYDMI 255
           R    +L+    H+VVGT GRV  M+
Sbjct: 104 RRQADKLKKDKPHIVVGTLGRVLTML 129



 Score = 36.3 bits (80), Expect = 0.12
 Identities = 22/58 (37%), Positives = 31/58 (53%)
 Frame = +3

Query: 264 ALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           AL  N ++  + DEAD MLS   +D +  +   L  DVQ+ L SAT   D+  V+  F
Sbjct: 133 ALKLNGLQTVIFDEADAMLSDERRDSLQALAAQLPTDVQLGLFSATSGVDLKYVADTF 190


>AF136175-1|AAP97265.1|  479|Homo sapiens RNA helicase protein.
          Length = 479

 Score = 62.5 bits (145), Expect = 2e-09
 Identities = 56/211 (26%), Positives = 98/211 (46%), Gaps = 10/211 (4%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGD-HLNAKCHACIGGTN 177
           GKTA F +++L +++ S R  Q L L PT EL  Q  KV+  +G  +   K    + G  
Sbjct: 143 GKTAAFVLAMLSRVEPSDRYPQCLCLFPTYELGLQTGKVIEQMGKFYPELKLAYAVRGNK 202

Query: 178 VREDIRQLESGVHVVVGTPGRVYDMILVVRFMPTPSNFLFLMKL--MKCCPEVSRTRSM- 348
           +    R  +    +V+G PG V D    ++F+      +F++    +    +  + +S+ 
Sbjct: 203 LE---RGQKISEQIVIGNPGTVLDWCSKLKFIDPKKIKVFVLDEADVMIATQGHQDQSIR 259

Query: 349 ---MSSRFCQ-LMFKSYYSLLPCLMMYWKYLDAL*EILYAYLYRRKSLPWKVLNNF--TC 510
              M  R CQ L+F + +         WK+   +         +R+      +  +   C
Sbjct: 260 IQRMLPRNCQMLLFSATFE-----DSVWKFAQKVVPDPNVIKLKREEETLDTIKQYYVLC 314

Query: 511 IELEEWKLETLCDLYDTLSIAQAVIFCNTRR 603
              +E K + LC+LY  ++IAQA+IFC+TR+
Sbjct: 315 SSRDE-KFQALCNLYGAITIAQAMIFCHTRK 344



 Score = 60.1 bits (139), Expect = 9e-09
 Identities = 32/77 (41%), Positives = 53/77 (68%), Gaps = 1/77 (1%)
 Frame = +3

Query: 282 IKLFVLDEADEMLS-RGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRI 458
           IK+FVLDEAD M++ +G +DQ   + ++L  + Q++L SAT  D V + ++  + DP  I
Sbjct: 236 IKVFVLDEADVMIATQGHQDQSIRIQRMLPRNCQMLLFSATFEDSVWKFAQKVVPDPNVI 295

Query: 459 LVQKEELTLEGIKQFYM 509
            +++EE TL+ IKQ+Y+
Sbjct: 296 KLKREEETLDTIKQYYV 312


>BC050360-1|AAH50360.2|  369|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 25 protein.
          Length = 369

 Score = 62.1 bits (144), Expect = 2e-09
 Identities = 32/77 (41%), Positives = 50/77 (64%), Gaps = 1/77 (1%)
 Frame = +3

Query: 282 IKLFVLDEADEML-SRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRI 458
           I++FVLDEAD M+ ++GF D    + + L ++ Q++L SAT  D V   +   + DP  I
Sbjct: 127 IRVFVLDEADVMIDTQGFSDHSIRIQRALPSECQMLLFSATFEDSVWHFAERIIPDPNVI 186

Query: 459 LVQKEELTLEGIKQFYM 509
            ++KEELTL  I+Q+Y+
Sbjct: 187 KLRKEELTLNNIRQYYV 203



 Score = 58.4 bits (135), Expect = 3e-08
 Identities = 50/210 (23%), Positives = 94/210 (44%), Gaps = 9/210 (4%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDH-LNAKCHACIGGTN 177
           GKTA F +++L +++      Q L LAPT ELA Q  +VV  +G   ++ +    I G  
Sbjct: 34  GKTAAFVLAMLSRVNALELFPQCLCLAPTYELALQTGRVVEQMGKFCVDVQVMYAIRGNR 93

Query: 178 VREDIRQLESGVHVVVGTPGRVYDMILVVRFMPTPSNFLFLMKLMKCCPEVS-------R 336
           +    R  +    +++GTPG V D    ++ +      +F++       +         R
Sbjct: 94  IP---RGTDITKQIIIGTPGTVLDWCFKLKLIDLTKIRVFVLDEADVMIDTQGFSDHSIR 150

Query: 337 TRSMMSSRFCQLMFKSYYSLLPCLMMYWKYLDAL*EILYAYLYRRKSLPWKVLNNFTCI- 513
            +  + S    L+F + +         W + + +         R++ L    +  +  + 
Sbjct: 151 IQRALPSECQMLLFSATFE-----DSVWHFAERIIPDPNVIKLRKEELTLNNIRQYYVLC 205

Query: 514 ELEEWKLETLCDLYDTLSIAQAVIFCNTRR 603
           E  + K + LC++Y +++I QA+IFC TRR
Sbjct: 206 EHRKDKYQALCNIYGSITIGQAIIFCQTRR 235


>BC035388-1|AAH35388.2|  369|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 25 protein.
          Length = 369

 Score = 62.1 bits (144), Expect = 2e-09
 Identities = 32/77 (41%), Positives = 50/77 (64%), Gaps = 1/77 (1%)
 Frame = +3

Query: 282 IKLFVLDEADEML-SRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRI 458
           I++FVLDEAD M+ ++GF D    + + L ++ Q++L SAT  D V   +   + DP  I
Sbjct: 127 IRVFVLDEADVMIDTQGFSDHSIRIQRALPSECQMLLFSATFEDSVWHFAERIIPDPNVI 186

Query: 459 LVQKEELTLEGIKQFYM 509
            ++KEELTL  I+Q+Y+
Sbjct: 187 KLRKEELTLNNIRQYYV 203



 Score = 58.4 bits (135), Expect = 3e-08
 Identities = 50/210 (23%), Positives = 94/210 (44%), Gaps = 9/210 (4%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDH-LNAKCHACIGGTN 177
           GKTA F +++L +++      Q L LAPT ELA Q  +VV  +G   ++ +    I G  
Sbjct: 34  GKTAAFVLAMLSRVNALELFPQCLCLAPTYELALQTGRVVEQMGKFCVDVQVMYAIRGNR 93

Query: 178 VREDIRQLESGVHVVVGTPGRVYDMILVVRFMPTPSNFLFLMKLMKCCPEVS-------R 336
           +    R  +    +++GTPG V D    ++ +      +F++       +         R
Sbjct: 94  IP---RGTDITKQIIIGTPGTVLDWCFKLKLIDLTKIRVFVLDEADVMIDTQGFSDHSIR 150

Query: 337 TRSMMSSRFCQLMFKSYYSLLPCLMMYWKYLDAL*EILYAYLYRRKSLPWKVLNNFTCI- 513
            +  + S    L+F + +         W + + +         R++ L    +  +  + 
Sbjct: 151 IQRALPSECQMLLFSATFE-----DSVWHFAERIIPDPNVIKLRKEELTLNNIRQYYVLC 205

Query: 514 ELEEWKLETLCDLYDTLSIAQAVIFCNTRR 603
           E  + K + LC++Y +++I QA+IFC TRR
Sbjct: 206 EHRKDKYQALCNIYGSITIGQAIIFCQTRR 235


>AY735312-1|AAU84667.1|  483|Homo sapiens gonadotropin-regulated
           testicular RNA helicase-GRTH/DDX25 protein.
          Length = 483

 Score = 62.1 bits (144), Expect = 2e-09
 Identities = 32/77 (41%), Positives = 50/77 (64%), Gaps = 1/77 (1%)
 Frame = +3

Query: 282 IKLFVLDEADEML-SRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRI 458
           I++FVLDEAD M+ ++GF D    + + L ++ Q++L SAT  D V   +   + DP  I
Sbjct: 241 IRVFVLDEADVMIDTQGFSDHSIRIQRALPSECQMLLFSATFEDSVWHFAERIIPDPNVI 300

Query: 459 LVQKEELTLEGIKQFYM 509
            ++KEELTL  I+Q+Y+
Sbjct: 301 KLRKEELTLNNIRQYYV 317



 Score = 58.4 bits (135), Expect = 3e-08
 Identities = 50/210 (23%), Positives = 94/210 (44%), Gaps = 9/210 (4%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDH-LNAKCHACIGGTN 177
           GKTA F +++L +++      Q L LAPT ELA Q  +VV  +G   ++ +    I G  
Sbjct: 148 GKTAAFVLAMLSRVNALELFPQCLCLAPTYELALQTGRVVEQMGKFCVDVQVMYAIRGNR 207

Query: 178 VREDIRQLESGVHVVVGTPGRVYDMILVVRFMPTPSNFLFLMKLMKCCPEVS-------R 336
           +    R  +    +++GTPG V D    ++ +      +F++       +         R
Sbjct: 208 IP---RGTDITKQIIIGTPGTVLDWCFKLKLIDLTKIRVFVLDEADVMIDTQGFSDHSIR 264

Query: 337 TRSMMSSRFCQLMFKSYYSLLPCLMMYWKYLDAL*EILYAYLYRRKSLPWKVLNNFTCI- 513
            +  + S    L+F + +         W + + +         R++ L    +  +  + 
Sbjct: 265 IQRALPSECQMLLFSATFE-----DSVWHFAERIIPDPNVIKLRKEELTLNNIRQYYVLC 319

Query: 514 ELEEWKLETLCDLYDTLSIAQAVIFCNTRR 603
           E  + K + LC++Y +++I QA+IFC TRR
Sbjct: 320 EHRKDKYQALCNIYGSITIGQAIIFCQTRR 349


>AF155140-1|AAF21371.2|  483|Homo sapiens gonadotropin-regulated
           testicular RNA helicase protein.
          Length = 483

 Score = 62.1 bits (144), Expect = 2e-09
 Identities = 32/77 (41%), Positives = 50/77 (64%), Gaps = 1/77 (1%)
 Frame = +3

Query: 282 IKLFVLDEADEML-SRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRI 458
           I++FVLDEAD M+ ++GF D    + + L ++ Q++L SAT  D V   +   + DP  I
Sbjct: 241 IRVFVLDEADVMIDTQGFSDHSIRIQRALPSECQMLLFSATFEDSVWHFAERIIPDPNVI 300

Query: 459 LVQKEELTLEGIKQFYM 509
            ++KEELTL  I+Q+Y+
Sbjct: 301 KLRKEELTLNNIRQYYV 317



 Score = 58.4 bits (135), Expect = 3e-08
 Identities = 50/210 (23%), Positives = 94/210 (44%), Gaps = 9/210 (4%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDH-LNAKCHACIGGTN 177
           GKTA F +++L +++      Q L LAPT ELA Q  +VV  +G   ++ +    I G  
Sbjct: 148 GKTAAFVLAMLSRVNALELFPQCLCLAPTYELALQTGRVVEQMGKFCVDVQVMYAIRGNR 207

Query: 178 VREDIRQLESGVHVVVGTPGRVYDMILVVRFMPTPSNFLFLMKLMKCCPEVS-------R 336
           +    R  +    +++GTPG V D    ++ +      +F++       +         R
Sbjct: 208 IP---RGTDITKQIIIGTPGTVLDWCFKLKLIDLTKIRVFVLDEADVMIDTQGFSDHSIR 264

Query: 337 TRSMMSSRFCQLMFKSYYSLLPCLMMYWKYLDAL*EILYAYLYRRKSLPWKVLNNFTCI- 513
            +  + S    L+F + +         W + + +         R++ L    +  +  + 
Sbjct: 265 IQRALPSECQMLLFSATFE-----DSVWHFAERIIPDPNVIKLRKEELTLNNIRQYYVLC 319

Query: 514 ELEEWKLETLCDLYDTLSIAQAVIFCNTRR 603
           E  + K + LC++Y +++I QA+IFC TRR
Sbjct: 320 EHRKDKYQALCNIYGSITIGQAIIFCQTRR 349


>BC041801-1|AAH41801.1|  619|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 59 protein.
          Length = 619

 Score = 61.3 bits (142), Expect = 4e-09
 Identities = 26/76 (34%), Positives = 48/76 (63%)
 Frame = +3

Query: 282 IKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRIL 461
           +K+ V+DEAD ML  GF+ Q+ D+ + +  D Q IL+SAT+P  + +++   + +PVRI+
Sbjct: 347 VKIVVVDEADTMLKMGFQQQVLDILENIPNDCQTILVSATIPTSIEQLASQLLHNPVRII 406

Query: 462 VQKEELTLEGIKQFYM 509
             ++ L    ++Q  +
Sbjct: 407 TGEKNLPCANVRQIIL 422



 Score = 53.2 bits (122), Expect = 1e-06
 Identities = 31/86 (36%), Positives = 47/86 (54%), Gaps = 1/86 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTN 177
           GKTA F + ++ +     +   ALIL PTRELA QI++    L   L   K    +GG  
Sbjct: 252 GKTAAFLLPVIMRALFESKTPSALILTPTRELAIQIERQAKELMSGLPRMKTVLLVGGLP 311

Query: 178 VREDIRQLESGVHVVVGTPGRVYDMI 255
           +   + +L+  V V++ TPGR+ D+I
Sbjct: 312 LPPQLYRLQQHVKVIIATPGRLLDII 337


>BC016295-1|AAH16295.1|  179|Homo sapiens EIF4A2 protein protein.
          Length = 179

 Score = 61.3 bits (142), Expect = 4e-09
 Identities = 29/51 (56%), Positives = 38/51 (74%), Gaps = 1/51 (1%)
 Frame = +1

Query: 460 LYRRKSLPWKVLNNFTC-IELEEWKLETLCDLYDTLSIAQAVIFCNTRRKV 609
           L +++ L  + +  F   +E EEWKL+TLCDLY+TL+I QAVIF NTRRKV
Sbjct: 8   LVKKEELTLEGIKQFYINVEREEWKLDTLCDLYETLTITQAVIFLNTRRKV 58



 Score = 54.8 bits (126), Expect = 3e-07
 Identities = 41/109 (37%), Positives = 55/109 (50%)
 Frame = +3

Query: 438 MRDPVRILVQKEELTLEGIKQFYMH*IRRMEAGNSV*PV*YTVYCTSCNFLQHPSQGGIG 617
           MRDP+RILV+KEELTLEGIKQFY++  R     +++  +  T+  T      +  +    
Sbjct: 1   MRDPIRILVKKEELTLEGIKQFYINVEREEWKLDTLCDLYETLTITQAVIFLNTRRKVDW 60

Query: 618 SLNLCICVTLLYLLCMGDMDQREPEVIMKAVSYWLLLVS*FTTDLWARG 764
                           GDMDQ+E +VIM+        V   TTDL ARG
Sbjct: 61  LTEKMHARDFTVSALHGDMDQKERDVIMREFRSGSSRVL-ITTDLLARG 108



 Score = 42.3 bits (95), Expect = 0.002
 Identities = 23/55 (41%), Positives = 31/55 (56%), Gaps = 3/55 (5%)
 Frame = +2

Query: 512 LN*KNGSWKLCVTCMIH---CLLHKL*FSATPVARWDWLTESMHLRDFTVSAMHG 667
           +N +   WKL   C ++    +   + F  T   + DWLTE MH RDFTVSA+HG
Sbjct: 24  INVEREEWKLDTLCDLYETLTITQAVIFLNTR-RKVDWLTEKMHARDFTVSALHG 77


>BC014183-1|AAH14183.1|  434|Homo sapiens DDX59 protein protein.
          Length = 434

 Score = 61.3 bits (142), Expect = 4e-09
 Identities = 26/76 (34%), Positives = 48/76 (63%)
 Frame = +3

Query: 282 IKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRIL 461
           +K+ V+DEAD ML  GF+ Q+ D+ + +  D Q IL+SAT+P  + +++   + +PVRI+
Sbjct: 347 VKIVVVDEADTMLKMGFQQQVLDILENIPNDCQTILVSATIPTSIEQLASQLLHNPVRII 406

Query: 462 VQKEELTLEGIKQFYM 509
             ++ L    ++Q  +
Sbjct: 407 TGEKNLPCANVRQIIL 422



 Score = 53.2 bits (122), Expect = 1e-06
 Identities = 31/86 (36%), Positives = 47/86 (54%), Gaps = 1/86 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTN 177
           GKTA F + ++ +     +   ALIL PTRELA QI++    L   L   K    +GG  
Sbjct: 252 GKTAAFLLPVIMRALFESKTPSALILTPTRELAIQIERQAKELMSGLPRMKTVLLVGGLP 311

Query: 178 VREDIRQLESGVHVVVGTPGRVYDMI 255
           +   + +L+  V V++ TPGR+ D+I
Sbjct: 312 LPPQLYRLQQHVKVIIATPGRLLDII 337


>AL445483-6|CAI17056.1|  619|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 59 protein.
          Length = 619

 Score = 61.3 bits (142), Expect = 4e-09
 Identities = 26/76 (34%), Positives = 48/76 (63%)
 Frame = +3

Query: 282 IKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRIL 461
           +K+ V+DEAD ML  GF+ Q+ D+ + +  D Q IL+SAT+P  + +++   + +PVRI+
Sbjct: 347 VKIVVVDEADTMLKMGFQQQVLDILENIPNDCQTILVSATIPTSIEQLASQLLHNPVRII 406

Query: 462 VQKEELTLEGIKQFYM 509
             ++ L    ++Q  +
Sbjct: 407 TGEKNLPCANVRQIIL 422



 Score = 53.2 bits (122), Expect = 1e-06
 Identities = 31/86 (36%), Positives = 47/86 (54%), Gaps = 1/86 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTN 177
           GKTA F + ++ +     +   ALIL PTRELA QI++    L   L   K    +GG  
Sbjct: 252 GKTAAFLLPVIMRALFESKTPSALILTPTRELAIQIERQAKELMSGLPRMKTVLLVGGLP 311

Query: 178 VREDIRQLESGVHVVVGTPGRVYDMI 255
           +   + +L+  V V++ TPGR+ D+I
Sbjct: 312 LPPQLYRLQQHVKVIIATPGRLLDII 337


>AL445483-5|CAI17055.1|  580|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 59 protein.
          Length = 580

 Score = 61.3 bits (142), Expect = 4e-09
 Identities = 26/76 (34%), Positives = 48/76 (63%)
 Frame = +3

Query: 282 IKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRIL 461
           +K+ V+DEAD ML  GF+ Q+ D+ + +  D Q IL+SAT+P  + +++   + +PVRI+
Sbjct: 347 VKIVVVDEADTMLKMGFQQQVLDILENIPNDCQTILVSATIPTSIEQLASQLLHNPVRII 406

Query: 462 VQKEELTLEGIKQFYM 509
             ++ L    ++Q  +
Sbjct: 407 TGEKNLPCANVRQIIL 422



 Score = 53.2 bits (122), Expect = 1e-06
 Identities = 31/86 (36%), Positives = 47/86 (54%), Gaps = 1/86 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTN 177
           GKTA F + ++ +     +   ALIL PTRELA QI++    L   L   K    +GG  
Sbjct: 252 GKTAAFLLPVIMRALFESKTPSALILTPTRELAIQIERQAKELMSGLPRMKTVLLVGGLP 311

Query: 178 VREDIRQLESGVHVVVGTPGRVYDMI 255
           +   + +L+  V V++ TPGR+ D+I
Sbjct: 312 LPPQLYRLQQHVKVIIATPGRLLDII 337


>AF193054-1|AAG22482.1|  312|Homo sapiens unknown protein.
          Length = 312

 Score = 61.3 bits (142), Expect = 4e-09
 Identities = 26/70 (37%), Positives = 48/70 (68%)
 Frame = +3

Query: 264 ALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMR 443
           + H ++I++ +LDEAD ML   F++Q+ ++ ++ S   Q +L SATM D+V +++   ++
Sbjct: 137 SFHLSSIEVLILDEADRMLDEYFEEQMKEIIRMCSHHRQTMLFSATMTDEVKDLASVSLK 196

Query: 444 DPVRILVQKE 473
           +PVRI V K+
Sbjct: 197 NPVRIFVNKQ 206



 Score = 53.2 bits (122), Expect = 1e-06
 Identities = 27/86 (31%), Positives = 45/86 (52%), Gaps = 3/86 (3%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIREC---QALILAPTRELAQQIQKVVIALGDHLNAKCHACIGG 171
           GKTA F++ +L+++    R+    + L+L PTREL  Q+  V   L    N      +GG
Sbjct: 45  GKTAAFALPVLERLIYKPRQAPVTRVLVLVPTRELGIQVHSVTRQLAQFCNITTCLAVGG 104

Query: 172 TNVREDIRQLESGVHVVVGTPGRVYD 249
            +V+     L +   +++ TPGR+ D
Sbjct: 105 LDVKSQEAALRAAPDILIATPGRLID 130


>BC002366-1|AAH02366.1|  820|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 23 protein.
          Length = 820

 Score = 60.5 bits (140), Expect = 6e-09
 Identities = 39/94 (41%), Positives = 52/94 (55%), Gaps = 9/94 (9%)
 Frame = +1

Query: 1   GKTATFSISILQQIDT-----SIRECQ----ALILAPTRELAQQIQKVVIALGDHLNAKC 153
           GKTA F I +L  I T      I E      A+ILAPTRELAQQI++  I  G  L  + 
Sbjct: 440 GKTAAFLIPLLVWITTLPKIDRIEESDQGPYAIILAPTRELAQQIEEETIKFGKPLGIRT 499

Query: 154 HACIGGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
            A IGG +  +   +L  G  +V+ TPGR+ D++
Sbjct: 500 VAVIGGISREDQGFRLRMGCEIVIATPGRLIDVL 533


>AF026402-1|AAB87902.1|  820|Homo sapiens U5 snRNP 100 kD protein
           protein.
          Length = 820

 Score = 60.5 bits (140), Expect = 6e-09
 Identities = 39/94 (41%), Positives = 52/94 (55%), Gaps = 9/94 (9%)
 Frame = +1

Query: 1   GKTATFSISILQQIDT-----SIRECQ----ALILAPTRELAQQIQKVVIALGDHLNAKC 153
           GKTA F I +L  I T      I E      A+ILAPTRELAQQI++  I  G  L  + 
Sbjct: 440 GKTAAFLIPLLVWITTLPKIDRIEESDQGPYAIILAPTRELAQQIEEETIKFGKPLGIRT 499

Query: 154 HACIGGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
            A IGG +  +   +L  G  +V+ TPGR+ D++
Sbjct: 500 VAVIGGISREDQGFRLRMGCEIVIATPGRLIDVL 533


>AB209401-1|BAD92638.1|  313|Homo sapiens DDX19-like protein variant
           protein.
          Length = 313

 Score = 60.1 bits (139), Expect = 9e-09
 Identities = 32/77 (41%), Positives = 53/77 (68%), Gaps = 1/77 (1%)
 Frame = +3

Query: 282 IKLFVLDEADEMLS-RGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRI 458
           IK+FVLDEAD M++ +G +DQ   + ++L  + Q++L SAT  D V + ++  + DP  I
Sbjct: 70  IKVFVLDEADVMIATQGHQDQSIRIQRMLPRNCQMLLFSATFEDSVWKFAQKVVPDPNVI 129

Query: 459 LVQKEELTLEGIKQFYM 509
            +++EE TL+ IKQ+Y+
Sbjct: 130 KLKREEETLDTIKQYYV 146



 Score = 40.3 bits (90), Expect = 0.007
 Identities = 35/138 (25%), Positives = 65/138 (47%), Gaps = 9/138 (6%)
 Frame = +1

Query: 217 VVVGTPGRVYDMILVVRFMPTPSNFLFLMKL--MKCCPEVSRTRSM----MSSRFCQ-LM 375
           +V+GTPG V D    ++F+      +F++    +    +  + +S+    M  R CQ L+
Sbjct: 47  IVIGTPGTVLDWCSKLKFIDPKKIKVFVLDEADVMIATQGHQDQSIRIQRMLPRNCQMLL 106

Query: 376 FKSYYSLLPCLMMYWKYLDAL*EILYAYLYRRKSLPWKVLNNF--TCIELEEWKLETLCD 549
           F + +         WK+   +         +R+      +  +   C   +E K + LC+
Sbjct: 107 FSATFE-----DSVWKFAQKVVPDPNVIKLKREEETLDTIKQYYVLCSSRDE-KFQALCN 160

Query: 550 LYDTLSIAQAVIFCNTRR 603
           LY  ++IAQA+IFC+TR+
Sbjct: 161 LYGAITIAQAMIFCHTRK 178


>BC002674-1|AAH02674.1|  483|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 49 protein.
          Length = 483

 Score = 58.8 bits (136), Expect = 2e-08
 Identities = 33/83 (39%), Positives = 44/83 (53%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTA F + ILQ++         L+L PTRELA QI +    LG  L  K    +GG ++
Sbjct: 51  GKTAAFVLPILQKLSEDPYGIFCLVLTPTRELAYQIAEQFRVLGKPLGLKDCIIVGGMDM 110

Query: 181 REDIRQLESGVHVVVGTPGRVYD 249
                +L    HVV+ TPGR+ D
Sbjct: 111 VAQALELSRKPHVVIATPGRLAD 133



 Score = 37.9 bits (84), Expect = 0.039
 Identities = 26/79 (32%), Positives = 39/79 (49%), Gaps = 3/79 (3%)
 Frame = +3

Query: 282 IKLFVLDEADEMLSRGFKDQIHDVFKILS---ADVQVILLSATMPDDVLEVSRCFMRDPV 452
           I+  V+DEAD +L +G  D   D+  IL+   A  Q +L SAT+ D + E+       P 
Sbjct: 146 IRFLVMDEADRLLEQGCTDFTVDLEAILAAVPARRQTLLFSATLTDTLRELQGLATNQPF 205

Query: 453 RILVQKEELTLEGIKQFYM 509
               Q    T+E + Q Y+
Sbjct: 206 FWEAQAPVSTVEQLDQRYL 224


>AK223294-1|BAD97014.1|  483|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 49 variant protein.
          Length = 483

 Score = 58.8 bits (136), Expect = 2e-08
 Identities = 33/83 (39%), Positives = 44/83 (53%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTA F + ILQ++         L+L PTRELA QI +    LG  L  K    +GG ++
Sbjct: 51  GKTAAFVLPILQKLSEDPYGIFCLVLTPTRELAYQIAEQFRVLGKPLGLKDCIIVGGMDM 110

Query: 181 REDIRQLESGVHVVVGTPGRVYD 249
                +L    HVV+ TPGR+ D
Sbjct: 111 VAQALELSRKPHVVIATPGRLAD 133



 Score = 37.9 bits (84), Expect = 0.039
 Identities = 26/79 (32%), Positives = 39/79 (49%), Gaps = 3/79 (3%)
 Frame = +3

Query: 282 IKLFVLDEADEMLSRGFKDQIHDVFKILS---ADVQVILLSATMPDDVLEVSRCFMRDPV 452
           I+  V+DEAD +L +G  D   D+  IL+   A  Q +L SAT+ D + E+       P 
Sbjct: 146 IRFLVMDEADRLLEQGCTDFTVDLEAILAAVPARRQTLLFSATLTDTLRELQGLATNQPF 205

Query: 453 RILVQKEELTLEGIKQFYM 509
               Q    T+E + Q Y+
Sbjct: 206 FWEAQAPVSTVEQLDQRYL 224


>AC002985-2|AAB81544.1|  483|Homo sapiens R27090_2 protein.
          Length = 483

 Score = 58.8 bits (136), Expect = 2e-08
 Identities = 33/83 (39%), Positives = 44/83 (53%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTA F + ILQ++         L+L PTRELA QI +    LG  L  K    +GG ++
Sbjct: 51  GKTAAFVLPILQKLSEDPYGIFCLVLTPTRELAYQIAEQFRVLGKPLGLKDCIIVGGMDM 110

Query: 181 REDIRQLESGVHVVVGTPGRVYD 249
                +L    HVV+ TPGR+ D
Sbjct: 111 VAQALELSRKPHVVIATPGRLAD 133



 Score = 37.9 bits (84), Expect = 0.039
 Identities = 26/79 (32%), Positives = 39/79 (49%), Gaps = 3/79 (3%)
 Frame = +3

Query: 282 IKLFVLDEADEMLSRGFKDQIHDVFKILS---ADVQVILLSATMPDDVLEVSRCFMRDPV 452
           I+  V+DEAD +L +G  D   D+  IL+   A  Q +L SAT+ D + E+       P 
Sbjct: 146 IRFLVMDEADRLLEQGCTDFTVDLEAILAAVPARRQTLLFSATLTDTLRELQGLATNQPF 205

Query: 453 RILVQKEELTLEGIKQFYM 509
               Q    T+E + Q Y+
Sbjct: 206 FWEAQAPVSTVEQLDQRYL 224


>BC130275-1|AAI30276.1|  796|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 27 protein.
          Length = 796

 Score = 58.4 bits (135), Expect = 3e-08
 Identities = 25/67 (37%), Positives = 46/67 (68%)
 Frame = +3

Query: 264 ALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMR 443
           + H ++I++ +LDEAD ML   F++Q+ ++ ++ S   Q +L SATM D+V +++   ++
Sbjct: 359 SFHLSSIEVLILDEADRMLDEYFEEQMKEIIRMCSHHRQTMLFSATMTDEVKDLASVSLK 418

Query: 444 DPVRILV 464
           +PVRI V
Sbjct: 419 NPVRIFV 425



 Score = 53.2 bits (122), Expect = 1e-06
 Identities = 27/86 (31%), Positives = 45/86 (52%), Gaps = 3/86 (3%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIREC---QALILAPTRELAQQIQKVVIALGDHLNAKCHACIGG 171
           GKTA F++ +L+++    R+    + L+L PTREL  Q+  V   L    N      +GG
Sbjct: 267 GKTAAFALPVLERLIYKPRQAPVTRVLVLVPTRELGIQVHSVTRQLAQFCNITTCLAVGG 326

Query: 172 TNVREDIRQLESGVHVVVGTPGRVYD 249
            +V+     L +   +++ TPGR+ D
Sbjct: 327 LDVKSQEAALRAAPDILIATPGRLID 352


>BC126287-1|AAI26288.1|  796|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 27 protein.
          Length = 796

 Score = 58.4 bits (135), Expect = 3e-08
 Identities = 25/67 (37%), Positives = 46/67 (68%)
 Frame = +3

Query: 264 ALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMR 443
           + H ++I++ +LDEAD ML   F++Q+ ++ ++ S   Q +L SATM D+V +++   ++
Sbjct: 359 SFHLSSIEVLILDEADRMLDEYFEEQMKEIIRMCSHHRQTMLFSATMTDEVKDLASVSLK 418

Query: 444 DPVRILV 464
           +PVRI V
Sbjct: 419 NPVRIFV 425



 Score = 53.2 bits (122), Expect = 1e-06
 Identities = 27/86 (31%), Positives = 45/86 (52%), Gaps = 3/86 (3%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIREC---QALILAPTRELAQQIQKVVIALGDHLNAKCHACIGG 171
           GKTA F++ +L+++    R+    + L+L PTREL  Q+  V   L    N      +GG
Sbjct: 267 GKTAAFALPVLERLIYKPRQAPVTRVLVLVPTRELGIQVHSVTRQLAQFCNITTCLAVGG 326

Query: 172 TNVREDIRQLESGVHVVVGTPGRVYD 249
            +V+     L +   +++ TPGR+ D
Sbjct: 327 LDVKSQEAALRAAPDILIATPGRLID 352


>BC068009-1|AAH68009.1|  455|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 47 protein.
          Length = 455

 Score = 58.4 bits (135), Expect = 3e-08
 Identities = 24/86 (27%), Positives = 50/86 (58%)
 Frame = +3

Query: 252 DTRRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSR 431
           +  +  +   +K  V+DEAD +L+  F+ ++  + K++  D +  L SATM   V ++ R
Sbjct: 158 ENTKGFNLRALKYLVMDEADRILNMDFETEVDKILKVIPRDRKTFLFSATMTKKVQKLQR 217

Query: 432 CFMRDPVRILVQKEELTLEGIKQFYM 509
             +++PV+  V  +  T+E ++Q+Y+
Sbjct: 218 AALKNPVKCAVSSKYQTVEKLQQYYI 243



 Score = 57.6 bits (133), Expect = 5e-08
 Identities = 29/83 (34%), Positives = 44/83 (53%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKT  F++ IL  +  + +   AL+L PTRELA QI +   ALG  +  +    +GG + 
Sbjct: 73  GKTGAFALPILNALLETPQRLFALVLTPTRELAFQISEQFEALGSSIGVQSAVIVGGIDS 132

Query: 181 REDIRQLESGVHVVVGTPGRVYD 249
                 L    H+++ TPGR+ D
Sbjct: 133 MSQSLALAKKPHIIIATPGRLID 155


>BC016060-1|AAH16060.2|  767|Homo sapiens DDX27 protein protein.
          Length = 767

 Score = 58.4 bits (135), Expect = 3e-08
 Identities = 25/67 (37%), Positives = 46/67 (68%)
 Frame = +3

Query: 264 ALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMR 443
           + H ++I++ +LDEAD ML   F++Q+ ++ ++ S   Q +L SATM D+V +++   ++
Sbjct: 330 SFHLSSIEVLILDEADRMLDEYFEEQMKEIIRMCSHHRQTMLFSATMTDEVKDLASVSLK 389

Query: 444 DPVRILV 464
           +PVRI V
Sbjct: 390 NPVRIFV 396



 Score = 53.2 bits (122), Expect = 1e-06
 Identities = 27/86 (31%), Positives = 45/86 (52%), Gaps = 3/86 (3%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIREC---QALILAPTRELAQQIQKVVIALGDHLNAKCHACIGG 171
           GKTA F++ +L+++    R+    + L+L PTREL  Q+  V   L    N      +GG
Sbjct: 238 GKTAAFALPVLERLIYKPRQAPVTRVLVLVPTRELGIQVHSVTRQLAQFCNITTCLAVGG 297

Query: 172 TNVREDIRQLESGVHVVVGTPGRVYD 249
            +V+     L +   +++ TPGR+ D
Sbjct: 298 LDVKSQEAALRAAPDILIATPGRLID 323


>BC011927-1|AAH11927.2|  767|Homo sapiens DDX27 protein protein.
          Length = 767

 Score = 58.4 bits (135), Expect = 3e-08
 Identities = 25/67 (37%), Positives = 46/67 (68%)
 Frame = +3

Query: 264 ALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMR 443
           + H ++I++ +LDEAD ML   F++Q+ ++ ++ S   Q +L SATM D+V +++   ++
Sbjct: 330 SFHLSSIEVLILDEADRMLDEYFEEQMKEIIRMCSHHRQTMLFSATMTDEVKDLASVSLK 389

Query: 444 DPVRILV 464
           +PVRI V
Sbjct: 390 NPVRIFV 396



 Score = 53.2 bits (122), Expect = 1e-06
 Identities = 27/86 (31%), Positives = 45/86 (52%), Gaps = 3/86 (3%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIREC---QALILAPTRELAQQIQKVVIALGDHLNAKCHACIGG 171
           GKTA F++ +L+++    R+    + L+L PTREL  Q+  V   L    N      +GG
Sbjct: 238 GKTAAFALPVLERLIYKPRQAPVTRVLVLVPTRELGIQVHSVTRQLAQFCNITTCLAVGG 297

Query: 172 TNVREDIRQLESGVHVVVGTPGRVYD 249
            +V+     L +   +++ TPGR+ D
Sbjct: 298 LDVKSQEAALRAAPDILIATPGRLID 323


>BC009379-1|AAH09379.2|  450|Homo sapiens DDX47 protein protein.
          Length = 450

 Score = 58.4 bits (135), Expect = 3e-08
 Identities = 24/86 (27%), Positives = 50/86 (58%)
 Frame = +3

Query: 252 DTRRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSR 431
           +  +  +   +K  V+DEAD +L+  F+ ++  + K++  D +  L SATM   V ++ R
Sbjct: 153 ENTKGFNLRALKYLVMDEADRILNMDFETEVDKILKVIPRDRKTFLFSATMTKKVQKLQR 212

Query: 432 CFMRDPVRILVQKEELTLEGIKQFYM 509
             +++PV+  V  +  T+E ++Q+Y+
Sbjct: 213 AALKNPVKCAVSSKYQTVEKLQQYYI 238



 Score = 57.6 bits (133), Expect = 5e-08
 Identities = 29/83 (34%), Positives = 44/83 (53%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKT  F++ IL  +  + +   AL+L PTRELA QI +   ALG  +  +    +GG + 
Sbjct: 68  GKTGAFALPILNALLETPQRLFALVLTPTRELAFQISEQFEALGSSIGVQSAVIVGGIDS 127

Query: 181 REDIRQLESGVHVVVGTPGRVYD 249
                 L    H+++ TPGR+ D
Sbjct: 128 MSQSLALAKKPHIIIATPGRLID 150


>BC009304-1|AAH09304.2|  769|Homo sapiens DDX27 protein protein.
          Length = 769

 Score = 58.4 bits (135), Expect = 3e-08
 Identities = 25/67 (37%), Positives = 46/67 (68%)
 Frame = +3

Query: 264 ALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMR 443
           + H ++I++ +LDEAD ML   F++Q+ ++ ++ S   Q +L SATM D+V +++   ++
Sbjct: 332 SFHLSSIEVLILDEADRMLDEYFEEQMKEIIRMCSHHRQTMLFSATMTDEVKDLASVSLK 391

Query: 444 DPVRILV 464
           +PVRI V
Sbjct: 392 NPVRIFV 398



 Score = 53.2 bits (122), Expect = 1e-06
 Identities = 27/86 (31%), Positives = 45/86 (52%), Gaps = 3/86 (3%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIREC---QALILAPTRELAQQIQKVVIALGDHLNAKCHACIGG 171
           GKTA F++ +L+++    R+    + L+L PTREL  Q+  V   L    N      +GG
Sbjct: 240 GKTAAFALPVLERLIYKPRQAPVTRVLVLVPTRELGIQVHSVTRQLAQFCNITTCLAVGG 299

Query: 172 TNVREDIRQLESGVHVVVGTPGRVYD 249
            +V+     L +   +++ TPGR+ D
Sbjct: 300 LDVKSQEAALRAAPDILIATPGRLID 325


>AY044431-1|AAK95821.1|  796|Homo sapiens RNA helicase-like protein
           protein.
          Length = 796

 Score = 58.4 bits (135), Expect = 3e-08
 Identities = 25/67 (37%), Positives = 46/67 (68%)
 Frame = +3

Query: 264 ALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMR 443
           + H ++I++ +LDEAD ML   F++Q+ ++ ++ S   Q +L SATM D+V +++   ++
Sbjct: 359 SFHLSSIEVLILDEADRMLDEYFEEQMKEIIRMCSHHRQTMLFSATMTDEVKDLASVSLK 418

Query: 444 DPVRILV 464
           +PVRI V
Sbjct: 419 NPVRIFV 425



 Score = 53.2 bits (122), Expect = 1e-06
 Identities = 27/86 (31%), Positives = 45/86 (52%), Gaps = 3/86 (3%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIREC---QALILAPTRELAQQIQKVVIALGDHLNAKCHACIGG 171
           GKTA F++ +L+++    R+    + L+L PTREL  Q+  V   L    N      +GG
Sbjct: 267 GKTAAFALPVLERLIYKPRQAPVTRVLVLVPTRELGIQVHSVTRQLAQFCNITTCLAVGG 326

Query: 172 TNVREDIRQLESGVHVVVGTPGRVYD 249
            +V+     L +   +++ TPGR+ D
Sbjct: 327 LDVKSQEAALRAAPDILIATPGRLID 352


>AL357560-1|CAH70236.1|  796|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 27 protein.
          Length = 796

 Score = 58.4 bits (135), Expect = 3e-08
 Identities = 25/67 (37%), Positives = 46/67 (68%)
 Frame = +3

Query: 264 ALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMR 443
           + H ++I++ +LDEAD ML   F++Q+ ++ ++ S   Q +L SATM D+V +++   ++
Sbjct: 359 SFHLSSIEVLILDEADRMLDEYFEEQMKEIIRMCSHHRQTMLFSATMTDEVKDLASVSLK 418

Query: 444 DPVRILV 464
           +PVRI V
Sbjct: 419 NPVRIFV 425



 Score = 53.2 bits (122), Expect = 1e-06
 Identities = 27/86 (31%), Positives = 45/86 (52%), Gaps = 3/86 (3%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIREC---QALILAPTRELAQQIQKVVIALGDHLNAKCHACIGG 171
           GKTA F++ +L+++    R+    + L+L PTREL  Q+  V   L    N      +GG
Sbjct: 267 GKTAAFALPVLERLIYKPRQAPVTRVLVLVPTRELGIQVHSVTRQLAQFCNITTCLAVGG 326

Query: 172 TNVREDIRQLESGVHVVVGTPGRVYD 249
            +V+     L +   +++ TPGR+ D
Sbjct: 327 LDVKSQEAALRAAPDILIATPGRLID 352


>AL136666-1|CAB66601.1|  455|Homo sapiens hypothetical protein
           protein.
          Length = 455

 Score = 58.4 bits (135), Expect = 3e-08
 Identities = 24/86 (27%), Positives = 50/86 (58%)
 Frame = +3

Query: 252 DTRRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSR 431
           +  +  +   +K  V+DEAD +L+  F+ ++  + K++  D +  L SATM   V ++ R
Sbjct: 158 ENTKGFNLRALKYLVMDEADRILNMDFETEVDKILKVIPRDRKTFLFSATMTKKVQKLQR 217

Query: 432 CFMRDPVRILVQKEELTLEGIKQFYM 509
             +++PV+  V  +  T+E ++Q+Y+
Sbjct: 218 AALKNPVKCAVSSKYQTVEKLQQYYI 243



 Score = 57.6 bits (133), Expect = 5e-08
 Identities = 29/83 (34%), Positives = 44/83 (53%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKT  F++ IL  +  + +   AL+L PTRELA QI +   ALG  +  +    +GG + 
Sbjct: 73  GKTGAFALPILNALLETPQRLFALVLTPTRELAFQISEQFEALGSSIGVQSAVIVGGIDS 132

Query: 181 REDIRQLESGVHVVVGTPGRVYD 249
                 L    H+++ TPGR+ D
Sbjct: 133 MSQSLALAKKPHIIIATPGRLID 155


>AL049766-1|CAI22427.1|  796|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 27 protein.
          Length = 796

 Score = 58.4 bits (135), Expect = 3e-08
 Identities = 25/67 (37%), Positives = 46/67 (68%)
 Frame = +3

Query: 264 ALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMR 443
           + H ++I++ +LDEAD ML   F++Q+ ++ ++ S   Q +L SATM D+V +++   ++
Sbjct: 359 SFHLSSIEVLILDEADRMLDEYFEEQMKEIIRMCSHHRQTMLFSATMTDEVKDLASVSLK 418

Query: 444 DPVRILV 464
           +PVRI V
Sbjct: 419 NPVRIFV 425



 Score = 53.2 bits (122), Expect = 1e-06
 Identities = 27/86 (31%), Positives = 45/86 (52%), Gaps = 3/86 (3%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIREC---QALILAPTRELAQQIQKVVIALGDHLNAKCHACIGG 171
           GKTA F++ +L+++    R+    + L+L PTREL  Q+  V   L    N      +GG
Sbjct: 267 GKTAAFALPVLERLIYKPRQAPVTRVLVLVPTRELGIQVHSVTRQLAQFCNITTCLAVGG 326

Query: 172 TNVREDIRQLESGVHVVVGTPGRVYD 249
            +V+     L +   +++ TPGR+ D
Sbjct: 327 LDVKSQEAALRAAPDILIATPGRLID 352


>AK054574-1|BAB70762.1|  455|Homo sapiens protein ( Homo sapiens
           cDNA FLJ30012 fis, clone 3NB692000281, moderately
           similar to PUTATIVE ATP-DEPENDENT RNA HELICASE T26G10.1
           IN CHROMOSOME III. ).
          Length = 455

 Score = 58.4 bits (135), Expect = 3e-08
 Identities = 24/86 (27%), Positives = 50/86 (58%)
 Frame = +3

Query: 252 DTRRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSR 431
           +  +  +   +K  V+DEAD +L+  F+ ++  + K++  D +  L SATM   V ++ R
Sbjct: 158 ENTKGFNLRALKYLVMDEADRILNMDFETEVDKILKVIPRDRKTFLFSATMTKKVQKLQR 217

Query: 432 CFMRDPVRILVQKEELTLEGIKQFYM 509
             +++PV+  V  +  T+E ++Q+Y+
Sbjct: 218 AALKNPVKCAVSSKYQTVEKLQQYYI 243



 Score = 57.6 bits (133), Expect = 5e-08
 Identities = 29/83 (34%), Positives = 44/83 (53%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKT  F++ IL  +  + +   AL+L PTRELA QI +   ALG  +  +    +GG + 
Sbjct: 73  GKTGAFALPILNALLETPQRLFALVLTPTRELAFQISEQFEALGSSIGVQSAVIVGGIDS 132

Query: 181 REDIRQLESGVHVVVGTPGRVYD 249
                 L    H+++ TPGR+ D
Sbjct: 133 MSQSLALAKKPHIIIATPGRLID 155


>AK022979-1|BAB14343.1|  765|Homo sapiens protein ( Homo sapiens
           cDNA FLJ12917 fis, clone NT2RP2004568, weakly similar to
           PUTATIVE ATP-DEPENDENT RNA HELICASE C30D11.03. ).
          Length = 765

 Score = 58.4 bits (135), Expect = 3e-08
 Identities = 25/67 (37%), Positives = 46/67 (68%)
 Frame = +3

Query: 264 ALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMR 443
           + H ++I++ +LDEAD ML   F++Q+ ++ ++ S   Q +L SATM D+V +++   ++
Sbjct: 328 SFHLSSIEVLILDEADRMLDEYFEEQMKEIIRMCSHHRQTMLFSATMTDEVKDLASVSLK 387

Query: 444 DPVRILV 464
           +PVRI V
Sbjct: 388 NPVRIFV 394



 Score = 53.2 bits (122), Expect = 1e-06
 Identities = 27/86 (31%), Positives = 45/86 (52%), Gaps = 3/86 (3%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIREC---QALILAPTRELAQQIQKVVIALGDHLNAKCHACIGG 171
           GKTA F++ +L+++    R+    + L+L PTREL  Q+  V   L    N      +GG
Sbjct: 236 GKTAAFALPVLERLIYKPRQAPVTRVLVLVPTRELGIQVHSVTRQLAQFCNITTCLAVGG 295

Query: 172 TNVREDIRQLESGVHVVVGTPGRVYD 249
            +V+     L +   +++ TPGR+ D
Sbjct: 296 LDVKSQEAALRAAPDILIATPGRLID 321


>AK001294-1|BAA91606.1|  257|Homo sapiens protein ( Homo sapiens
           cDNA FLJ10432 fis, clone NT2RP1000470, weakly similar to
           PUTATIVE ATP-DEPENDENT RNA HELICASE T26G10.1 IN
           CHROMOSOME III. ).
          Length = 257

 Score = 58.4 bits (135), Expect = 3e-08
 Identities = 33/83 (39%), Positives = 44/83 (53%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTA F + ILQ++         L+L PTRELA QI +    LG  L  K    +GG ++
Sbjct: 51  GKTAAFVLPILQKLSEDPYGIFCLVLTPTRELAYQIAERFRVLGKPLGLKDCIIVGGMDM 110

Query: 181 REDIRQLESGVHVVVGTPGRVYD 249
                +L    HVV+ TPGR+ D
Sbjct: 111 VAQALELSRKPHVVIATPGRLAD 133



 Score = 37.9 bits (84), Expect = 0.039
 Identities = 26/79 (32%), Positives = 39/79 (49%), Gaps = 3/79 (3%)
 Frame = +3

Query: 282 IKLFVLDEADEMLSRGFKDQIHDVFKILS---ADVQVILLSATMPDDVLEVSRCFMRDPV 452
           I+  V+DEAD +L +G  D   D+  IL+   A  Q +L SAT+ D + E+       P 
Sbjct: 146 IRFLVMDEADRLLEQGCTDFTVDLEAILAAVPARRQTLLFSATLTDTLRELQGLATNQPF 205

Query: 453 RILVQKEELTLEGIKQFYM 509
               Q    T+E + Q Y+
Sbjct: 206 FWEAQAPVSTVEQLDQRYL 224


>AJ276704-1|CAC14786.1|  455|Homo sapiens DEAD box protein protein.
          Length = 455

 Score = 58.4 bits (135), Expect = 3e-08
 Identities = 24/86 (27%), Positives = 50/86 (58%)
 Frame = +3

Query: 252 DTRRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSR 431
           +  +  +   +K  V+DEAD +L+  F+ ++  + K++  D +  L SATM   V ++ R
Sbjct: 158 ENTKGFNLRALKYLVMDEADRILNMDFETEVDKILKVIPRDRKTFLFSATMTKKVQKLQR 217

Query: 432 CFMRDPVRILVQKEELTLEGIKQFYM 509
             +++PV+  V  +  T+E ++Q+Y+
Sbjct: 218 AALKNPVKCAVSSKYQTVEKLQQYYI 243



 Score = 57.6 bits (133), Expect = 5e-08
 Identities = 29/83 (34%), Positives = 44/83 (53%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKT  F++ IL  +  + +   AL+L PTRELA QI +   ALG  +  +    +GG + 
Sbjct: 73  GKTGAFALPILNALLETPQRLFALVLTPTRELAFQISEQFEALGSSIGVQSAVIVGGIDS 132

Query: 181 REDIRQLESGVHVVVGTPGRVYD 249
                 L    H+++ TPGR+ D
Sbjct: 133 MSQSLALAKKPHIIIATPGRLID 155


>AF336851-1|AAK21271.1|  561|Homo sapiens RNA helicase-like protein
           protein.
          Length = 561

 Score = 58.4 bits (135), Expect = 3e-08
 Identities = 25/67 (37%), Positives = 46/67 (68%)
 Frame = +3

Query: 264 ALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMR 443
           + H ++I++ +LDEAD ML   F++Q+ ++ ++ S   Q +L SATM D+V +++   ++
Sbjct: 124 SFHLSSIEVLILDEADRMLDEYFEEQMKEIIRMCSHHRQTMLFSATMTDEVKDLASVSLK 183

Query: 444 DPVRILV 464
           +PVRI V
Sbjct: 184 NPVRIFV 190



 Score = 53.2 bits (122), Expect = 1e-06
 Identities = 27/86 (31%), Positives = 45/86 (52%), Gaps = 3/86 (3%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIREC---QALILAPTRELAQQIQKVVIALGDHLNAKCHACIGG 171
           GKTA F++ +L+++    R+    + L+L PTREL  Q+  V   L    N      +GG
Sbjct: 32  GKTAAFALPVLERLIYKPRQAPVTRVLVLVPTRELGIQVHSVTRQLAQFCNITTCLAVGG 91

Query: 172 TNVREDIRQLESGVHVVVGTPGRVYD 249
            +V+     L +   +++ TPGR+ D
Sbjct: 92  LDVKSQEAALRAAPDILIATPGRLID 117


>AF078843-1|AAF23354.1|  274|Homo sapiens hqp0256 protein protein.
          Length = 274

 Score = 58.4 bits (135), Expect = 3e-08
 Identities = 24/86 (27%), Positives = 50/86 (58%)
 Frame = +3

Query: 252 DTRRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSR 431
           +  +  +   +K  V+DEAD +L+  F+ ++  + K++  D +  L SATM   V ++ R
Sbjct: 26  ENTKGFNLRALKYLVMDEADRILNMDFETEVDKILKVIPRDRKTFLFSATMTKKVQKLQR 85

Query: 432 CFMRDPVRILVQKEELTLEGIKQFYM 509
             +++PV+  V  +  T+E ++Q+Y+
Sbjct: 86  AALKNPVKCAVSSKYQTVEKLQQYYI 111


>BX248516-9|CAM25880.1|  236|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 236

 Score = 58.0 bits (134), Expect = 3e-08
 Identities = 31/83 (37%), Positives = 47/83 (56%), Gaps = 2/83 (2%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTN 177
           GKTA F ++ LQQ++    +   L++  TRELA QI K       ++ N K     GG +
Sbjct: 94  GKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLS 153

Query: 178 VREDIRQLESGV-HVVVGTPGRV 243
           +++D   L+    H+VVGTPGR+
Sbjct: 154 IKKDEEVLKKNCPHIVVGTPGRI 176



 Score = 37.5 bits (83), Expect = 0.052
 Identities = 16/53 (30%), Positives = 34/53 (64%), Gaps = 1/53 (1%)
 Frame = +3

Query: 261 RALHANTIKLFVLDEADEMLSR-GFKDQIHDVFKILSADVQVILLSATMPDDV 416
           ++L+   IK F+LDE D+ML +   +  + ++F++   + QV++ SAT+  ++
Sbjct: 183 KSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSKEI 235


>BX248516-8|CAM25879.1|  238|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 238

 Score = 58.0 bits (134), Expect = 3e-08
 Identities = 31/83 (37%), Positives = 47/83 (56%), Gaps = 2/83 (2%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTN 177
           GKTA F ++ LQQ++    +   L++  TRELA QI K       ++ N K     GG +
Sbjct: 94  GKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLS 153

Query: 178 VREDIRQLESGV-HVVVGTPGRV 243
           +++D   L+    H+VVGTPGR+
Sbjct: 154 IKKDEEVLKKNCPHIVVGTPGRI 176



 Score = 37.9 bits (84), Expect = 0.039
 Identities = 17/56 (30%), Positives = 35/56 (62%), Gaps = 1/56 (1%)
 Frame = +3

Query: 261 RALHANTIKLFVLDEADEMLSR-GFKDQIHDVFKILSADVQVILLSATMPDDVLEV 425
           ++L+   IK F+LDE D+ML +   +  + ++F++   + QV++ SAT+  ++  V
Sbjct: 183 KSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSKEIRPV 238


>BX248516-7|CAM25878.1|  231|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 231

 Score = 58.0 bits (134), Expect = 3e-08
 Identities = 31/83 (37%), Positives = 47/83 (56%), Gaps = 2/83 (2%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTN 177
           GKTA F ++ LQQ++    +   L++  TRELA QI K       ++ N K     GG +
Sbjct: 94  GKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLS 153

Query: 178 VREDIRQLESGV-HVVVGTPGRV 243
           +++D   L+    H+VVGTPGR+
Sbjct: 154 IKKDEEVLKKNCPHIVVGTPGRI 176



 Score = 36.3 bits (80), Expect = 0.12
 Identities = 16/49 (32%), Positives = 32/49 (65%), Gaps = 1/49 (2%)
 Frame = +3

Query: 261 RALHANTIKLFVLDEADEMLSR-GFKDQIHDVFKILSADVQVILLSATM 404
           ++L+   IK F+LDE D+ML +   +  + ++F++   + QV++ SAT+
Sbjct: 183 KSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATL 231


>BX001040-8|CAI18637.1|  205|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 205

 Score = 58.0 bits (134), Expect = 3e-08
 Identities = 31/83 (37%), Positives = 47/83 (56%), Gaps = 2/83 (2%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTN 177
           GKTA F ++ LQQ++    +   L++  TRELA QI K       ++ N K     GG +
Sbjct: 94  GKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLS 153

Query: 178 VREDIRQLESGV-HVVVGTPGRV 243
           +++D   L+    H+VVGTPGR+
Sbjct: 154 IKKDEEVLKKNCPHIVVGTPGRI 176


>BX001040-7|CAI18635.1|  245|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 245

 Score = 58.0 bits (134), Expect = 3e-08
 Identities = 31/83 (37%), Positives = 47/83 (56%), Gaps = 2/83 (2%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTN 177
           GKTA F ++ LQQ++    +   L++  TRELA QI K       ++ N K     GG +
Sbjct: 94  GKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLS 153

Query: 178 VREDIRQLESGV-HVVVGTPGRV 243
           +++D   L+    H+VVGTPGR+
Sbjct: 154 IKKDEEVLKKNCPHIVVGTPGRI 176



 Score = 45.6 bits (103), Expect = 2e-04
 Identities = 21/63 (33%), Positives = 40/63 (63%), Gaps = 1/63 (1%)
 Frame = +3

Query: 261 RALHANTIKLFVLDEADEMLSR-GFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           ++L+   IK F+LDE D+ML +   +  + ++F++   + QV++ SAT+  ++  V R F
Sbjct: 183 KSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSKEIRPVCRKF 242

Query: 438 MRD 446
           M+D
Sbjct: 243 MQD 245


>BC000272-1|AAH00272.1|  737|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 50 protein.
          Length = 737

 Score = 58.0 bits (134), Expect = 3e-08
 Identities = 31/89 (34%), Positives = 52/89 (58%), Gaps = 6/89 (6%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTS------IRECQALILAPTRELAQQIQKVVIALGDHLNAKCHAC 162
           GKT +F+I +++++  +       R  + L+LAPTRELA Q+ K    +   L+  C   
Sbjct: 186 GKTFSFAIPLIERLQRNQETIKKSRSPKVLVLAPTRELANQVAKDFKDITRKLSVACF-- 243

Query: 163 IGGTNVREDIRQLESGVHVVVGTPGRVYD 249
            GGT+ +  I  + +G+ ++VGTPGR+ D
Sbjct: 244 YGGTSYQSQINHIRNGIDILVGTPGRIKD 272



 Score = 41.5 bits (93), Expect = 0.003
 Identities = 31/85 (36%), Positives = 46/85 (54%), Gaps = 11/85 (12%)
 Frame = +3

Query: 267 LHANTIKLFVLDEADEMLSRGFKDQ----IHDVFKILSAD-VQVILLSATMPDDVLEVSR 431
           L  + ++  VLDE D+ML  GF +Q    IH+ +K  S D  Q +L SAT P  V +V++
Sbjct: 279 LDLSKLRHVVLDEVDQMLDLGFAEQVEDIIHESYKTDSEDNPQTLLFSATCPQWVYKVAK 338

Query: 432 CFMR------DPVRILVQKEELTLE 488
            +M+      D V  + QK   T+E
Sbjct: 339 KYMKSRYEQVDLVGKMTQKAATTVE 363


>AL662847-26|CAI17670.2|  238|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 238

 Score = 58.0 bits (134), Expect = 3e-08
 Identities = 31/83 (37%), Positives = 47/83 (56%), Gaps = 2/83 (2%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTN 177
           GKTA F ++ LQQ++    +   L++  TRELA QI K       ++ N K     GG +
Sbjct: 94  GKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLS 153

Query: 178 VREDIRQLESGV-HVVVGTPGRV 243
           +++D   L+    H+VVGTPGR+
Sbjct: 154 IKKDEEVLKKNCPHIVVGTPGRI 176



 Score = 37.9 bits (84), Expect = 0.039
 Identities = 17/56 (30%), Positives = 35/56 (62%), Gaps = 1/56 (1%)
 Frame = +3

Query: 261 RALHANTIKLFVLDEADEMLSR-GFKDQIHDVFKILSADVQVILLSATMPDDVLEV 425
           ++L+   IK F+LDE D+ML +   +  + ++F++   + QV++ SAT+  ++  V
Sbjct: 183 KSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSKEIRPV 238


>AL662847-25|CAO72088.1|  231|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 231

 Score = 58.0 bits (134), Expect = 3e-08
 Identities = 31/83 (37%), Positives = 47/83 (56%), Gaps = 2/83 (2%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTN 177
           GKTA F ++ LQQ++    +   L++  TRELA QI K       ++ N K     GG +
Sbjct: 94  GKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLS 153

Query: 178 VREDIRQLESGV-HVVVGTPGRV 243
           +++D   L+    H+VVGTPGR+
Sbjct: 154 IKKDEEVLKKNCPHIVVGTPGRI 176



 Score = 36.3 bits (80), Expect = 0.12
 Identities = 16/49 (32%), Positives = 32/49 (65%), Gaps = 1/49 (2%)
 Frame = +3

Query: 261 RALHANTIKLFVLDEADEMLSR-GFKDQIHDVFKILSADVQVILLSATM 404
           ++L+   IK F+LDE D+ML +   +  + ++F++   + QV++ SAT+
Sbjct: 183 KSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATL 231


>AL662847-24|CAO72087.1|  236|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 236

 Score = 58.0 bits (134), Expect = 3e-08
 Identities = 31/83 (37%), Positives = 47/83 (56%), Gaps = 2/83 (2%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTN 177
           GKTA F ++ LQQ++    +   L++  TRELA QI K       ++ N K     GG +
Sbjct: 94  GKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLS 153

Query: 178 VREDIRQLESGV-HVVVGTPGRV 243
           +++D   L+    H+VVGTPGR+
Sbjct: 154 IKKDEEVLKKNCPHIVVGTPGRI 176



 Score = 37.5 bits (83), Expect = 0.052
 Identities = 16/53 (30%), Positives = 34/53 (64%), Gaps = 1/53 (1%)
 Frame = +3

Query: 261 RALHANTIKLFVLDEADEMLSR-GFKDQIHDVFKILSADVQVILLSATMPDDV 416
           ++L+   IK F+LDE D+ML +   +  + ++F++   + QV++ SAT+  ++
Sbjct: 183 KSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSKEI 235


>AL662801-9|CAI18278.2|  238|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 238

 Score = 58.0 bits (134), Expect = 3e-08
 Identities = 31/83 (37%), Positives = 47/83 (56%), Gaps = 2/83 (2%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTN 177
           GKTA F ++ LQQ++    +   L++  TRELA QI K       ++ N K     GG +
Sbjct: 94  GKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLS 153

Query: 178 VREDIRQLESGV-HVVVGTPGRV 243
           +++D   L+    H+VVGTPGR+
Sbjct: 154 IKKDEEVLKKNCPHIVVGTPGRI 176



 Score = 37.9 bits (84), Expect = 0.039
 Identities = 17/56 (30%), Positives = 35/56 (62%), Gaps = 1/56 (1%)
 Frame = +3

Query: 261 RALHANTIKLFVLDEADEMLSR-GFKDQIHDVFKILSADVQVILLSATMPDDVLEV 425
           ++L+   IK F+LDE D+ML +   +  + ++F++   + QV++ SAT+  ++  V
Sbjct: 183 KSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSKEIRPV 238


>AL662801-8|CAI18281.2|  231|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 231

 Score = 58.0 bits (134), Expect = 3e-08
 Identities = 31/83 (37%), Positives = 47/83 (56%), Gaps = 2/83 (2%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTN 177
           GKTA F ++ LQQ++    +   L++  TRELA QI K       ++ N K     GG +
Sbjct: 94  GKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLS 153

Query: 178 VREDIRQLESGV-HVVVGTPGRV 243
           +++D   L+    H+VVGTPGR+
Sbjct: 154 IKKDEEVLKKNCPHIVVGTPGRI 176



 Score = 36.3 bits (80), Expect = 0.12
 Identities = 16/49 (32%), Positives = 32/49 (65%), Gaps = 1/49 (2%)
 Frame = +3

Query: 261 RALHANTIKLFVLDEADEMLSR-GFKDQIHDVFKILSADVQVILLSATM 404
           ++L+   IK F+LDE D+ML +   +  + ++F++   + QV++ SAT+
Sbjct: 183 KSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATL 231


>AL662801-7|CAI18283.2|  236|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 236

 Score = 58.0 bits (134), Expect = 3e-08
 Identities = 31/83 (37%), Positives = 47/83 (56%), Gaps = 2/83 (2%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTN 177
           GKTA F ++ LQQ++    +   L++  TRELA QI K       ++ N K     GG +
Sbjct: 94  GKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLS 153

Query: 178 VREDIRQLESGV-HVVVGTPGRV 243
           +++D   L+    H+VVGTPGR+
Sbjct: 154 IKKDEEVLKKNCPHIVVGTPGRI 176



 Score = 37.5 bits (83), Expect = 0.052
 Identities = 16/53 (30%), Positives = 34/53 (64%), Gaps = 1/53 (1%)
 Frame = +3

Query: 261 RALHANTIKLFVLDEADEMLSR-GFKDQIHDVFKILSADVQVILLSATMPDDV 416
           ++L+   IK F+LDE D+ML +   +  + ++F++   + QV++ SAT+  ++
Sbjct: 183 KSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSKEI 235


>AL359844-2|CAH72376.1|  737|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 50 protein.
          Length = 737

 Score = 58.0 bits (134), Expect = 3e-08
 Identities = 31/89 (34%), Positives = 52/89 (58%), Gaps = 6/89 (6%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTS------IRECQALILAPTRELAQQIQKVVIALGDHLNAKCHAC 162
           GKT +F+I +++++  +       R  + L+LAPTRELA Q+ K    +   L+  C   
Sbjct: 186 GKTFSFAIPLIERLQRNQETIKKSRSPKVLVLAPTRELANQVAKDFKDITRKLSVACF-- 243

Query: 163 IGGTNVREDIRQLESGVHVVVGTPGRVYD 249
            GGT+ +  I  + +G+ ++VGTPGR+ D
Sbjct: 244 YGGTSYQSQINHIRNGIDILVGTPGRIKD 272



 Score = 41.5 bits (93), Expect = 0.003
 Identities = 31/85 (36%), Positives = 46/85 (54%), Gaps = 11/85 (12%)
 Frame = +3

Query: 267 LHANTIKLFVLDEADEMLSRGFKDQ----IHDVFKILSAD-VQVILLSATMPDDVLEVSR 431
           L  + ++  VLDE D+ML  GF +Q    IH+ +K  S D  Q +L SAT P  V +V++
Sbjct: 279 LDLSKLRHVVLDEVDQMLDLGFAEQVEDIIHESYKTDSEDNPQTLLFSATCPQWVYKVAK 338

Query: 432 CFMR------DPVRILVQKEELTLE 488
            +M+      D V  + QK   T+E
Sbjct: 339 KYMKSRYEQVDLVGKMTQKAATTVE 363


>AF334103-1|AAK29402.1|  737|Homo sapiens nucleolar protein GU2
           protein.
          Length = 737

 Score = 58.0 bits (134), Expect = 3e-08
 Identities = 31/89 (34%), Positives = 52/89 (58%), Gaps = 6/89 (6%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTS------IRECQALILAPTRELAQQIQKVVIALGDHLNAKCHAC 162
           GKT +F+I +++++  +       R  + L+LAPTRELA Q+ K    +   L+  C   
Sbjct: 186 GKTFSFAIPLIERLQRNQETIKKSRSPKVLVLAPTRELANQVAKDFKDITRKLSVACF-- 243

Query: 163 IGGTNVREDIRQLESGVHVVVGTPGRVYD 249
            GGT+ +  I  + +G+ ++VGTPGR+ D
Sbjct: 244 YGGTSYQSQINHIRNGIDILVGTPGRIKD 272



 Score = 41.5 bits (93), Expect = 0.003
 Identities = 31/85 (36%), Positives = 46/85 (54%), Gaps = 11/85 (12%)
 Frame = +3

Query: 267 LHANTIKLFVLDEADEMLSRGFKDQ----IHDVFKILSAD-VQVILLSATMPDDVLEVSR 431
           L  + ++  VLDE D+ML  GF +Q    IH+ +K  S D  Q +L SAT P  V +V++
Sbjct: 279 LDLSKLRHVVLDEVDQMLDLGFAEQVEDIIHESYKTDSEDNPQTLLFSATCPQWVYKVAK 338

Query: 432 CFMR------DPVRILVQKEELTLE 488
            +M+      D V  + QK   T+E
Sbjct: 339 KYMKSRYEQVDLVGKMTQKAATTVE 363


>AB209217-1|BAD92454.1|  310|Homo sapiens HLA-B associated
           transcript 1 variant protein.
          Length = 310

 Score = 58.0 bits (134), Expect = 3e-08
 Identities = 31/83 (37%), Positives = 47/83 (56%), Gaps = 2/83 (2%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTN 177
           GKTA F ++ LQQ++    +   L++  TRELA QI K       ++ N K     GG +
Sbjct: 114 GKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLS 173

Query: 178 VREDIRQLESGV-HVVVGTPGRV 243
           +++D   L+    H+VVGTPGR+
Sbjct: 174 IKKDEEVLKKNCPHIVVGTPGRI 196



 Score = 45.6 bits (103), Expect = 2e-04
 Identities = 21/63 (33%), Positives = 40/63 (63%), Gaps = 1/63 (1%)
 Frame = +3

Query: 261 RALHANTIKLFVLDEADEMLSR-GFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           ++L+   IK F+LDE D+ML +   +  + ++F++   + QV++ SAT+  ++  V R F
Sbjct: 203 KSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSKEIRPVCRKF 262

Query: 438 MRD 446
           M+D
Sbjct: 263 MQD 265


>EF036507-1|ABO65093.1|  182|Homo sapiens DEAD box polypeptide 47
           isoform 1 variant protein.
          Length = 182

 Score = 57.6 bits (133), Expect = 5e-08
 Identities = 29/83 (34%), Positives = 44/83 (53%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKT  F++ IL  +  + +   AL+L PTRELA QI +   ALG  +  +    +GG + 
Sbjct: 62  GKTGAFALPILNALLETPQRLFALVLTPTRELAFQISEQFEALGSSIGVQSAVIVGGIDS 121

Query: 181 REDIRQLESGVHVVVGTPGRVYD 249
                 L    H+++ TPGR+ D
Sbjct: 122 MSQSLALAKKPHIIIATPGRLID 144


>AK222940-1|BAD96660.1|  448|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 47 isoform 1 variant protein.
          Length = 448

 Score = 57.6 bits (133), Expect = 5e-08
 Identities = 29/83 (34%), Positives = 44/83 (53%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKT  F++ IL  +  + +   AL+L PTRELA QI +   ALG  +  +    +GG + 
Sbjct: 66  GKTGAFALPILNALLETPQRLFALVLTPTRELAFQISEQFEALGSSIGVQSAVIVGGIDS 125

Query: 181 REDIRQLESGVHVVVGTPGRVYD 249
                 L    H+++ TPGR+ D
Sbjct: 126 MSQSLALAKKPHIIIATPGRLID 148



 Score = 56.4 bits (130), Expect = 1e-07
 Identities = 24/86 (27%), Positives = 49/86 (56%)
 Frame = +3

Query: 252 DTRRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSR 431
           +  +  +   +K  V+DEAD +L+  F+ ++  + K+   D +  L SATM   V ++ R
Sbjct: 151 ENTKGFNLRALKYLVMDEADRILNMDFETEVDKILKVNPRDRKTFLFSATMTKKVQKLQR 210

Query: 432 CFMRDPVRILVQKEELTLEGIKQFYM 509
             +++PV+  V  +  T+E ++Q+Y+
Sbjct: 211 AALKNPVKCAVSSKYQTVEKLQQYYI 236


>U41387-1|AAB02546.1|  801|Homo sapiens Gu protein protein.
          Length = 801

 Score = 57.2 bits (132), Expect = 6e-08
 Identities = 32/91 (35%), Positives = 51/91 (56%), Gaps = 6/91 (6%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSI------RECQALILAPTRELAQQIQKVVIALGDHLNAKCHAC 162
           GKT +F+I +++++   +      R  Q L+LAPTRELA Q+ K    +   L+  C   
Sbjct: 253 GKTFSFAIPLIEKLHGELQDRKRGRAPQVLVLAPTRELANQVSKDFSDITKKLSVACF-- 310

Query: 163 IGGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
            GGT       ++ +G+ ++VGTPGR+ D I
Sbjct: 311 YGGTPYGGQFERMRNGIDILVGTPGRIKDHI 341



 Score = 41.5 bits (93), Expect = 0.003
 Identities = 24/64 (37%), Positives = 35/64 (54%), Gaps = 5/64 (7%)
 Frame = +3

Query: 267 LHANTIKLFVLDEADEMLSRGFKDQIHDVFKIL----SAD-VQVILLSATMPDDVLEVSR 431
           L    +K  VLDE D+ML  GF DQ+ ++  +     S D  Q +L SAT P  V  V++
Sbjct: 346 LDLTKLKHVVLDEVDQMLDMGFADQVEEILSVAYKKDSEDNPQTLLFSATCPHWVFNVAK 405

Query: 432 CFMR 443
            +M+
Sbjct: 406 KYMK 409


>BC010455-1|AAH10455.1|  316|Homo sapiens DDX39 protein protein.
          Length = 316

 Score = 57.2 bits (132), Expect = 6e-08
 Identities = 32/87 (36%), Positives = 49/87 (56%), Gaps = 2/87 (2%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTN 177
           GKTA F ++ LQQI+    +   L++  TRELA QI K       ++ + K     GG +
Sbjct: 93  GKTAVFVLATLQQIEPVNGQVTVLVMCHTRELAFQISKEYERFSKYMPSVKVSVFFGGLS 152

Query: 178 VREDIRQLESGV-HVVVGTPGRVYDMI 255
           +++D   L+    HVVVGTPGR+  ++
Sbjct: 153 IKKDEEVLKKNCPHVVVGTPGRILALV 179



 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 23/69 (33%), Positives = 39/69 (56%), Gaps = 1/69 (1%)
 Frame = +3

Query: 261 RALHANTIKLFVLDEADEMLSR-GFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           R+     +K FVLDE D+ML +   +  + ++F++   + Q ++ SAT+  D+  V R F
Sbjct: 182 RSFSLKNVKHFVLDECDKMLEQLDMRRDVQEIFRLTPHEKQCMMFSATLSKDIRPVCRKF 241

Query: 438 MRDPVRILV 464
           M+D  R  V
Sbjct: 242 MQDVSRARV 250


>BC008071-1|AAH08071.2|  783|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 21 protein.
          Length = 783

 Score = 57.2 bits (132), Expect = 6e-08
 Identities = 32/91 (35%), Positives = 51/91 (56%), Gaps = 6/91 (6%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSI------RECQALILAPTRELAQQIQKVVIALGDHLNAKCHAC 162
           GKT +F+I +++++   +      R  Q L+LAPTRELA Q+ K    +   L+  C   
Sbjct: 235 GKTFSFAIPLIEKLHGELQDRKRGRAPQVLVLAPTRELANQVSKDFSDITKKLSVACF-- 292

Query: 163 IGGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
            GGT       ++ +G+ ++VGTPGR+ D I
Sbjct: 293 YGGTPYGGQFERMRNGIDILVGTPGRIKDHI 323



 Score = 41.5 bits (93), Expect = 0.003
 Identities = 24/64 (37%), Positives = 35/64 (54%), Gaps = 5/64 (7%)
 Frame = +3

Query: 267 LHANTIKLFVLDEADEMLSRGFKDQIHDVFKIL----SAD-VQVILLSATMPDDVLEVSR 431
           L    +K  VLDE D+ML  GF DQ+ ++  +     S D  Q +L SAT P  V  V++
Sbjct: 328 LDLTKLKHVVLDEVDQMLDMGFADQVEEILSVAYKKDSEDNPQTLLFSATCPHWVFNVAK 387

Query: 432 CFMR 443
            +M+
Sbjct: 388 KYMK 391


>AL359844-3|CAH72377.1|  783|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 21 protein.
          Length = 783

 Score = 57.2 bits (132), Expect = 6e-08
 Identities = 32/91 (35%), Positives = 51/91 (56%), Gaps = 6/91 (6%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSI------RECQALILAPTRELAQQIQKVVIALGDHLNAKCHAC 162
           GKT +F+I +++++   +      R  Q L+LAPTRELA Q+ K    +   L+  C   
Sbjct: 235 GKTFSFAIPLIEKLHGELQDRKRGRAPQVLVLAPTRELANQVSKDFSDITKKLSVACF-- 292

Query: 163 IGGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
            GGT       ++ +G+ ++VGTPGR+ D I
Sbjct: 293 YGGTPYGGQFERMRNGIDILVGTPGRIKDHI 323



 Score = 41.5 bits (93), Expect = 0.003
 Identities = 24/64 (37%), Positives = 35/64 (54%), Gaps = 5/64 (7%)
 Frame = +3

Query: 267 LHANTIKLFVLDEADEMLSRGFKDQIHDVFKIL----SAD-VQVILLSATMPDDVLEVSR 431
           L    +K  VLDE D+ML  GF DQ+ ++  +     S D  Q +L SAT P  V  V++
Sbjct: 328 LDLTKLKHVVLDEVDQMLDMGFADQVEEILSVAYKKDSEDNPQTLLFSATCPHWVFNVAK 387

Query: 432 CFMR 443
            +M+
Sbjct: 388 KYMK 391


>BC012304-1|AAH12304.1| 1031|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 46 protein.
          Length = 1031

 Score = 56.4 bits (130), Expect = 1e-07
 Identities = 33/90 (36%), Positives = 48/90 (53%), Gaps = 5/90 (5%)
 Frame = +1

Query: 1   GKTATFSISILQQI--DTSIRECQ---ALILAPTRELAQQIQKVVIALGDHLNAKCHACI 165
           GKT  F + + + I    S+ E +   A+I+ PTRELA QI K        L  +     
Sbjct: 421 GKTIAFLLPMFRHIMDQRSLEEGEGPIAVIMTPTRELALQITKECKKFSKTLGLRVVCVY 480

Query: 166 GGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
           GGT + E I +L+ G  ++V TPGR+ DM+
Sbjct: 481 GGTGISEQIAELKRGAEIIVCTPGRMIDML 510



 Score = 44.4 bits (100), Expect = 5e-04
 Identities = 23/95 (24%), Positives = 43/95 (45%)
 Frame = +3

Query: 216 CGGGHSRSCI*YDTRRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLS 395
           C  G     +  ++ R  +   +   VLDEAD M   GF+ Q+  +   +  D Q ++ S
Sbjct: 501 CTPGRMIDMLAANSGRVTNLRRVTYVVLDEADRMFDMGFEPQVMRIVDNVRPDRQTVMFS 560

Query: 396 ATMPDDVLEVSRCFMRDPVRILVQKEELTLEGIKQ 500
           AT P  +  ++R  +  P+ + V    +    ++Q
Sbjct: 561 ATFPRAMEALARRILSKPIEVQVGGRSVVCSDVEQ 595


>AB018344-1|BAA34521.2| 1058|Homo sapiens KIAA0801 protein protein.
          Length = 1058

 Score = 56.4 bits (130), Expect = 1e-07
 Identities = 33/90 (36%), Positives = 48/90 (53%), Gaps = 5/90 (5%)
 Frame = +1

Query: 1   GKTATFSISILQQI--DTSIRECQ---ALILAPTRELAQQIQKVVIALGDHLNAKCHACI 165
           GKT  F + + + I    S+ E +   A+I+ PTRELA QI K        L  +     
Sbjct: 447 GKTIAFLLPMFRHIMDQRSLEEGEGPIAVIMTPTRELALQITKECKKFSKTLGLRVVCVY 506

Query: 166 GGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
           GGT + E I +L+ G  ++V TPGR+ DM+
Sbjct: 507 GGTGISEQIAELKRGAEIIVCTPGRMIDML 536



 Score = 44.4 bits (100), Expect = 5e-04
 Identities = 23/95 (24%), Positives = 43/95 (45%)
 Frame = +3

Query: 216 CGGGHSRSCI*YDTRRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLS 395
           C  G     +  ++ R  +   +   VLDEAD M   GF+ Q+  +   +  D Q ++ S
Sbjct: 527 CTPGRMIDMLAANSGRVTNLRRVTYVVLDEADRMFDMGFEPQVMRIVDNVRPDRQTVMFS 586

Query: 396 ATMPDDVLEVSRCFMRDPVRILVQKEELTLEGIKQ 500
           AT P  +  ++R  +  P+ + V    +    ++Q
Sbjct: 587 ATFPRAMEALARRILSKPIEVQVGGRSVVCSDVEQ 621


>Z97056-3|CAB09792.1|  650|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 17 protein.
          Length = 650

 Score = 56.0 bits (129), Expect = 1e-07
 Identities = 28/62 (45%), Positives = 35/62 (56%)
 Frame = +1

Query: 70  LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTPGRVYD 249
           L+LAPTRELAQQ+Q+V    G     K     GG      IR LE GV + + TPGR+ D
Sbjct: 169 LVLAPTRELAQQVQQVADDYGKCSRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLID 228

Query: 250 MI 255
            +
Sbjct: 229 FL 230



 Score = 50.4 bits (115), Expect = 7e-06
 Identities = 26/63 (41%), Positives = 38/63 (60%)
 Frame = +3

Query: 294 VLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRILVQKE 473
           VLDEAD ML  GF+ QI  +   +  D Q ++ SAT P +V +++  F+RD  +I V   
Sbjct: 244 VLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLRDYTQINVGNL 303

Query: 474 ELT 482
           EL+
Sbjct: 304 ELS 306


>U59321-1|AAC50787.1|  650|Homo sapiens DEAD-box protein p72
           protein.
          Length = 650

 Score = 56.0 bits (129), Expect = 1e-07
 Identities = 28/62 (45%), Positives = 35/62 (56%)
 Frame = +1

Query: 70  LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTPGRVYD 249
           L+LAPTRELAQQ+Q+V    G     K     GG      IR LE GV + + TPGR+ D
Sbjct: 169 LVLAPTRELAQQVQQVADDYGKCSRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLID 228

Query: 250 MI 255
            +
Sbjct: 229 FL 230



 Score = 50.4 bits (115), Expect = 7e-06
 Identities = 26/63 (41%), Positives = 38/63 (60%)
 Frame = +3

Query: 294 VLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRILVQKE 473
           VLDEAD ML  GF+ QI  +   +  D Q ++ SAT P +V +++  F+RD  +I V   
Sbjct: 244 VLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLRDYTQINVGNL 303

Query: 474 ELT 482
           EL+
Sbjct: 304 ELS 306


>CR456432-1|CAG30318.1|  652|Homo sapiens DDX17 protein.
          Length = 652

 Score = 56.0 bits (129), Expect = 1e-07
 Identities = 28/62 (45%), Positives = 35/62 (56%)
 Frame = +1

Query: 70  LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTPGRVYD 249
           L+LAPTRELAQQ+Q+V    G     K     GG      IR LE GV + + TPGR+ D
Sbjct: 169 LVLAPTRELAQQVQQVADDYGKCSRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLID 228

Query: 250 MI 255
            +
Sbjct: 229 FL 230



 Score = 50.4 bits (115), Expect = 7e-06
 Identities = 26/63 (41%), Positives = 38/63 (60%)
 Frame = +3

Query: 294 VLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRILVQKE 473
           VLDEAD ML  GF+ QI  +   +  D Q ++ SAT P +V +++  F+RD  +I V   
Sbjct: 244 VLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLRDYTQINVGNL 303

Query: 474 ELT 482
           EL+
Sbjct: 304 ELS 306


>BC000595-1|AAH00595.2|  729|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 17 protein.
          Length = 729

 Score = 56.0 bits (129), Expect = 1e-07
 Identities = 28/62 (45%), Positives = 35/62 (56%)
 Frame = +1

Query: 70  LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTPGRVYD 249
           L+LAPTRELAQQ+Q+V    G     K     GG      IR LE GV + + TPGR+ D
Sbjct: 248 LVLAPTRELAQQVQQVADDYGKCSRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLID 307

Query: 250 MI 255
            +
Sbjct: 308 FL 309



 Score = 50.4 bits (115), Expect = 7e-06
 Identities = 26/63 (41%), Positives = 38/63 (60%)
 Frame = +3

Query: 294 VLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRILVQKE 473
           VLDEAD ML  GF+ QI  +   +  D Q ++ SAT P +V +++  F+RD  +I V   
Sbjct: 323 VLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLRDYTQINVGNL 382

Query: 474 ELT 482
           EL+
Sbjct: 383 ELS 385


>AB209595-1|BAD92832.1|  737|Homo sapiens DEAD box polypeptide 17
           isoform p82 variant protein.
          Length = 737

 Score = 56.0 bits (129), Expect = 1e-07
 Identities = 28/62 (45%), Positives = 35/62 (56%)
 Frame = +1

Query: 70  LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTPGRVYD 249
           L+LAPTRELAQQ+Q+V    G     K     GG      IR LE GV + + TPGR+ D
Sbjct: 250 LVLAPTRELAQQVQQVADDYGKCSRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLID 309

Query: 250 MI 255
            +
Sbjct: 310 FL 311



 Score = 50.4 bits (115), Expect = 7e-06
 Identities = 26/63 (41%), Positives = 38/63 (60%)
 Frame = +3

Query: 294 VLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRILVQKE 473
           VLDEAD ML  GF+ QI  +   +  D Q ++ SAT P +V +++  F+RD  +I V   
Sbjct: 325 VLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLRDYTQINVGNL 384

Query: 474 ELT 482
           EL+
Sbjct: 385 ELS 387


>AF261917-1|AAF78930.2|  715|Homo sapiens RNA helicase II/Gu protein
           protein.
          Length = 715

 Score = 55.6 bits (128), Expect = 2e-07
 Identities = 31/91 (34%), Positives = 50/91 (54%), Gaps = 6/91 (6%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSI------RECQALILAPTRELAQQIQKVVIALGDHLNAKCHAC 162
           GKT +F+I +++++   +      R  Q L+LAPTREL  Q+ K    +   L+  C   
Sbjct: 167 GKTFSFAIPLIEKLHGELQDRKRGRAPQVLVLAPTRELCNQVSKDFSDITKKLSVACF-- 224

Query: 163 IGGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
            GGT       ++ +G+ ++VGTPGR+ D I
Sbjct: 225 YGGTPYGGQFERMRNGIDILVGTPGRIKDHI 255



 Score = 41.5 bits (93), Expect = 0.003
 Identities = 24/64 (37%), Positives = 35/64 (54%), Gaps = 5/64 (7%)
 Frame = +3

Query: 267 LHANTIKLFVLDEADEMLSRGFKDQIHDVFKIL----SAD-VQVILLSATMPDDVLEVSR 431
           L    +K  VLDE D+ML  GF DQ+ ++  +     S D  Q +L SAT P  V  V++
Sbjct: 260 LDLTKLKHVVLDEVDQMLDMGFADQVEEILSVAYKKDSEDNPQTLLFSATCPHWVFNVAK 319

Query: 432 CFMR 443
            +M+
Sbjct: 320 KYMK 323


>AK223297-1|BAD97017.1|  363|Homo sapiens nucleolar protein GU2
           variant protein.
          Length = 363

 Score = 55.2 bits (127), Expect = 2e-07
 Identities = 30/89 (33%), Positives = 51/89 (57%), Gaps = 6/89 (6%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTS------IRECQALILAPTRELAQQIQKVVIALGDHLNAKCHAC 162
           GKT +F+I +++++  +       R  + L+LAPT ELA Q+ K    +   L+  C   
Sbjct: 186 GKTFSFAIPLIERLQRNQETIKKSRSPKVLVLAPTGELANQVAKDFKDITRKLSVACF-- 243

Query: 163 IGGTNVREDIRQLESGVHVVVGTPGRVYD 249
            GGT+ +  I  + +G+ ++VGTPGR+ D
Sbjct: 244 YGGTSYQSQINHIRNGIDILVGTPGRIKD 272



 Score = 41.5 bits (93), Expect = 0.003
 Identities = 31/85 (36%), Positives = 46/85 (54%), Gaps = 11/85 (12%)
 Frame = +3

Query: 267 LHANTIKLFVLDEADEMLSRGFKDQ----IHDVFKILSAD-VQVILLSATMPDDVLEVSR 431
           L  + ++  VLDE D+ML  GF +Q    IH+ +K  S D  Q +L SAT P  V +V++
Sbjct: 279 LDLSKLRHVVLDEVDQMLDLGFAEQVEDIIHESYKTDSEDNPQTLLFSATCPQWVYKVAK 338

Query: 432 CFMR------DPVRILVQKEELTLE 488
            +M+      D V  + QK   T+E
Sbjct: 339 KYMKSRYEQVDLVGKMTQKAATTVE 363


>AF106680-1|AAD43033.1| 1031|Homo sapiens RNA helicase protein.
          Length = 1031

 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 34/90 (37%), Positives = 50/90 (55%), Gaps = 5/90 (5%)
 Frame = +1

Query: 1   GKTATFSISILQQI--DTSIRECQ---ALILAPTRELAQQIQKVVIALGDHLNAKCHACI 165
           GKT  F + + + I    S+ E +   A+I+ PTRELA QI K V +    L  +     
Sbjct: 421 GKTIAFLLPMFRHIMDQRSLEEGEGPLAVIMTPTRELALQIPKGVRSFKT-LGLRVVCVY 479

Query: 166 GGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
           GGT + E I +L+ G  ++V TPGR+ DM+
Sbjct: 480 GGTGISEQIAELKRGAEIIVCTPGRMIDML 509



 Score = 44.4 bits (100), Expect = 5e-04
 Identities = 23/95 (24%), Positives = 43/95 (45%)
 Frame = +3

Query: 216 CGGGHSRSCI*YDTRRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLS 395
           C  G     +  ++ R  +   +   VLDEAD M   GF+ Q+  +   +  D Q ++ S
Sbjct: 500 CTPGRMIDMLAANSGRVTNLRRVTYVVLDEADRMFDMGFEPQVMRIVDNVRPDRQTVMFS 559

Query: 396 ATMPDDVLEVSRCFMRDPVRILVQKEELTLEGIKQ 500
           AT P  +  ++R  +  P+ + V    +    ++Q
Sbjct: 560 ATFPRAMEALARRILSKPIEVQVGGRSVVCSDVEQ 594


>X52104-1|CAA36324.1|  614|Homo sapiens protein ( Human mRNA for p68
           protein. ).
          Length = 614

 Score = 54.0 bits (124), Expect = 6e-07
 Identities = 27/62 (43%), Positives = 34/62 (54%)
 Frame = +1

Query: 70  LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTPGRVYD 249
           L+LAPTRELAQQ+Q+V          K     GG      IR LE GV + + TPGR+ D
Sbjct: 171 LVLAPTRELAQQVQQVAAEYCRACRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLID 230

Query: 250 MI 255
            +
Sbjct: 231 FL 232



 Score = 49.2 bits (112), Expect = 2e-05
 Identities = 24/63 (38%), Positives = 38/63 (60%)
 Frame = +3

Query: 294 VLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRILVQKE 473
           VLDEAD ML  GF+ QI  +   +  D Q ++ SAT P +V +++  F++D + I +   
Sbjct: 246 VLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLKDYIHINIGAL 305

Query: 474 ELT 482
           EL+
Sbjct: 306 ELS 308


>X15729-1|CAA33751.1|  614|Homo sapiens protein ( Human mRNA for
           nuclear p68 protein. ).
          Length = 614

 Score = 54.0 bits (124), Expect = 6e-07
 Identities = 27/62 (43%), Positives = 34/62 (54%)
 Frame = +1

Query: 70  LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTPGRVYD 249
           L+LAPTRELAQQ+Q+V          K     GG      IR LE GV + + TPGR+ D
Sbjct: 171 LVLAPTRELAQQVQQVAAEYCRACRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLID 230

Query: 250 MI 255
            +
Sbjct: 231 FL 232



 Score = 49.2 bits (112), Expect = 2e-05
 Identities = 24/63 (38%), Positives = 38/63 (60%)
 Frame = +3

Query: 294 VLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRILVQKE 473
           VLDEAD ML  GF+ QI  +   +  D Q ++ SAT P +V +++  F++D + I +   
Sbjct: 246 VLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLKDYIHINIGAL 305

Query: 474 ELT 482
           EL+
Sbjct: 306 ELS 308


>BX571764-1|CAE11890.1|  406|Homo sapiens hypothetical protein
           protein.
          Length = 406

 Score = 54.0 bits (124), Expect = 6e-07
 Identities = 27/62 (43%), Positives = 34/62 (54%)
 Frame = +1

Query: 70  LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTPGRVYD 249
           L+LAPTRELAQQ+Q+V          K     GG      IR LE GV + + TPGR+ D
Sbjct: 171 LVLAPTRELAQQVQQVAAEYCRACRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLID 230

Query: 250 MI 255
            +
Sbjct: 231 FL 232



 Score = 49.2 bits (112), Expect = 2e-05
 Identities = 24/63 (38%), Positives = 38/63 (60%)
 Frame = +3

Query: 294 VLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRILVQKE 473
           VLDEAD ML  GF+ QI  +   +  D Q ++ SAT P +V +++  F++D + I +   
Sbjct: 246 VLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLKDYIHINIGAL 305

Query: 474 ELT 482
           EL+
Sbjct: 306 ELS 308


>BT006943-1|AAP35589.1|  614|Homo sapiens DEAD/H
           (Asp-Glu-Ala-Asp/His) box polypeptide 5 (RNA helicase,
           68kDa) protein.
          Length = 614

 Score = 54.0 bits (124), Expect = 6e-07
 Identities = 27/62 (43%), Positives = 34/62 (54%)
 Frame = +1

Query: 70  LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTPGRVYD 249
           L+LAPTRELAQQ+Q+V          K     GG      IR LE GV + + TPGR+ D
Sbjct: 171 LVLAPTRELAQQVQQVAAEYCRACRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLID 230

Query: 250 MI 255
            +
Sbjct: 231 FL 232



 Score = 49.2 bits (112), Expect = 2e-05
 Identities = 24/63 (38%), Positives = 38/63 (60%)
 Frame = +3

Query: 294 VLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRILVQKE 473
           VLDEAD ML  GF+ QI  +   +  D Q ++ SAT P +V +++  F++D + I +   
Sbjct: 246 VLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLKDYIHINIGAL 305

Query: 474 ELT 482
           EL+
Sbjct: 306 ELS 308


>BC016027-1|AAH16027.1|  614|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 5 protein.
          Length = 614

 Score = 54.0 bits (124), Expect = 6e-07
 Identities = 27/62 (43%), Positives = 34/62 (54%)
 Frame = +1

Query: 70  LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTPGRVYD 249
           L+LAPTRELAQQ+Q+V          K     GG      IR LE GV + + TPGR+ D
Sbjct: 171 LVLAPTRELAQQVQQVAAEYCRACRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLID 230

Query: 250 MI 255
            +
Sbjct: 231 FL 232



 Score = 49.2 bits (112), Expect = 2e-05
 Identities = 24/63 (38%), Positives = 38/63 (60%)
 Frame = +3

Query: 294 VLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRILVQKE 473
           VLDEAD ML  GF+ QI  +   +  D Q ++ SAT P +V +++  F++D + I +   
Sbjct: 246 VLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLKDYIHINIGAL 305

Query: 474 ELT 482
           EL+
Sbjct: 306 ELS 308


>AF015812-1|AAB84094.1|  614|Homo sapiens RNA helicase p68 protein.
          Length = 614

 Score = 54.0 bits (124), Expect = 6e-07
 Identities = 27/62 (43%), Positives = 34/62 (54%)
 Frame = +1

Query: 70  LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTPGRVYD 249
           L+LAPTRELAQQ+Q+V          K     GG      IR LE GV + + TPGR+ D
Sbjct: 171 LVLAPTRELAQQVQQVAAEYCRACRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLID 230

Query: 250 MI 255
            +
Sbjct: 231 FL 232



 Score = 49.2 bits (112), Expect = 2e-05
 Identities = 24/63 (38%), Positives = 38/63 (60%)
 Frame = +3

Query: 294 VLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRILVQKE 473
           VLDEAD ML  GF+ QI  +   +  D Q ++ SAT P +V +++  F++D + I +   
Sbjct: 246 VLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLKDYIHINIGAL 305

Query: 474 ELT 482
           EL+
Sbjct: 306 ELS 308


>AB209919-1|BAD93156.1|  457|Homo sapiens Hypothetical protein
           DKFZp686J01190 variant protein.
          Length = 457

 Score = 54.0 bits (124), Expect = 6e-07
 Identities = 27/62 (43%), Positives = 34/62 (54%)
 Frame = +1

Query: 70  LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTPGRVYD 249
           L+LAPTRELAQQ+Q+V          K     GG      IR LE GV + + TPGR+ D
Sbjct: 222 LVLAPTRELAQQVQQVAAEYCRACRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLID 281

Query: 250 MI 255
            +
Sbjct: 282 FL 283



 Score = 49.2 bits (112), Expect = 2e-05
 Identities = 24/63 (38%), Positives = 38/63 (60%)
 Frame = +3

Query: 294 VLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRILVQKE 473
           VLDEAD ML  GF+ QI  +   +  D Q ++ SAT P +V +++  F++D + I +   
Sbjct: 297 VLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLKDYIHINIGAL 356

Query: 474 ELT 482
           EL+
Sbjct: 357 ELS 359


>U50553-1|AAB95637.1|  662|Homo sapiens helicase like protein 2
           protein.
          Length = 662

 Score = 53.6 bits (123), Expect = 7e-07
 Identities = 26/63 (41%), Positives = 37/63 (58%)
 Frame = +1

Query: 67  ALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTPGRVY 246
           +L+LAPTRELA QI +           +     GG ++ + IR LE G H++V TPGR+ 
Sbjct: 269 SLVLAPTRELAVQIYEEARKFSYRSRVRPCVVYGGADIGQQIRDLERGCHLLVATPGRLV 328

Query: 247 DMI 255
           DM+
Sbjct: 329 DMM 331



 Score = 37.9 bits (84), Expect = 0.039
 Identities = 24/76 (31%), Positives = 40/76 (52%), Gaps = 4/76 (5%)
 Frame = +3

Query: 285 KLFVLDEADEMLSRGFKDQIHDVFKILSADVQ----VILLSATMPDDVLEVSRCFMRDPV 452
           K  VLDEAD ML  GF+ QI  + +  +   +     ++ SAT P ++  ++R F+ + +
Sbjct: 342 KYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLDEYI 401

Query: 453 RILVQKEELTLEGIKQ 500
            + V +   T E I Q
Sbjct: 402 FLAVGRVGSTSENITQ 417


>BC034942-1|AAH34942.1|  660|Homo sapiens DDX3Y protein protein.
          Length = 660

 Score = 53.6 bits (123), Expect = 7e-07
 Identities = 26/63 (41%), Positives = 37/63 (58%)
 Frame = +1

Query: 67  ALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTPGRVY 246
           +L+LAPTRELA QI +           +     GG ++ + IR LE G H++V TPGR+ 
Sbjct: 267 SLVLAPTRELAVQIYEEARKFSYRSRVRPCVVYGGADIGQQIRDLERGCHLLVATPGRLV 326

Query: 247 DMI 255
           DM+
Sbjct: 327 DMM 329



 Score = 37.9 bits (84), Expect = 0.039
 Identities = 24/76 (31%), Positives = 40/76 (52%), Gaps = 4/76 (5%)
 Frame = +3

Query: 285 KLFVLDEADEMLSRGFKDQIHDVFKILSADVQ----VILLSATMPDDVLEVSRCFMRDPV 452
           K  VLDEAD ML  GF+ QI  + +  +   +     ++ SAT P ++  ++R F+ + +
Sbjct: 340 KYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLDEYI 399

Query: 453 RILVQKEELTLEGIKQ 500
            + V +   T E I Q
Sbjct: 400 FLAVGRVGSTSENITQ 415


>BC011819-1|AAH11819.1|  662|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 3, X-linked protein.
          Length = 662

 Score = 53.6 bits (123), Expect = 7e-07
 Identities = 26/63 (41%), Positives = 37/63 (58%)
 Frame = +1

Query: 67  ALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTPGRVY 246
           +L+LAPTRELA QI +           +     GG ++ + IR LE G H++V TPGR+ 
Sbjct: 269 SLVLAPTRELAVQIYEEARKFSYRSRVRPCVVYGGADIGQQIRDLERGCHLLVATPGRLV 328

Query: 247 DMI 255
           DM+
Sbjct: 329 DMM 331



 Score = 37.9 bits (84), Expect = 0.039
 Identities = 24/76 (31%), Positives = 40/76 (52%), Gaps = 4/76 (5%)
 Frame = +3

Query: 285 KLFVLDEADEMLSRGFKDQIHDVFKILSADVQ----VILLSATMPDDVLEVSRCFMRDPV 452
           K  VLDEAD ML  GF+ QI  + +  +   +     ++ SAT P ++  ++R F+ + +
Sbjct: 342 KYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLDEYI 401

Query: 453 RILVQKEELTLEGIKQ 500
            + V +   T E I Q
Sbjct: 402 FLAVGRVGSTSENITQ 417


>AL391647-2|CAI41416.1|  662|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 3, X-linked protein.
          Length = 662

 Score = 53.6 bits (123), Expect = 7e-07
 Identities = 26/63 (41%), Positives = 37/63 (58%)
 Frame = +1

Query: 67  ALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTPGRVY 246
           +L+LAPTRELA QI +           +     GG ++ + IR LE G H++V TPGR+ 
Sbjct: 269 SLVLAPTRELAVQIYEEARKFSYRSRVRPCVVYGGADIGQQIRDLERGCHLLVATPGRLV 328

Query: 247 DMI 255
           DM+
Sbjct: 329 DMM 331



 Score = 37.9 bits (84), Expect = 0.039
 Identities = 24/76 (31%), Positives = 40/76 (52%), Gaps = 4/76 (5%)
 Frame = +3

Query: 285 KLFVLDEADEMLSRGFKDQIHDVFKILSADVQ----VILLSATMPDDVLEVSRCFMRDPV 452
           K  VLDEAD ML  GF+ QI  + +  +   +     ++ SAT P ++  ++R F+ + +
Sbjct: 342 KYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLDEYI 401

Query: 453 RILVQKEELTLEGIKQ 500
            + V +   T E I Q
Sbjct: 402 FLAVGRVGSTSENITQ 417


>AF061337-1|AAC34298.1|  662|Homo sapiens DEAD box RNA helicase DDX3
           protein.
          Length = 662

 Score = 53.6 bits (123), Expect = 7e-07
 Identities = 26/63 (41%), Positives = 37/63 (58%)
 Frame = +1

Query: 67  ALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTPGRVY 246
           +L+LAPTRELA QI +           +     GG ++ + IR LE G H++V TPGR+ 
Sbjct: 269 SLVLAPTRELAVQIYEEARKFSYRSRVRPCVVYGGADIGQQIRDLERGCHLLVATPGRLV 328

Query: 247 DMI 255
           DM+
Sbjct: 329 DMM 331



 Score = 37.9 bits (84), Expect = 0.039
 Identities = 24/76 (31%), Positives = 40/76 (52%), Gaps = 4/76 (5%)
 Frame = +3

Query: 285 KLFVLDEADEMLSRGFKDQIHDVFKILSADVQ----VILLSATMPDDVLEVSRCFMRDPV 452
           K  VLDEAD ML  GF+ QI  + +  +   +     ++ SAT P ++  ++R F+ + +
Sbjct: 342 KYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLDEYI 401

Query: 453 RILVQKEELTLEGIKQ 500
            + V +   T E I Q
Sbjct: 402 FLAVGRVGSTSENITQ 417


>AF000985-1|AAC51832.1|  660|Homo sapiens dead box, Y isoform
           protein.
          Length = 660

 Score = 53.6 bits (123), Expect = 7e-07
 Identities = 26/63 (41%), Positives = 37/63 (58%)
 Frame = +1

Query: 67  ALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTPGRVY 246
           +L+LAPTRELA QI +           +     GG ++ + IR LE G H++V TPGR+ 
Sbjct: 267 SLVLAPTRELAVQIYEEARKFSYRSRVRPCVVYGGADIGQQIRDLERGCHLLVATPGRLV 326

Query: 247 DMI 255
           DM+
Sbjct: 327 DMM 329



 Score = 37.9 bits (84), Expect = 0.039
 Identities = 24/76 (31%), Positives = 40/76 (52%), Gaps = 4/76 (5%)
 Frame = +3

Query: 285 KLFVLDEADEMLSRGFKDQIHDVFKILSADVQ----VILLSATMPDDVLEVSRCFMRDPV 452
           K  VLDEAD ML  GF+ QI  + +  +   +     ++ SAT P ++  ++R F+ + +
Sbjct: 340 KYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLDEYI 399

Query: 453 RILVQKEELTLEGIKQ 500
            + V +   T E I Q
Sbjct: 400 FLAVGRVGSTSENITQ 415


>AF000984-1|AAC51831.1|  660|Homo sapiens dead box, Y isoform
           protein.
          Length = 660

 Score = 53.6 bits (123), Expect = 7e-07
 Identities = 26/63 (41%), Positives = 37/63 (58%)
 Frame = +1

Query: 67  ALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTPGRVY 246
           +L+LAPTRELA QI +           +     GG ++ + IR LE G H++V TPGR+ 
Sbjct: 267 SLVLAPTRELAVQIYEEARKFSYRSRVRPCVVYGGADIGQQIRDLERGCHLLVATPGRLV 326

Query: 247 DMI 255
           DM+
Sbjct: 327 DMM 329



 Score = 37.9 bits (84), Expect = 0.039
 Identities = 24/76 (31%), Positives = 40/76 (52%), Gaps = 4/76 (5%)
 Frame = +3

Query: 285 KLFVLDEADEMLSRGFKDQIHDVFKILSADVQ----VILLSATMPDDVLEVSRCFMRDPV 452
           K  VLDEAD ML  GF+ QI  + +  +   +     ++ SAT P ++  ++R F+ + +
Sbjct: 340 KYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLDEYI 399

Query: 453 RILVQKEELTLEGIKQ 500
            + V +   T E I Q
Sbjct: 400 FLAVGRVGSTSENITQ 415


>AF000983-1|AAC51830.1|  662|Homo sapiens dead box, X isoform
           protein.
          Length = 662

 Score = 53.6 bits (123), Expect = 7e-07
 Identities = 26/63 (41%), Positives = 37/63 (58%)
 Frame = +1

Query: 67  ALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTPGRVY 246
           +L+LAPTRELA QI +           +     GG ++ + IR LE G H++V TPGR+ 
Sbjct: 269 SLVLAPTRELAVQIYEEARKFSYRSRVRPCVVYGGADIGQQIRDLERGCHLLVATPGRLV 328

Query: 247 DMI 255
           DM+
Sbjct: 329 DMM 331



 Score = 37.9 bits (84), Expect = 0.039
 Identities = 24/76 (31%), Positives = 40/76 (52%), Gaps = 4/76 (5%)
 Frame = +3

Query: 285 KLFVLDEADEMLSRGFKDQIHDVFKILSADVQ----VILLSATMPDDVLEVSRCFMRDPV 452
           K  VLDEAD ML  GF+ QI  + +  +   +     ++ SAT P ++  ++R F+ + +
Sbjct: 342 KYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLDEYI 401

Query: 453 RILVQKEELTLEGIKQ 500
            + V +   T E I Q
Sbjct: 402 FLAVGRVGSTSENITQ 417


>AF000982-1|AAC51829.1|  662|Homo sapiens dead box, X isoform
           protein.
          Length = 662

 Score = 53.6 bits (123), Expect = 7e-07
 Identities = 26/63 (41%), Positives = 37/63 (58%)
 Frame = +1

Query: 67  ALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTPGRVY 246
           +L+LAPTRELA QI +           +     GG ++ + IR LE G H++V TPGR+ 
Sbjct: 269 SLVLAPTRELAVQIYEEARKFSYRSRVRPCVVYGGADIGQQIRDLERGCHLLVATPGRLV 328

Query: 247 DMI 255
           DM+
Sbjct: 329 DMM 331



 Score = 37.9 bits (84), Expect = 0.039
 Identities = 24/76 (31%), Positives = 40/76 (52%), Gaps = 4/76 (5%)
 Frame = +3

Query: 285 KLFVLDEADEMLSRGFKDQIHDVFKILSADVQ----VILLSATMPDDVLEVSRCFMRDPV 452
           K  VLDEAD ML  GF+ QI  + +  +   +     ++ SAT P ++  ++R F+ + +
Sbjct: 342 KYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLDEYI 401

Query: 453 RILVQKEELTLEGIKQ 500
            + V +   T E I Q
Sbjct: 402 FLAVGRVGSTSENITQ 417


>AB208983-1|BAD92220.1|  674|Homo sapiens DEAD/H
           (Asp-Glu-Ala-Asp/His) box polypeptide 3 variant protein.
          Length = 674

 Score = 53.6 bits (123), Expect = 7e-07
 Identities = 26/63 (41%), Positives = 37/63 (58%)
 Frame = +1

Query: 67  ALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTPGRVY 246
           +L+LAPTRELA QI +           +     GG ++ + IR LE G H++V TPGR+ 
Sbjct: 281 SLVLAPTRELAVQIYEEARKFSYRSRVRPCVVYGGADIGQQIRDLERGCHLLVATPGRLV 340

Query: 247 DMI 255
           DM+
Sbjct: 341 DMM 343



 Score = 37.9 bits (84), Expect = 0.039
 Identities = 24/76 (31%), Positives = 40/76 (52%), Gaps = 4/76 (5%)
 Frame = +3

Query: 285 KLFVLDEADEMLSRGFKDQIHDVFKILSADVQ----VILLSATMPDDVLEVSRCFMRDPV 452
           K  VLDEAD ML  GF+ QI  + +  +   +     ++ SAT P ++  ++R F+ + +
Sbjct: 354 KYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLDEYI 413

Query: 453 RILVQKEELTLEGIKQ 500
            + V +   T E I Q
Sbjct: 414 FLAVGRVGSTSENITQ 429


>BC005848-1|AAH05848.2|  864|Homo sapiens DDX54 protein protein.
          Length = 864

 Score = 52.8 bits (121), Expect = 1e-06
 Identities = 28/83 (33%), Positives = 43/83 (51%), Gaps = 2/83 (2%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRE--CQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGT 174
           GKTA F + + +++ T   +   +ALIL+PTRELA Q  K    LG     K    +GG 
Sbjct: 128 GKTACFLLPMFERLKTHSAQTGARALILSPTRELALQTLKFTKELGKFTGLKTALILGGD 187

Query: 175 NVREDIRQLESGVHVVVGTPGRV 243
            + +    L     +++ TPGR+
Sbjct: 188 RMEDQFAALHENPDIIIATPGRL 210



 Score = 47.6 bits (108), Expect = 5e-05
 Identities = 23/78 (29%), Positives = 42/78 (53%)
 Frame = +3

Query: 264 ALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMR 443
           +L   +++  V DEAD +   GF +Q+ ++   L    Q +L SAT+P  ++E +R  + 
Sbjct: 218 SLKLQSVEYVVFDEADRLFEMGFAEQLQEIIARLPGGHQTVLFSATLPKLLVEFARAGLT 277

Query: 444 DPVRILVQKEELTLEGIK 497
           +PV I +  +    E +K
Sbjct: 278 EPVLIRLDVDTKLNEQLK 295


>AY148094-1|AAN59978.1|  865|Homo sapiens DEAD box RNA helicase DP97
           protein.
          Length = 865

 Score = 52.8 bits (121), Expect = 1e-06
 Identities = 28/83 (33%), Positives = 43/83 (51%), Gaps = 2/83 (2%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRE--CQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGT 174
           GKTA F + + +++ T   +   +ALIL+PTRELA Q  K    LG     K    +GG 
Sbjct: 129 GKTACFLLPMFERLKTHSAQTGARALILSPTRELALQTLKFTKELGKFTGLKTALILGGD 188

Query: 175 NVREDIRQLESGVHVVVGTPGRV 243
            + +    L     +++ TPGR+
Sbjct: 189 RMEDQFAALHENPDIIIATPGRL 211



 Score = 47.6 bits (108), Expect = 5e-05
 Identities = 23/78 (29%), Positives = 42/78 (53%)
 Frame = +3

Query: 264 ALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMR 443
           +L   +++  V DEAD +   GF +Q+ ++   L    Q +L SAT+P  ++E +R  + 
Sbjct: 219 SLKLQSVEYVVFDEADRLFEMGFAEQLQEIIARLPGGHQTVLFSATLPKLLVEFARAGLT 278

Query: 444 DPVRILVQKEELTLEGIK 497
           +PV I +  +    E +K
Sbjct: 279 EPVLIRLDVDTKLNEQLK 296


>AF478457-1|AAL85336.1|  882|Homo sapiens ATP-dependent RNA helicase
           protein.
          Length = 882

 Score = 52.8 bits (121), Expect = 1e-06
 Identities = 28/83 (33%), Positives = 43/83 (51%), Gaps = 2/83 (2%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRE--CQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGT 174
           GKTA F + + +++ T   +   +ALIL+PTRELA Q  K    LG     K    +GG 
Sbjct: 145 GKTACFLLPMFERLKTHSAQTGARALILSPTRELALQTLKFTKELGKFTGLKTALILGGD 204

Query: 175 NVREDIRQLESGVHVVVGTPGRV 243
            + +    L     +++ TPGR+
Sbjct: 205 RMEDQFAALHENPDIIIATPGRL 227



 Score = 47.6 bits (108), Expect = 5e-05
 Identities = 23/78 (29%), Positives = 42/78 (53%)
 Frame = +3

Query: 264 ALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMR 443
           +L   +++  V DEAD +   GF +Q+ ++   L    Q +L SAT+P  ++E +R  + 
Sbjct: 235 SLKLQSVEYVVFDEADRLFEMGFAEQLQEIIARLPGGHQTVLFSATLPKLLVEFARAGLT 294

Query: 444 DPVRILVQKEELTLEGIK 497
           +PV I +  +    E +K
Sbjct: 295 EPVLIRLDVDTKLNEQLK 312


>AK074219-1|BAB85021.1|  353|Homo sapiens protein ( Homo sapiens
           cDNA FLJ23639 fis, clone CAS11535. ).
          Length = 353

 Score = 51.6 bits (118), Expect = 3e-06
 Identities = 34/91 (37%), Positives = 51/91 (56%), Gaps = 7/91 (7%)
 Frame = +1

Query: 1   GKTATFSISILQQI---DTSIRECQ--ALILAPTRELAQQIQKVVIALGDHLNAKCHAC- 162
           GKT  F I IL+ +   +  +++ Q  A+I+ PTRELA QI +V+     H         
Sbjct: 58  GKTLAFVIPILEILLRREEKLKKSQVGAIIITPTRELAIQIDEVLSHFTKHFPEFSQILW 117

Query: 163 IGGTNVREDIRQL-ESGVHVVVGTPGRVYDM 252
           IGG N  ED+ +  + G +++V TPGR+ DM
Sbjct: 118 IGGRNPGEDVERFKQQGGNIIVATPGRLEDM 148



 Score = 45.6 bits (103), Expect = 2e-04
 Identities = 22/65 (33%), Positives = 39/65 (60%)
 Frame = +3

Query: 279 TIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRI 458
           ++ + VLDEAD +L  GF+  I+ + + L    +  L SAT   +V  + R  +R+PVR+
Sbjct: 164 SLDVLVLDEADRLLDMGFEASINTILEFLPKQRRTGLFSATRTQEVENLVRAGLRNPVRV 223

Query: 459 LVQKE 473
            V+++
Sbjct: 224 SVKEK 228


>AB001343-1|BAA20386.1|  111|Homo sapiens DDX10-NUP98 fusion protein
           type 2 protein.
          Length = 111

 Score = 51.2 bits (117), Expect = 4e-06
 Identities = 26/86 (30%), Positives = 47/86 (54%)
 Frame = +3

Query: 252 DTRRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSR 431
           D   + HA  +++ VLDEAD +L  GF D ++ V + L    Q +L SAT    V +++R
Sbjct: 15  DETVSFHATDLQMLVLDEADRILDMGFADTMNAVIENLPKKRQTLLFSATQTKSVKDLAR 74

Query: 432 CFMRDPVRILVQKEELTLEGIKQFYM 509
             +++P  + V ++    + IK+  +
Sbjct: 75  LSLKNPEYVWVHEKAKYRKSIKKLVL 100


>BX641072-1|CAE46035.1|  496|Homo sapiens hypothetical protein
           protein.
          Length = 496

 Score = 50.4 bits (115), Expect = 7e-06
 Identities = 32/99 (32%), Positives = 54/99 (54%), Gaps = 14/99 (14%)
 Frame = +1

Query: 1   GKTATFSISIL-------QQIDTSIRECQ-ALILAPTRELAQQIQKVVIALGDHLNA--- 147
           GKT  F++ ++       +++  S RE    LI+ P+RELA+Q   ++      L     
Sbjct: 104 GKTLVFTLPVIMFCLEQEKRLPFSKREGPYGLIICPSRELARQTHGILEYYCRLLQEDSS 163

Query: 148 ---KCHACIGGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
              +C  CIGG +V+E +  +  GVH++V TPGR+ D++
Sbjct: 164 PLLRCALCIGGMSVKEQMETIRHGVHMMVATPGRLMDLL 202



 Score = 44.4 bits (100), Expect = 5e-04
 Identities = 21/69 (30%), Positives = 34/69 (49%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           ++ +  +  +   LDEAD M+  GF+  I  +F       Q +L SATMP  +   ++  
Sbjct: 204 KKMVSLDICRYLALDEADRMIDMGFEGDIRTIFSYFKGQRQTLLFSATMPKKIQNFAKSA 263

Query: 438 MRDPVRILV 464
           +  PV I V
Sbjct: 264 LVKPVTINV 272


>BC030020-1|AAH30020.1|  600|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 55 protein.
          Length = 600

 Score = 50.4 bits (115), Expect = 7e-06
 Identities = 33/91 (36%), Positives = 51/91 (56%), Gaps = 7/91 (7%)
 Frame = +1

Query: 1   GKTATFSISILQQI---DTSIRECQ--ALILAPTRELAQQIQKVVIALGDHLNAKCHAC- 162
           GKT  F I IL+ +   +  +++ Q  A+I+ PTRELA QI +V+     H         
Sbjct: 58  GKTLAFVIPILEILLRREEKLKKSQVGAIIITPTRELAIQIDEVLSHFTKHFPEFSQILW 117

Query: 163 IGGTNVREDIRQL-ESGVHVVVGTPGRVYDM 252
           IGG N  ED+ +  + G +++V TPGR+ D+
Sbjct: 118 IGGRNPGEDVERFKQQGGNIIVATPGRLEDL 148



 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 22/65 (33%), Positives = 39/65 (60%)
 Frame = +3

Query: 279 TIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRI 458
           ++ + VLDEAD +L  GF+  I+ + + L    +  L SAT   +V  + R  +R+PVR+
Sbjct: 164 SLDVLVLDEADRLLDMGFEASINTILEFLPKQRRTGLFSATQTQEVENLVRAGLRNPVRV 223

Query: 459 LVQKE 473
            V+++
Sbjct: 224 SVKEK 228


>BC015476-1|AAH15476.1|  622|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 41 protein.
          Length = 622

 Score = 50.4 bits (115), Expect = 7e-06
 Identities = 32/99 (32%), Positives = 54/99 (54%), Gaps = 14/99 (14%)
 Frame = +1

Query: 1   GKTATFSISIL-------QQIDTSIRECQ-ALILAPTRELAQQIQKVVIALGDHLNA--- 147
           GKT  F++ ++       +++  S RE    LI+ P+RELA+Q   ++      L     
Sbjct: 230 GKTLVFTLPVIMFCLEQEKRLPFSKREGPYGLIICPSRELARQTHGILEYYCRLLQEDSS 289

Query: 148 ---KCHACIGGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
              +C  CIGG +V+E +  +  GVH++V TPGR+ D++
Sbjct: 290 PLLRCALCIGGMSVKEQMETIRHGVHMMVATPGRLMDLL 328



 Score = 44.4 bits (100), Expect = 5e-04
 Identities = 21/69 (30%), Positives = 34/69 (49%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           ++ +  +  +   LDEAD M+  GF+  I  +F       Q +L SATMP  +   ++  
Sbjct: 330 KKMVSLDICRYLALDEADRMIDMGFEGDIRTIFSYFKGQRQTLLFSATMPKKIQNFAKSA 389

Query: 438 MRDPVRILV 464
           +  PV I V
Sbjct: 390 LVKPVTINV 398


>AK222598-1|BAD96318.1|  622|Homo sapiens DEAD-box protein abstrakt
           variant protein.
          Length = 622

 Score = 50.4 bits (115), Expect = 7e-06
 Identities = 32/99 (32%), Positives = 54/99 (54%), Gaps = 14/99 (14%)
 Frame = +1

Query: 1   GKTATFSISIL-------QQIDTSIRECQ-ALILAPTRELAQQIQKVVIALGDHLNA--- 147
           GKT  F++ ++       +++  S RE    LI+ P+RELA+Q   ++      L     
Sbjct: 230 GKTLVFTLPVIMFCLEQEKRLPFSKREGPYGLIICPSRELARQTHGILEYYCRLLQEDSS 289

Query: 148 ---KCHACIGGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
              +C  CIGG +V+E +  +  GVH++V TPGR+ D++
Sbjct: 290 PLLRCALCIGGMSVKEQMETIRHGVHMMVATPGRLMDLL 328



 Score = 44.4 bits (100), Expect = 5e-04
 Identities = 21/69 (30%), Positives = 34/69 (49%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           ++ +  +  +   LDEAD M+  GF+  I  +F       Q +L SATMP  +   ++  
Sbjct: 330 KKMVSLDICRYLALDEADRMIDMGFEGDIRTIFSYFKGQRQTLLFSATMPKKIQNFAKSA 389

Query: 438 MRDPVRILV 464
           +  PV I V
Sbjct: 390 LVKPVTINV 398


>AK027768-1|BAB55355.1|  622|Homo sapiens protein ( Homo sapiens
           cDNA FLJ14862 fis, clone PLACE1001739, weakly similar to
           PUTATIVE ATP-DEPENDENT RNA HELICASE PL10. ).
          Length = 622

 Score = 50.4 bits (115), Expect = 7e-06
 Identities = 32/99 (32%), Positives = 54/99 (54%), Gaps = 14/99 (14%)
 Frame = +1

Query: 1   GKTATFSISIL-------QQIDTSIRECQ-ALILAPTRELAQQIQKVVIALGDHLNA--- 147
           GKT  F++ ++       +++  S RE    LI+ P+RELA+Q   ++      L     
Sbjct: 230 GKTLVFTLPVIMFCLEQEKRLPFSKREGPYGLIICPSRELARQTHGILEYYCRLLQEDSS 289

Query: 148 ---KCHACIGGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
              +C  CIGG +V+E +  +  GVH++V TPGR+ D++
Sbjct: 290 PLLRCALCIGGMSVKEQMETIRHGVHMMVATPGRLMDLL 328



 Score = 44.4 bits (100), Expect = 5e-04
 Identities = 21/69 (30%), Positives = 34/69 (49%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           ++ +  +  +   LDEAD M+  GF+  I  +F       Q +L SATMP  +   ++  
Sbjct: 330 KKMVSLDICRYLALDEADRMIDMGFEGDIRTIFSYFKGQRQTLLFSATMPKKIQNFAKSA 389

Query: 438 MRDPVRILV 464
           +  PV I V
Sbjct: 390 LVKPVTINV 398


>AK001255-1|BAA91585.1|  622|Homo sapiens protein ( Homo sapiens
           cDNA FLJ10393 fis, clone NT2RM4000191, weakly similar to
           PUTATIVE ATP-DEPENDENT RNA HELICASE PL10. ).
          Length = 622

 Score = 50.4 bits (115), Expect = 7e-06
 Identities = 32/99 (32%), Positives = 54/99 (54%), Gaps = 14/99 (14%)
 Frame = +1

Query: 1   GKTATFSISIL-------QQIDTSIRECQ-ALILAPTRELAQQIQKVVIALGDHLNA--- 147
           GKT  F++ ++       +++  S RE    LI+ P+RELA+Q   ++      L     
Sbjct: 230 GKTLVFTLPVIMFCLEQEKRLPFSKREGPYGLIICPSRELARQTHGILEYYCRLLQEDSS 289

Query: 148 ---KCHACIGGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
              +C  CIGG +V+E +  +  GVH++V TPGR+ D++
Sbjct: 290 PLLRCALCIGGMSVKEQMETIRHGVHMMVATPGRLMDLL 328



 Score = 44.4 bits (100), Expect = 5e-04
 Identities = 21/69 (30%), Positives = 34/69 (49%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           ++ +  +  +   LDEAD M+  GF+  I  +F       Q +L SATMP  +   ++  
Sbjct: 330 KKMVSLDICRYLALDEADRMIDTGFEGDIRTIFSYFKGQRQTLLFSATMPKKIQNFAKSA 389

Query: 438 MRDPVRILV 464
           +  PV I V
Sbjct: 390 LVKPVTINV 398


>AF195417-1|AAF04150.1|  621|Homo sapiens DEAD-box protein abstrakt
           protein.
          Length = 621

 Score = 50.4 bits (115), Expect = 7e-06
 Identities = 32/99 (32%), Positives = 54/99 (54%), Gaps = 14/99 (14%)
 Frame = +1

Query: 1   GKTATFSISIL-------QQIDTSIRECQ-ALILAPTRELAQQIQKVVIALGDHLNA--- 147
           GKT  F++ ++       +++  S RE    LI+ P+RELA+Q   ++      L     
Sbjct: 229 GKTLVFTLPVIMFCLEQEKRLPFSKREGPYGLIICPSRELARQTHGILEYYCRLLQEDSS 288

Query: 148 ---KCHACIGGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
              +C  CIGG +V+E +  +  GVH++V TPGR+ D++
Sbjct: 289 PLLRCALCIGGMSVKEQMETIRHGVHMMVATPGRLMDLL 327



 Score = 44.4 bits (100), Expect = 5e-04
 Identities = 21/69 (30%), Positives = 34/69 (49%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           ++ +  +  +   LDEAD M+  GF+  I  +F       Q +L SATMP  +   ++  
Sbjct: 329 KKMVSLDICRYLALDEADRMIDMGFEGDIRTIFSYFKGQRQTLLFSATMPKKIQNFAKSA 388

Query: 438 MRDPVRILV 464
           +  PV I V
Sbjct: 389 LVKPVTINV 397


>X70649-1|CAA49992.1|  740|Homo sapiens member of DEAD box protein
           family protein.
          Length = 740

 Score = 50.0 bits (114), Expect = 9e-06
 Identities = 30/82 (36%), Positives = 46/82 (56%), Gaps = 3/82 (3%)
 Frame = +1

Query: 64  QALILAPTRELAQQIQKVVIALGDHL-NAKCHAC--IGGTNVREDIRQLESGVHVVVGTP 234
           +ALI+ P+RELA+Q    +     ++ N K      IGG   R+ +  LE+GV +VVGTP
Sbjct: 288 KALIVEPSRELAEQTLNNIKQFKKYIDNPKLRELLIIGGVAARDQLSVLENGVDIVVGTP 347

Query: 235 GRVYDMILVVRFMPTPSNFLFL 300
           GR+ D++   +   +   FL L
Sbjct: 348 GRLDDLVSTGKLNLSQVRFLVL 369



 Score = 38.3 bits (85), Expect = 0.030
 Identities = 25/77 (32%), Positives = 47/77 (61%), Gaps = 7/77 (9%)
 Frame = +3

Query: 267 LHANTIKLFVLDEADEMLSRGFKD---QIHDVFKILSAD---VQVILLSATMPD-DVLEV 425
           L+ + ++  VLDEAD +LS+G+ D   ++H+    +++D   +QVI+ SAT+   DV ++
Sbjct: 359 LNLSQVRFLVLDEADGLLSQGYSDFINRMHNQIPQVTSDGKRLQVIVCSATLHSFDVKKL 418

Query: 426 SRCFMRDPVRILVQKEE 476
           S   M  P  + ++ E+
Sbjct: 419 SEKIMHFPTWVDLKGED 435


>EF418571-1|ABN70941.1|  740|Homo sapiens DEAD box polypeptide 1
           protein.
          Length = 740

 Score = 50.0 bits (114), Expect = 9e-06
 Identities = 30/82 (36%), Positives = 46/82 (56%), Gaps = 3/82 (3%)
 Frame = +1

Query: 64  QALILAPTRELAQQIQKVVIALGDHL-NAKCHAC--IGGTNVREDIRQLESGVHVVVGTP 234
           +ALI+ P+RELA+Q    +     ++ N K      IGG   R+ +  LE+GV +VVGTP
Sbjct: 288 KALIVEPSRELAEQTLNNIKQFKKYIDNPKLRELLIIGGVAARDQLSVLENGVDIVVGTP 347

Query: 235 GRVYDMILVVRFMPTPSNFLFL 300
           GR+ D++   +   +   FL L
Sbjct: 348 GRLDDLVSTGKLNLSQVRFLVL 369



 Score = 38.3 bits (85), Expect = 0.030
 Identities = 25/77 (32%), Positives = 47/77 (61%), Gaps = 7/77 (9%)
 Frame = +3

Query: 267 LHANTIKLFVLDEADEMLSRGFKD---QIHDVFKILSAD---VQVILLSATMPD-DVLEV 425
           L+ + ++  VLDEAD +LS+G+ D   ++H+    +++D   +QVI+ SAT+   DV ++
Sbjct: 359 LNLSQVRFLVLDEADGLLSQGYSDFINRMHNQIPQVTSDGKRLQVIVCSATLHSFDVKKL 418

Query: 426 SRCFMRDPVRILVQKEE 476
           S   M  P  + ++ E+
Sbjct: 419 SEKIMHFPTWVDLKGED 435


>EF418570-1|ABN70940.1|  740|Homo sapiens DEAD box polypeptide 1
           protein.
          Length = 740

 Score = 50.0 bits (114), Expect = 9e-06
 Identities = 30/82 (36%), Positives = 46/82 (56%), Gaps = 3/82 (3%)
 Frame = +1

Query: 64  QALILAPTRELAQQIQKVVIALGDHL-NAKCHAC--IGGTNVREDIRQLESGVHVVVGTP 234
           +ALI+ P+RELA+Q    +     ++ N K      IGG   R+ +  LE+GV +VVGTP
Sbjct: 288 KALIVEPSRELAEQTLNNIKQFKKYIDNPKLRELLIIGGVAARDQLSVLENGVDIVVGTP 347

Query: 235 GRVYDMILVVRFMPTPSNFLFL 300
           GR+ D++   +   +   FL L
Sbjct: 348 GRLDDLVSTGKLNLSQVRFLVL 369



 Score = 38.3 bits (85), Expect = 0.030
 Identities = 25/77 (32%), Positives = 47/77 (61%), Gaps = 7/77 (9%)
 Frame = +3

Query: 267 LHANTIKLFVLDEADEMLSRGFKD---QIHDVFKILSAD---VQVILLSATMPD-DVLEV 425
           L+ + ++  VLDEAD +LS+G+ D   ++H+    +++D   +QVI+ SAT+   DV ++
Sbjct: 359 LNLSQVRFLVLDEADGLLSQGYSDFINRMHNQIPQVTSDGKRLQVIVCSATLHSFDVKKL 418

Query: 426 SRCFMRDPVRILVQKEE 476
           S   M  P  + ++ E+
Sbjct: 419 SEKIMHFPTWVDLKGED 435


>BC093081-1|AAH93081.1|  938|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 42 protein.
          Length = 938

 Score = 50.0 bits (114), Expect = 9e-06
 Identities = 33/90 (36%), Positives = 46/90 (51%), Gaps = 5/90 (5%)
 Frame = +1

Query: 1   GKTATFS----ISILQQIDTSIRECQ-ALILAPTRELAQQIQKVVIALGDHLNAKCHACI 165
           GKTA F     I I+ Q +    +   A+I+ PTREL QQI       G   N +  A  
Sbjct: 302 GKTAAFIWPMLIHIMDQKELEPGDGPIAVIVCPTRELCQQIHAECKRFGKAYNLRSVAVY 361

Query: 166 GGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
           GG ++ E  + L+ G  +VV TPGR+ D +
Sbjct: 362 GGGSMWEQAKALQEGAEIVVCTPGRLIDHV 391



 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 20/68 (29%), Positives = 37/68 (54%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           ++A +   +   V DEAD M   GF+ Q+  +   +  D Q +L SAT    + +++R  
Sbjct: 393 KKATNLQRVSYLVFDEADRMFDMGFEYQVRSIASHVRPDRQTLLFSATFRKKIEKLARDI 452

Query: 438 MRDPVRIL 461
           + DP+R++
Sbjct: 453 LIDPIRVV 460


>BC078667-1|AAH78667.1|  919|Homo sapiens DDX42 protein protein.
          Length = 919

 Score = 50.0 bits (114), Expect = 9e-06
 Identities = 33/90 (36%), Positives = 46/90 (51%), Gaps = 5/90 (5%)
 Frame = +1

Query: 1   GKTATFS----ISILQQIDTSIRECQ-ALILAPTRELAQQIQKVVIALGDHLNAKCHACI 165
           GKTA F     I I+ Q +    +   A+I+ PTREL QQI       G   N +  A  
Sbjct: 283 GKTAAFIWPMLIHIMDQKELEPGDGPIAVIVCPTRELCQQIHAECKRFGKAYNLRSVAVY 342

Query: 166 GGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
           GG ++ E  + L+ G  +VV TPGR+ D +
Sbjct: 343 GGGSMWEQAKALQEGAEIVVCTPGRLIDHV 372



 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 20/68 (29%), Positives = 37/68 (54%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           ++A +   +   V DEAD M   GF+ Q+  +   +  D Q +L SAT    + +++R  
Sbjct: 374 KKATNLQRVSYLVFDEADRMFDMGFEYQVRSIASHVRPDRQTLLFSATFRKKIEKLARDI 433

Query: 438 MRDPVRIL 461
           + DP+R++
Sbjct: 434 LIDPIRVV 441


>BC053673-1|AAH53673.1|  740|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 1 protein.
          Length = 740

 Score = 50.0 bits (114), Expect = 9e-06
 Identities = 30/82 (36%), Positives = 46/82 (56%), Gaps = 3/82 (3%)
 Frame = +1

Query: 64  QALILAPTRELAQQIQKVVIALGDHL-NAKCHAC--IGGTNVREDIRQLESGVHVVVGTP 234
           +ALI+ P+RELA+Q    +     ++ N K      IGG   R+ +  LE+GV +VVGTP
Sbjct: 288 KALIVEPSRELAEQTLNNIKQFKKYIDNPKLRELLIIGGVAARDQLSVLENGVDIVVGTP 347

Query: 235 GRVYDMILVVRFMPTPSNFLFL 300
           GR+ D++   +   +   FL L
Sbjct: 348 GRLDDLVSTGKLNLSQVRFLVL 369



 Score = 38.3 bits (85), Expect = 0.030
 Identities = 25/77 (32%), Positives = 47/77 (61%), Gaps = 7/77 (9%)
 Frame = +3

Query: 267 LHANTIKLFVLDEADEMLSRGFKD---QIHDVFKILSAD---VQVILLSATMPD-DVLEV 425
           L+ + ++  VLDEAD +LS+G+ D   ++H+    +++D   +QVI+ SAT+   DV ++
Sbjct: 359 LNLSQVRFLVLDEADGLLSQGYSDFINRMHNQIPQVTSDGKRLQVIVCSATLHSFDVKKL 418

Query: 426 SRCFMRDPVRILVQKEE 476
           S   M  P  + ++ E+
Sbjct: 419 SEKIMHFPTWVDLKGED 435


>BC015505-1|AAH15505.1|  819|Homo sapiens DDX42 protein protein.
          Length = 819

 Score = 50.0 bits (114), Expect = 9e-06
 Identities = 33/90 (36%), Positives = 46/90 (51%), Gaps = 5/90 (5%)
 Frame = +1

Query: 1   GKTATFS----ISILQQIDTSIRECQ-ALILAPTRELAQQIQKVVIALGDHLNAKCHACI 165
           GKTA F     I I+ Q +    +   A+I+ PTREL QQI       G   N +  A  
Sbjct: 183 GKTAAFIWPMLIHIMDQKELEPGDGPIAVIVCPTRELCQQIHAECKRFGKAYNLRSVAVY 242

Query: 166 GGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
           GG ++ E  + L+ G  +VV TPGR+ D +
Sbjct: 243 GGGSMWEQAKALQEGAEIVVCTPGRLIDHV 272



 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 20/68 (29%), Positives = 37/68 (54%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           ++A +   +   V DEAD M   GF+ Q+  +   +  D Q +L SAT    + +++R  
Sbjct: 274 KKATNLQRVSYLVFDEADRMFDMGFEYQVRSIASHVRPDRQTLLFSATFRKKIEKLARDI 333

Query: 438 MRDPVRIL 461
           + DP+R++
Sbjct: 334 LIDPIRVV 341


>BC012132-1|AAH12132.1|  740|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 1 protein.
          Length = 740

 Score = 50.0 bits (114), Expect = 9e-06
 Identities = 30/82 (36%), Positives = 46/82 (56%), Gaps = 3/82 (3%)
 Frame = +1

Query: 64  QALILAPTRELAQQIQKVVIALGDHL-NAKCHAC--IGGTNVREDIRQLESGVHVVVGTP 234
           +ALI+ P+RELA+Q    +     ++ N K      IGG   R+ +  LE+GV +VVGTP
Sbjct: 288 KALIVEPSRELAEQTLNNIKQFKKYIDNPKLRELLIIGGVAARDQLSVLENGVDIVVGTP 347

Query: 235 GRVYDMILVVRFMPTPSNFLFL 300
           GR+ D++   +   +   FL L
Sbjct: 348 GRLDDLVSTGKLNLSQVRFLVL 369



 Score = 38.3 bits (85), Expect = 0.030
 Identities = 25/77 (32%), Positives = 47/77 (61%), Gaps = 7/77 (9%)
 Frame = +3

Query: 267 LHANTIKLFVLDEADEMLSRGFKD---QIHDVFKILSAD---VQVILLSATMPD-DVLEV 425
           L+ + ++  VLDEAD +LS+G+ D   ++H+    +++D   +QVI+ SAT+   DV ++
Sbjct: 359 LNLSQVRFLVLDEADGLLSQGYSDFINRMHNQIPQVTSDGKRLQVIVCSATLHSFDVKKL 418

Query: 426 SRCFMRDPVRILVQKEE 476
           S   M  P  + ++ E+
Sbjct: 419 SEKIMHFPTWVDLKGED 435


>AF083255-1|AAC32396.1|  709|Homo sapiens RNA helicase-related
           protein protein.
          Length = 709

 Score = 50.0 bits (114), Expect = 9e-06
 Identities = 33/90 (36%), Positives = 46/90 (51%), Gaps = 5/90 (5%)
 Frame = +1

Query: 1   GKTATFS----ISILQQIDTSIRECQ-ALILAPTRELAQQIQKVVIALGDHLNAKCHACI 165
           GKTA F     I I+ Q +    +   A+I+ PTREL QQI       G   N +  A  
Sbjct: 183 GKTAAFIWPMLIHIMDQKELEPGDGPIAVIVCPTRELCQQIHAECKRFGKAYNLRSVAVY 242

Query: 166 GGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
           GG ++ E  + L+ G  +VV TPGR+ D +
Sbjct: 243 GGGSMWEQAKALQEGAEIVVCTPGRLIDHV 272



 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 20/68 (29%), Positives = 37/68 (54%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           ++A +   +   V DEAD M   GF+ Q+  +   +  D Q +L SAT    + +++R  
Sbjct: 274 KKATNLQRVSYLVFDEADRMFDMGFEYQVRSIASHVRPDRQTLLFSATFRKKIEKLARDI 333

Query: 438 MRDPVRIL 461
           + DP+R++
Sbjct: 334 LIDPIRVV 341


>AB036090-1|BAC66466.1|  938|Homo sapiens RNA helicase-related
           protein protein.
          Length = 938

 Score = 50.0 bits (114), Expect = 9e-06
 Identities = 33/90 (36%), Positives = 46/90 (51%), Gaps = 5/90 (5%)
 Frame = +1

Query: 1   GKTATFS----ISILQQIDTSIRECQ-ALILAPTRELAQQIQKVVIALGDHLNAKCHACI 165
           GKTA F     I I+ Q +    +   A+I+ PTREL QQI       G   N +  A  
Sbjct: 302 GKTAAFIWPMLIHIMDQKELEPGDGPIAVIVCPTRELCQQIHAECKRFGKAYNLRSVAVY 361

Query: 166 GGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
           GG ++ E  + L+ G  +VV TPGR+ D +
Sbjct: 362 GGGSMWEQAKALQEGAEIVVCTPGRLIDHV 391



 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 20/68 (29%), Positives = 37/68 (54%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           ++A +   +   V DEAD M   GF+ Q+  +   +  D Q +L SAT    + +++R  
Sbjct: 393 KKATNLQRVSYLVFDEADRMFDMGFEYQVRSIASHVRPDRQTLLFSATFRKKIEKLARDI 452

Query: 438 MRDPVRIL 461
           + DP+R++
Sbjct: 453 LIDPIRVV 460


>BC067878-1|AAH67878.1|  631|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 53 protein.
          Length = 631

 Score = 49.6 bits (113), Expect = 1e-05
 Identities = 22/67 (32%), Positives = 41/67 (61%)
 Frame = +3

Query: 264 ALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMR 443
           +++  +I   V+DEAD+ML   F+ QI  +   +  D Q ++ SAT PD V +++  +++
Sbjct: 364 SVNLRSITYLVIDEADKMLDMEFEPQIRKILLDVRPDRQTVMTSATWPDTVRQLALSYLK 423

Query: 444 DPVRILV 464
           DP+ + V
Sbjct: 424 DPMIVYV 430



 Score = 40.3 bits (90), Expect = 0.007
 Identities = 20/61 (32%), Positives = 31/61 (50%)
 Frame = +1

Query: 70  LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTPGRVYD 249
           L+L PTRELA  ++    +   +   K     GG N    I  +  GV +++ TPGR+ D
Sbjct: 300 LVLTPTRELALHVE-AECSKYSYKGLKSICIYGGRNRNGQIEDISKGVDIIIATPGRLND 358

Query: 250 M 252
           +
Sbjct: 359 L 359


>BC051703-1|AAH51703.1|  631|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 53 protein.
          Length = 631

 Score = 49.6 bits (113), Expect = 1e-05
 Identities = 22/67 (32%), Positives = 41/67 (61%)
 Frame = +3

Query: 264 ALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMR 443
           +++  +I   V+DEAD+ML   F+ QI  +   +  D Q ++ SAT PD V +++  +++
Sbjct: 364 SVNLRSITYLVIDEADKMLDMEFEPQIRKILLDVRPDRQTVMTSATWPDTVRQLALSYLK 423

Query: 444 DPVRILV 464
           DP+ + V
Sbjct: 424 DPMIVYV 430



 Score = 40.3 bits (90), Expect = 0.007
 Identities = 20/61 (32%), Positives = 31/61 (50%)
 Frame = +1

Query: 70  LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTPGRVYD 249
           L+L PTRELA  ++    +   +   K     GG N    I  +  GV +++ TPGR+ D
Sbjct: 300 LVLTPTRELALHVE-AECSKYSYKGLKSICIYGGRNRNGQIEDISKGVDIIIATPGRLND 358

Query: 250 M 252
           +
Sbjct: 359 L 359


>AY039237-1|AAK72102.1|  630|Homo sapiens DEAD-box protein CAGE
           protein.
          Length = 630

 Score = 49.6 bits (113), Expect = 1e-05
 Identities = 22/67 (32%), Positives = 41/67 (61%)
 Frame = +3

Query: 264 ALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMR 443
           +++  +I   V+DEAD+ML   F+ QI  +   +  D Q ++ SAT PD V +++  +++
Sbjct: 364 SVNLRSITYLVIDEADKMLDMEFEPQIRKILLDVRPDRQTVMTSATWPDTVRQLALSYLK 423

Query: 444 DPVRILV 464
           DP+ + V
Sbjct: 424 DPMIVYV 430



 Score = 40.3 bits (90), Expect = 0.007
 Identities = 20/61 (32%), Positives = 31/61 (50%)
 Frame = +1

Query: 70  LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTPGRVYD 249
           L+L PTRELA  ++    +   +   K     GG N    I  +  GV +++ TPGR+ D
Sbjct: 300 LVLTPTRELALHVE-AECSKYSYKGLKSICIYGGRNRNGQIEDISKGVDIIIATPGRLND 358

Query: 250 M 252
           +
Sbjct: 359 L 359


>U28042-1|AAC50823.1|  875|Homo sapiens protein ( Human DEAD box RNA
           helicase-like protein mRNA, complete cds. ).
          Length = 875

 Score = 49.2 bits (112), Expect = 2e-05
 Identities = 24/74 (32%), Positives = 42/74 (56%)
 Frame = +3

Query: 252 DTRRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSR 431
           D   + HA  +++ VLDEAD +L  GF D ++ V + L    Q +L SAT    V +++R
Sbjct: 206 DETVSFHATDLQMLVLDEADRILDMGFADTMNAVIENLPKKRQTLLFSATQTKSVKDLAR 265

Query: 432 CFMRDPVRILVQKE 473
             +++P  + V ++
Sbjct: 266 LSLKNPEYVWVHEK 279



 Score = 45.2 bits (102), Expect = 3e-04
 Identities = 32/105 (30%), Positives = 55/105 (52%), Gaps = 5/105 (4%)
 Frame = +1

Query: 1   GKTATFSISILQQID----TSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIG 168
           GKT  F + +L+ +     TS      LI++PTRELA Q  +V+  +G + +      IG
Sbjct: 118 GKTLAFLVPVLEALYRLQWTSTDGLGVLIISPTRELAYQTFEVLRKVGKNHDFSAGLIIG 177

Query: 169 GTNVREDIRQLESGVHVVVGTPGRVYD-MILVVRFMPTPSNFLFL 300
           G +++ +  ++ + ++++V TPGR+   M   V F  T    L L
Sbjct: 178 GKDLKHEAERI-NNINILVCTPGRLLQHMDETVSFHATDLQMLVL 221


>BC093656-1|AAH93656.1|  875|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 10 protein.
          Length = 875

 Score = 49.2 bits (112), Expect = 2e-05
 Identities = 24/74 (32%), Positives = 42/74 (56%)
 Frame = +3

Query: 252 DTRRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSR 431
           D   + HA  +++ VLDEAD +L  GF D ++ V + L    Q +L SAT    V +++R
Sbjct: 206 DETVSFHATDLQMLVLDEADRILDMGFADTMNAVIENLPKKRQTLLFSATQTKSVKDLAR 265

Query: 432 CFMRDPVRILVQKE 473
             +++P  + V ++
Sbjct: 266 LSLKNPEYVWVHEK 279



 Score = 45.2 bits (102), Expect = 3e-04
 Identities = 32/105 (30%), Positives = 55/105 (52%), Gaps = 5/105 (4%)
 Frame = +1

Query: 1   GKTATFSISILQQID----TSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIG 168
           GKT  F + +L+ +     TS      LI++PTRELA Q  +V+  +G + +      IG
Sbjct: 118 GKTLAFLVPVLEALYRLQWTSTDGLGVLIISPTRELAYQTFEVLRKVGKNHDFSAGLIIG 177

Query: 169 GTNVREDIRQLESGVHVVVGTPGRVYD-MILVVRFMPTPSNFLFL 300
           G +++ +  ++ + ++++V TPGR+   M   V F  T    L L
Sbjct: 178 GKDLKHEAERI-NNINILVCTPGRLLQHMDETVSFHATDLQMLVL 221


>BC093654-1|AAH93654.1|  875|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 10 protein.
          Length = 875

 Score = 49.2 bits (112), Expect = 2e-05
 Identities = 24/74 (32%), Positives = 42/74 (56%)
 Frame = +3

Query: 252 DTRRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSR 431
           D   + HA  +++ VLDEAD +L  GF D ++ V + L    Q +L SAT    V +++R
Sbjct: 206 DETVSFHATDLQMLVLDEADRILDMGFADTMNAVIENLPKKRQTLLFSATQTKSVKDLAR 265

Query: 432 CFMRDPVRILVQKE 473
             +++P  + V ++
Sbjct: 266 LSLKNPEYVWVHEK 279



 Score = 45.2 bits (102), Expect = 3e-04
 Identities = 32/105 (30%), Positives = 55/105 (52%), Gaps = 5/105 (4%)
 Frame = +1

Query: 1   GKTATFSISILQQID----TSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIG 168
           GKT  F + +L+ +     TS      LI++PTRELA Q  +V+  +G + +      IG
Sbjct: 118 GKTLAFLVPVLEALYRLQWTSTDGLGVLIISPTRELAYQTFEVLRKVGKNHDFSAGLIIG 177

Query: 169 GTNVREDIRQLESGVHVVVGTPGRVYD-MILVVRFMPTPSNFLFL 300
           G +++ +  ++ + ++++V TPGR+   M   V F  T    L L
Sbjct: 178 GKDLKHEAERI-NNINILVCTPGRLLQHMDETVSFHATDLQMLVL 221


>BC091521-1|AAH91521.1|  875|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 10 protein.
          Length = 875

 Score = 49.2 bits (112), Expect = 2e-05
 Identities = 24/74 (32%), Positives = 42/74 (56%)
 Frame = +3

Query: 252 DTRRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSR 431
           D   + HA  +++ VLDEAD +L  GF D ++ V + L    Q +L SAT    V +++R
Sbjct: 206 DETVSFHATDLQMLVLDEADRILDMGFADTMNAVIENLPKKRQTLLFSATQTKSVKDLAR 265

Query: 432 CFMRDPVRILVQKE 473
             +++P  + V ++
Sbjct: 266 LSLKNPEYVWVHEK 279



 Score = 45.2 bits (102), Expect = 3e-04
 Identities = 32/105 (30%), Positives = 55/105 (52%), Gaps = 5/105 (4%)
 Frame = +1

Query: 1   GKTATFSISILQQID----TSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIG 168
           GKT  F + +L+ +     TS      LI++PTRELA Q  +V+  +G + +      IG
Sbjct: 118 GKTLAFLVPVLEALYRLQWTSTDGLGVLIISPTRELAYQTFEVLRKVGKNHDFSAGLIIG 177

Query: 169 GTNVREDIRQLESGVHVVVGTPGRVYD-MILVVRFMPTPSNFLFL 300
           G +++ +  ++ + ++++V TPGR+   M   V F  T    L L
Sbjct: 178 GKDLKHEAERI-NNINILVCTPGRLLQHMDETVSFHATDLQMLVL 221


>BC066938-1|AAH66938.1|  648|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 43 protein.
          Length = 648

 Score = 49.2 bits (112), Expect = 2e-05
 Identities = 25/79 (31%), Positives = 45/79 (56%), Gaps = 1/79 (1%)
 Frame = +3

Query: 267 LHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRD 446
           ++   I   VLDEAD+ML  GF+ QI  +   +  D Q ++ SAT P  V  +++ ++++
Sbjct: 385 VNLKNITYLVLDEADKMLDMGFEPQIMKILLDVRPDRQTVMTSATWPHSVHRLAQSYLKE 444

Query: 447 PVRILVQKEEL-TLEGIKQ 500
           P+ + V   +L  +  +KQ
Sbjct: 445 PMIVYVGTLDLVAVSSVKQ 463



 Score = 44.4 bits (100), Expect = 5e-04
 Identities = 22/61 (36%), Positives = 34/61 (55%)
 Frame = +1

Query: 70  LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTPGRVYD 249
           L+L PTRELA Q++        +   +     GG N  E I +L+ GV +++ TPGR+ D
Sbjct: 320 LVLTPTRELALQVEGECCKYS-YKGLRSVCVYGGGNRDEQIEELKKGVDIIIATPGRLND 378

Query: 250 M 252
           +
Sbjct: 379 L 379


>BC049217-1|AAH49217.1|  745|Homo sapiens DDX10 protein protein.
          Length = 745

 Score = 49.2 bits (112), Expect = 2e-05
 Identities = 24/74 (32%), Positives = 42/74 (56%)
 Frame = +3

Query: 252 DTRRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSR 431
           D   + HA  +++ VLDEAD +L  GF D ++ V + L    Q +L SAT    V +++R
Sbjct: 206 DETVSFHATDLQMLVLDEADRILDMGFADTMNAVIENLPKKRQTLLFSATQTKSVKDLAR 265

Query: 432 CFMRDPVRILVQKE 473
             +++P  + V ++
Sbjct: 266 LSLKNPEYVWVHEK 279



 Score = 45.2 bits (102), Expect = 3e-04
 Identities = 32/105 (30%), Positives = 55/105 (52%), Gaps = 5/105 (4%)
 Frame = +1

Query: 1   GKTATFSISILQQID----TSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIG 168
           GKT  F + +L+ +     TS      LI++PTRELA Q  +V+  +G + +      IG
Sbjct: 118 GKTLAFLVPVLEALYRLQWTSTDGLGVLIISPTRELAYQTFEVLRKVGKNHDFSAGLIIG 177

Query: 169 GTNVREDIRQLESGVHVVVGTPGRVYD-MILVVRFMPTPSNFLFL 300
           G +++ +  ++ + ++++V TPGR+   M   V F  T    L L
Sbjct: 178 GKDLKHEAERI-NNINILVCTPGRLLQHMDETVSFHATDLQMLVL 221


>AJ278110-1|CAB92442.1|  648|Homo sapiens DEAD-box protein protein.
          Length = 648

 Score = 49.2 bits (112), Expect = 2e-05
 Identities = 25/79 (31%), Positives = 45/79 (56%), Gaps = 1/79 (1%)
 Frame = +3

Query: 267 LHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRD 446
           ++   I   VLDEAD+ML  GF+ QI  +   +  D Q ++ SAT P  V  +++ ++++
Sbjct: 385 VNLKNITYLVLDEADKMLDMGFEPQIMKILLDVRPDRQTVMTSATWPHSVHRLAQSYLKE 444

Query: 447 PVRILVQKEEL-TLEGIKQ 500
           P+ + V   +L  +  +KQ
Sbjct: 445 PMIVYVGTLDLVAVSSVKQ 463



 Score = 44.4 bits (100), Expect = 5e-04
 Identities = 22/61 (36%), Positives = 34/61 (55%)
 Frame = +1

Query: 70  LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTPGRVYD 249
           L+L PTRELA Q++        +   +     GG N  E I +L+ GV +++ TPGR+ D
Sbjct: 320 LVLTPTRELALQVEGECCKYS-YKGLRSVCVYGGGNRDEQIEELKKGVDIIIATPGRLND 378

Query: 250 M 252
           +
Sbjct: 379 L 379


>AB209884-1|BAD93121.1|  845|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 10 variant protein.
          Length = 845

 Score = 49.2 bits (112), Expect = 2e-05
 Identities = 24/74 (32%), Positives = 42/74 (56%)
 Frame = +3

Query: 252 DTRRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSR 431
           D   + HA  +++ VLDEAD +L  GF D ++ V + L    Q +L SAT    V +++R
Sbjct: 216 DETVSFHATDLQMLVLDEADRILDMGFADTMNAVIENLPKKRQTLLFSATQTKSVKDLAR 275

Query: 432 CFMRDPVRILVQKE 473
             +++P  + V ++
Sbjct: 276 LSLKNPEYVWVHEK 289



 Score = 45.2 bits (102), Expect = 3e-04
 Identities = 32/105 (30%), Positives = 55/105 (52%), Gaps = 5/105 (4%)
 Frame = +1

Query: 1   GKTATFSISILQQID----TSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIG 168
           GKT  F + +L+ +     TS      LI++PTRELA Q  +V+  +G + +      IG
Sbjct: 128 GKTLAFLVPVLEALYRLQWTSTDGLGVLIISPTRELAYQTFEVLRKVGKNHDFSAGLIIG 187

Query: 169 GTNVREDIRQLESGVHVVVGTPGRVYD-MILVVRFMPTPSNFLFL 300
           G +++ +  ++ + ++++V TPGR+   M   V F  T    L L
Sbjct: 188 GKDLKHEAERI-NNINILVCTPGRLLQHMDETVSFHATDLQMLVL 231


>AB040537-1|BAB18536.1|  875|Homo sapiens RNA helicase protein.
          Length = 875

 Score = 49.2 bits (112), Expect = 2e-05
 Identities = 24/74 (32%), Positives = 42/74 (56%)
 Frame = +3

Query: 252 DTRRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSR 431
           D   + HA  +++ VLDEAD +L  GF D ++ V + L    Q +L SAT    V +++R
Sbjct: 206 DETVSFHATDLQMLVLDEADRILDMGFADTMNAVIENLPKKRQTLLFSATQTKSVKDLAR 265

Query: 432 CFMRDPVRILVQKE 473
             +++P  + V ++
Sbjct: 266 LSLKNPEYVWVHEK 279



 Score = 45.2 bits (102), Expect = 3e-04
 Identities = 32/105 (30%), Positives = 55/105 (52%), Gaps = 5/105 (4%)
 Frame = +1

Query: 1   GKTATFSISILQQID----TSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIG 168
           GKT  F + +L+ +     TS      LI++PTRELA Q  +V+  +G + +      IG
Sbjct: 118 GKTLAFLVPVLEALYRLQWTSTDGLGVLIISPTRELAYQTFEVLRKVGKNHDFSAGLIIG 177

Query: 169 GTNVREDIRQLESGVHVVVGTPGRVYD-MILVVRFMPTPSNFLFL 300
           G +++ +  ++ + ++++V TPGR+   M   V F  T    L L
Sbjct: 178 GKDLKHEAERI-NNINILVCTPGRLLQHMDETVSFHATDLQMLVL 221


>BC096826-1|AAH96826.1|  804|Homo sapiens DDX24 protein protein.
          Length = 804

 Score = 48.4 bits (110), Expect = 3e-05
 Identities = 23/67 (34%), Positives = 38/67 (56%)
 Frame = +1

Query: 55  RECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTP 234
           R    L+L PTRELA Q+++ + A+      K    +GG + ++  R L     +VV TP
Sbjct: 331 RPLLGLVLTPTRELAVQVKQHIDAVARFTGIKTAILVGGMSTQKQQRMLNRRPEIVVATP 390

Query: 235 GRVYDMI 255
           GR++++I
Sbjct: 391 GRLWELI 397


>BC009406-1|AAH09406.1|  859|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 24 protein.
          Length = 859

 Score = 48.4 bits (110), Expect = 3e-05
 Identities = 23/67 (34%), Positives = 38/67 (56%)
 Frame = +1

Query: 55  RECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTP 234
           R    L+L PTRELA Q+++ + A+      K    +GG + ++  R L     +VV TP
Sbjct: 386 RPLLGLVLTPTRELAVQVKQHIDAVARFTGIKTAILVGGMSTQKQQRMLNRRPEIVVATP 445

Query: 235 GRVYDMI 255
           GR++++I
Sbjct: 446 GRLWELI 452


>BC008847-1|AAH08847.1|  859|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 24 protein.
          Length = 859

 Score = 48.4 bits (110), Expect = 3e-05
 Identities = 23/67 (34%), Positives = 38/67 (56%)
 Frame = +1

Query: 55  RECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTP 234
           R    L+L PTRELA Q+++ + A+      K    +GG + ++  R L     +VV TP
Sbjct: 386 RPLLGLVLTPTRELAVQVKQHIDAVARFTGIKTAILVGGMSTQKQQRMLNRRPEIVVATP 445

Query: 235 GRVYDMI 255
           GR++++I
Sbjct: 446 GRLWELI 452


>AK025162-1|BAB15079.1|  859|Homo sapiens protein ( Homo sapiens
           cDNA: FLJ21509 fis, clone COL05745. ).
          Length = 859

 Score = 48.4 bits (110), Expect = 3e-05
 Identities = 23/67 (34%), Positives = 38/67 (56%)
 Frame = +1

Query: 55  RECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTP 234
           R    L+L PTRELA Q+++ + A+      K    +GG + ++  R L     +VV TP
Sbjct: 386 RPLLGLVLTPTRELAVQVKQHIDAVARFTGIKTAILVGGMSTQKQQRMLNRRPEIVVATP 445

Query: 235 GRVYDMI 255
           GR++++I
Sbjct: 446 GRLWELI 452


>AF214731-1|AAG02169.1|  859|Homo sapiens ATP-dependent RNA helicase
           protein.
          Length = 859

 Score = 48.4 bits (110), Expect = 3e-05
 Identities = 23/67 (34%), Positives = 38/67 (56%)
 Frame = +1

Query: 55  RECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTP 234
           R    L+L PTRELA Q+++ + A+      K    +GG + ++  R L     +VV TP
Sbjct: 386 RPLLGLVLTPTRELAVQVKQHIDAVARFTGIKTAILVGGMSTQKQQRMLNRRPEIVVATP 445

Query: 235 GRVYDMI 255
           GR++++I
Sbjct: 446 GRLWELI 452


>AB209382-1|BAD92619.1|  676|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 24 variant protein.
          Length = 676

 Score = 48.4 bits (110), Expect = 3e-05
 Identities = 23/67 (34%), Positives = 38/67 (56%)
 Frame = +1

Query: 55  RECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTP 234
           R    L+L PTRELA Q+++ + A+      K    +GG + ++  R L     +VV TP
Sbjct: 392 RPLLGLVLTPTRELAVQVKQHIDAVARFTGIKTAILVGGMSTQKQQRMLNRRPEIVVATP 451

Query: 235 GRVYDMI 255
           GR++++I
Sbjct: 452 GRLWELI 458


>BC088362-1|AAH88362.1|  724|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 4 protein.
          Length = 724

 Score = 47.6 bits (108), Expect = 5e-05
 Identities = 32/94 (34%), Positives = 46/94 (48%), Gaps = 9/94 (9%)
 Frame = +1

Query: 1   GKTATFSISILQQ-----IDTS----IRECQALILAPTRELAQQIQKVVIALGDHLNAKC 153
           GKTA F + IL       I  S    ++E + +I+APTREL  QI             + 
Sbjct: 337 GKTAAFLLPILAHMMHDGITASRFKELQEPECIIVAPTRELVNQIYLEARKFSFGTCVRA 396

Query: 154 HACIGGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
               GGT +   IRQ+  G +++  TPGR+ D+I
Sbjct: 397 VVIYGGTQLGHSIRQIVQGCNILCATPGRLMDII 430



 Score = 33.5 bits (73), Expect = 0.85
 Identities = 18/58 (31%), Positives = 30/58 (51%), Gaps = 4/58 (6%)
 Frame = +3

Query: 282 IKLFVLDEADEMLSRGFKDQIHDVFKI----LSADVQVILLSATMPDDVLEVSRCFMR 443
           IK  VLDEAD ML  GF  ++  +            Q ++ SAT P+++  ++  F++
Sbjct: 440 IKYLVLDEADRMLDMGFGPEMKKLISCPGMPSKEQRQTLMFSATFPEEIQRLAAEFLK 497


>AY004154-1|AAF86585.1|  724|Homo sapiens DEAD box RNA helicase
           protein.
          Length = 724

 Score = 47.6 bits (108), Expect = 5e-05
 Identities = 32/94 (34%), Positives = 46/94 (48%), Gaps = 9/94 (9%)
 Frame = +1

Query: 1   GKTATFSISILQQ-----IDTS----IRECQALILAPTRELAQQIQKVVIALGDHLNAKC 153
           GKTA F + IL       I  S    ++E + +I+APTREL  QI             + 
Sbjct: 337 GKTAAFLLPILAHMMHDGITASRFKELQEPECIIVAPTRELVNQIYLEARKFSFGTCVRA 396

Query: 154 HACIGGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
               GGT +   IRQ+  G +++  TPGR+ D+I
Sbjct: 397 VVIYGGTQLGHSIRQIVQGCNILCATPGRLMDII 430



 Score = 33.5 bits (73), Expect = 0.85
 Identities = 18/58 (31%), Positives = 30/58 (51%), Gaps = 4/58 (6%)
 Frame = +3

Query: 282 IKLFVLDEADEMLSRGFKDQIHDVFKI----LSADVQVILLSATMPDDVLEVSRCFMR 443
           IK  VLDEAD ML  GF  ++  +            Q ++ SAT P+++  ++  F++
Sbjct: 440 IKYLVLDEADRMLDMGFGPEMKKLISCPGMPSKEQRQTLMFSATFPEEIQRLAAEFLK 497


>AL137462-1|CAB70750.1|  635|Homo sapiens hypothetical protein
           protein.
          Length = 635

 Score = 47.6 bits (108), Expect = 5e-05
 Identities = 32/94 (34%), Positives = 46/94 (48%), Gaps = 9/94 (9%)
 Frame = +1

Query: 1   GKTATFSISILQQ-----IDTS----IRECQALILAPTRELAQQIQKVVIALGDHLNAKC 153
           GKTA F + IL       I  S    ++E + +I+APTREL  QI             + 
Sbjct: 248 GKTAAFLLPILAHMMHDGITASRFKELQEPECIIVAPTRELVNQIYLEARKFSFGTCVRA 307

Query: 154 HACIGGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
               GGT +   IRQ+  G +++  TPGR+ D+I
Sbjct: 308 VVIYGGTQLGHSIRQIVQGCNILCATPGRLMDII 341



 Score = 33.5 bits (73), Expect = 0.85
 Identities = 18/58 (31%), Positives = 30/58 (51%), Gaps = 4/58 (6%)
 Frame = +3

Query: 282 IKLFVLDEADEMLSRGFKDQIHDVFKI----LSADVQVILLSATMPDDVLEVSRCFMR 443
           IK  VLDEAD ML  GF  ++  +            Q ++ SAT P+++  ++  F++
Sbjct: 351 IKYLVLDEADRMLDMGFGPEMKKLISCPGMPSKEQRQTLMFSATFPEEIQRLAAEFLK 408


>AF262962-1|AAF72705.1|  724|Homo sapiens VASA protein protein.
          Length = 724

 Score = 47.6 bits (108), Expect = 5e-05
 Identities = 32/94 (34%), Positives = 46/94 (48%), Gaps = 9/94 (9%)
 Frame = +1

Query: 1   GKTATFSISILQQ-----IDTS----IRECQALILAPTRELAQQIQKVVIALGDHLNAKC 153
           GKTA F + IL       I  S    ++E + +I+APTREL  QI             + 
Sbjct: 337 GKTAAFLLPILAHMMHDGITASRFKELQEPECIIVAPTRELVNQIYLEARKFSFGTCVRA 396

Query: 154 HACIGGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
               GGT +   IRQ+  G +++  TPGR+ D+I
Sbjct: 397 VVIYGGTQLGHSIRQIVQGCNILCATPGRLMDII 430



 Score = 33.5 bits (73), Expect = 0.85
 Identities = 18/58 (31%), Positives = 30/58 (51%), Gaps = 4/58 (6%)
 Frame = +3

Query: 282 IKLFVLDEADEMLSRGFKDQIHDVFKI----LSADVQVILLSATMPDDVLEVSRCFMR 443
           IK  VLDEAD ML  GF  ++  +            Q ++ SAT P+++  ++  F++
Sbjct: 440 IKYLVLDEADRMLDMGFGPEMKKLISCPGMPSKEQRQTLMFSATFPEEIQRLAAEFLK 497


>X98743-1|CAA67295.1|  610|Homo sapiens RNA helicase protein.
          Length = 610

 Score = 46.8 bits (106), Expect = 8e-05
 Identities = 24/60 (40%), Positives = 37/60 (61%)
 Frame = +1

Query: 70  LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTPGRVYD 249
           LIL+PTRELA Q   V+  L  H        +GG+N   + ++L +G++++V TPGR+ D
Sbjct: 195 LILSPTRELAMQTFGVLKELMTHHVHTYGLIMGGSNRSAEAQKLGNGINIIVATPGRLLD 254



 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 24/79 (30%), Positives = 48/79 (60%), Gaps = 3/79 (3%)
 Frame = +3

Query: 282 IKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFM-RDPVRI 458
           ++  V+DEAD +L  GF++++  + K+L    Q +L SAT    V +++R  + ++P+ +
Sbjct: 267 LQCLVIDEADRILDVGFEEELKQIIKLLPTRRQTMLFSATQTRKVEDLARISLKKEPLYV 326

Query: 459 LV--QKEELTLEGIKQFYM 509
            V   K   T++G++Q Y+
Sbjct: 327 GVDDDKANATVDGLEQGYV 345


>CR457060-1|CAG33341.1|  610|Homo sapiens DDX18 protein.
          Length = 610

 Score = 46.8 bits (106), Expect = 8e-05
 Identities = 24/60 (40%), Positives = 37/60 (61%)
 Frame = +1

Query: 70  LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTPGRVYD 249
           LIL+PTRELA Q   V+  L  H        +GG+N   + ++L +G++++V TPGR+ D
Sbjct: 195 LILSPTRELAMQTFGVLKELMTHHVHTYGLIMGGSNRSAEAQKLGNGINIIVATPGRLLD 254



 Score = 44.8 bits (101), Expect = 3e-04
 Identities = 24/79 (30%), Positives = 47/79 (59%), Gaps = 3/79 (3%)
 Frame = +3

Query: 282 IKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFM-RDPVRI 458
           ++  V+DEAD +L  GF++++  + K+L    Q +L SAT    V +++R  + + P+ +
Sbjct: 267 LQCLVIDEADRILDVGFEEELKQIIKLLPTRRQTMLFSATQTRKVEDLARISLKKGPLYV 326

Query: 459 LV--QKEELTLEGIKQFYM 509
            V   K   T++G++Q Y+
Sbjct: 327 GVDDDKANATVDGLEQGYV 345


>BC024739-1|AAH24739.1|  670|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 18 protein.
          Length = 670

 Score = 46.8 bits (106), Expect = 8e-05
 Identities = 24/60 (40%), Positives = 37/60 (61%)
 Frame = +1

Query: 70  LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTPGRVYD 249
           LIL+PTRELA Q   V+  L  H        +GG+N   + ++L +G++++V TPGR+ D
Sbjct: 255 LILSPTRELAMQTFGVLKELMTHHVHTYGLIMGGSNRSAEAQKLGNGINIIVATPGRLLD 314



 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 24/79 (30%), Positives = 48/79 (60%), Gaps = 3/79 (3%)
 Frame = +3

Query: 282 IKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFM-RDPVRI 458
           ++  V+DEAD +L  GF++++  + K+L    Q +L SAT    V +++R  + ++P+ +
Sbjct: 327 LQCLVIDEADRILDVGFEEELKQIIKLLPTRRQTMLFSATQTRKVEDLARISLKKEPLYV 386

Query: 459 LV--QKEELTLEGIKQFYM 509
            V   K   T++G++Q Y+
Sbjct: 387 GVDDDKANATVDGLEQGYV 405


>BC003360-1|AAH03360.1|  670|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 18 protein.
          Length = 670

 Score = 46.8 bits (106), Expect = 8e-05
 Identities = 24/60 (40%), Positives = 37/60 (61%)
 Frame = +1

Query: 70  LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTPGRVYD 249
           LIL+PTRELA Q   V+  L  H        +GG+N   + ++L +G++++V TPGR+ D
Sbjct: 255 LILSPTRELAMQTFGVLKELMTHHVHTYGLIMGGSNRSAEAQKLGNGINIIVATPGRLLD 314



 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 24/79 (30%), Positives = 48/79 (60%), Gaps = 3/79 (3%)
 Frame = +3

Query: 282 IKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFM-RDPVRI 458
           ++  V+DEAD +L  GF++++  + K+L    Q +L SAT    V +++R  + ++P+ +
Sbjct: 327 LQCLVIDEADRILDVGFEEELKQIIKLLPTRRQTMLFSATQTRKVEDLARISLKKEPLYV 386

Query: 459 LV--QKEELTLEGIKQFYM 509
            V   K   T++G++Q Y+
Sbjct: 387 GVDDDKANATVDGLEQGYV 405


>BC001238-1|AAH01238.1|  670|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 18 protein.
          Length = 670

 Score = 46.8 bits (106), Expect = 8e-05
 Identities = 24/60 (40%), Positives = 37/60 (61%)
 Frame = +1

Query: 70  LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTPGRVYD 249
           LIL+PTRELA Q   V+  L  H        +GG+N   + ++L +G++++V TPGR+ D
Sbjct: 255 LILSPTRELAMQTFGVLKELMTHHVHTYGLIMGGSNRSAEAQKLGNGINIIVATPGRLLD 314



 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 24/79 (30%), Positives = 48/79 (60%), Gaps = 3/79 (3%)
 Frame = +3

Query: 282 IKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFM-RDPVRI 458
           ++  V+DEAD +L  GF++++  + K+L    Q +L SAT    V +++R  + ++P+ +
Sbjct: 327 LQCLVIDEADRILDVGFEEELKQIIKLLPTRRQTMLFSATQTRKVEDLARISLKKEPLYV 386

Query: 459 LV--QKEELTLEGIKQFYM 509
            V   K   T++G++Q Y+
Sbjct: 387 GVDDDKANATVDGLEQGYV 405


>AK001467-1|BAA91709.1|  670|Homo sapiens protein ( Homo sapiens
           cDNA FLJ10605 fis, clone NT2RP2005126, highly similar to
           H.sapiens mRNA for RNA helicase. ).
          Length = 670

 Score = 46.8 bits (106), Expect = 8e-05
 Identities = 24/60 (40%), Positives = 37/60 (61%)
 Frame = +1

Query: 70  LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTPGRVYD 249
           LIL+PTRELA Q   V+  L  H        +GG+N   + ++L +G++++V TPGR+ D
Sbjct: 255 LILSPTRELAMQTFGVLKELMTHHVHTYGLIMGGSNRSAEAQKLGNGINIIVATPGRLLD 314



 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 24/79 (30%), Positives = 48/79 (60%), Gaps = 3/79 (3%)
 Frame = +3

Query: 282 IKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFM-RDPVRI 458
           ++  V+DEAD +L  GF++++  + K+L    Q +L SAT    V +++R  + ++P+ +
Sbjct: 327 LQCLVIDEADRILDVGFEEELKQIIKLLPTRRQTMLFSATQTRKVEDLARISLKKEPLYV 386

Query: 459 LV--QKEELTLEGIKQFYM 509
            V   K   T++G++Q Y+
Sbjct: 387 GVDDDKANATVDGLEQGYV 405


>AC009404-1|AAX88947.1|  546|Homo sapiens unknown protein.
          Length = 546

 Score = 46.8 bits (106), Expect = 8e-05
 Identities = 24/60 (40%), Positives = 37/60 (61%)
 Frame = +1

Query: 70  LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTPGRVYD 249
           LIL+PTRELA Q   V+  L  H        +GG+N   + ++L +G++++V TPGR+ D
Sbjct: 131 LILSPTRELAMQTFGVLKELMTHHVHTYGLIMGGSNRSAEAQKLGNGINIIVATPGRLLD 190



 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 24/79 (30%), Positives = 48/79 (60%), Gaps = 3/79 (3%)
 Frame = +3

Query: 282 IKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFM-RDPVRI 458
           ++  V+DEAD +L  GF++++  + K+L    Q +L SAT    V +++R  + ++P+ +
Sbjct: 203 LQCLVIDEADRILDVGFEEELKQIIKLLPTRRQTMLFSATQTRKVEDLARISLKKEPLYV 262

Query: 459 LV--QKEELTLEGIKQFYM 509
            V   K   T++G++Q Y+
Sbjct: 263 GVDDDKANATVDGLEQGYV 281


>AF145022-1|AAP97274.1|  454|Homo sapiens ATP-dependent RNA helicase
           protein.
          Length = 454

 Score = 46.4 bits (105), Expect = 1e-04
 Identities = 21/61 (34%), Positives = 36/61 (59%)
 Frame = +1

Query: 73  ILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTPGRVYDM 252
           +L PTRELA Q+++ + A+      K    +GG + ++  R L     +VV TPGR++++
Sbjct: 19  VLTPTRELAVQVKQHIDAVARFTGIKTAILVGGMSTQKQQRMLNRRPEIVVATPGRLWEL 78

Query: 253 I 255
           I
Sbjct: 79  I 79


>AF134475-1|AAP97252.1|  486|Homo sapiens ATP-dependent RNA helicase
           protein.
          Length = 486

 Score = 46.4 bits (105), Expect = 1e-04
 Identities = 21/61 (34%), Positives = 36/61 (59%)
 Frame = +1

Query: 73  ILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTPGRVYDM 252
           +L PTRELA Q+++ + A+      K    +GG + ++  R L     +VV TPGR++++
Sbjct: 19  VLTPTRELAVQVKQHIDAVARFTGIKTAILVGGMSTQKQQRMLNRRPEIVVATPGRLWEL 78

Query: 253 I 255
           I
Sbjct: 79  I 79


>BC047455-1|AAH47455.1|  690|Homo sapiens DDX4 protein protein.
          Length = 690

 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 31/94 (32%), Positives = 46/94 (48%), Gaps = 9/94 (9%)
 Frame = +1

Query: 1   GKTATFSISILQQ-----IDTS----IRECQALILAPTRELAQQIQKVVIALGDHLNAKC 153
           GKTA F + IL       I  S    ++E + +I+APTREL  +I             + 
Sbjct: 303 GKTAAFLLPILAHMMHDGITASRFKELQEPECIIVAPTRELVNKIYLEARKFSFGTCVRA 362

Query: 154 HACIGGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
               GGT +   IRQ+  G +++  TPGR+ D+I
Sbjct: 363 VVIYGGTQLGHSIRQIVQGCNILCATPGRLMDII 396



 Score = 33.5 bits (73), Expect = 0.85
 Identities = 18/58 (31%), Positives = 30/58 (51%), Gaps = 4/58 (6%)
 Frame = +3

Query: 282 IKLFVLDEADEMLSRGFKDQIHDVFKI----LSADVQVILLSATMPDDVLEVSRCFMR 443
           IK  VLDEAD ML  GF  ++  +            Q ++ SAT P+++  ++  F++
Sbjct: 406 IKYLVLDEADRMLDMGFGPEMKKLISCPGMPSKEQRQTLMFSATFPEEIQRLAAEFLK 463


>AK131442-1|BAD18588.1|  267|Homo sapiens protein ( Homo sapiens
           cDNA FLJ16577 fis, clone TESTI2026647, weakly  similar
           to PROBABLE ATP-DEPENDENT RNA HELICASE DDX10. ).
          Length = 267

 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 22/65 (33%), Positives = 39/65 (60%)
 Frame = +3

Query: 279 TIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRI 458
           ++ + VLDEAD +L  GF+  I+ + + L    +  L SAT   +V  + R  +R+PVR+
Sbjct: 17  SLDVLVLDEADRLLDMGFEASINTILEFLPKQRRTGLFSATQTQEVENLVRAGLRNPVRV 76

Query: 459 LVQKE 473
            V+++
Sbjct: 77  SVKEK 81


>AK091227-1|BAC03616.1|  408|Homo sapiens protein ( Homo sapiens
           cDNA FLJ33908 fis, clone CTONG2008518, highly similar to
           DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 18. ).
          Length = 408

 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 24/79 (30%), Positives = 48/79 (60%), Gaps = 3/79 (3%)
 Frame = +3

Query: 282 IKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFM-RDPVRI 458
           ++  V+DEAD +L  GF++++  + K+L    Q +L SAT    V +++R  + ++P+ +
Sbjct: 65  LQCLVIDEADRILDVGFEEELKQIIKLLPTRRQTMLFSATQTRKVEDLARISLKKEPLYV 124

Query: 459 LV--QKEELTLEGIKQFYM 509
            V   K   T++G++Q Y+
Sbjct: 125 GVDDDKANATVDGLEQGYV 143



 Score = 32.3 bits (70), Expect = 2.0
 Identities = 11/29 (37%), Positives = 22/29 (75%)
 Frame = +1

Query: 163 IGGTNVREDIRQLESGVHVVVGTPGRVYD 249
           +GG+N   + ++L +G++++V TPGR+ D
Sbjct: 24  MGGSNRSAEAQKLGNGINIIVATPGRLLD 52


>AB046815-1|BAB13421.1|  471|Homo sapiens KIAA1595 protein protein.
          Length = 471

 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 22/65 (33%), Positives = 39/65 (60%)
 Frame = +3

Query: 279 TIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRI 458
           ++ + VLDEAD +L  GF+  I+ + + L    +  L SAT   +V  + R  +R+PVR+
Sbjct: 35  SLDVLVLDEADRLLDMGFEASINTILEFLPKQRRTGLFSATQTQEVENLVRAGLRNPVRV 94

Query: 459 LVQKE 473
            V+++
Sbjct: 95  SVKEK 99


>CR457213-1|CAG33494.1|  547|Homo sapiens DDX56 protein.
          Length = 547

 Score = 45.6 bits (103), Expect = 2e-04
 Identities = 21/68 (30%), Positives = 41/68 (60%)
 Frame = +3

Query: 276 NTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVR 455
           ++++L V+DEAD + S GF++++  +   L    Q  L+SAT  +DV  +    + +PV 
Sbjct: 158 DSLELLVVDEADLLFSFGFEEELKSLLCHLPRIYQAFLMSATFNEDVQALKELILHNPVT 217

Query: 456 ILVQKEEL 479
           + +Q+ +L
Sbjct: 218 LKLQESQL 225



 Score = 33.1 bits (72), Expect = 1.1
 Identities = 28/92 (30%), Positives = 44/92 (47%), Gaps = 11/92 (11%)
 Frame = +1

Query: 1   GKTATFSISILQQI-------DTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHA 159
           GKTA ++I +LQ +           +  + L+L PT+ELA+Q Q ++  L  +       
Sbjct: 56  GKTAAYAIPMLQLLLHRKATGPVVEQAVRGLVLVPTKELARQAQSMIQQLATYCARDVR- 114

Query: 160 CIGGTNVRED-IRQ---LESGVHVVVGTPGRV 243
            +   +  ED + Q   L     VVVGTP R+
Sbjct: 115 -VANVSAAEDSVSQRAVLMEKPDVVVGTPSRI 145


>BC001235-1|AAH01235.1|  547|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 56 protein.
          Length = 547

 Score = 45.6 bits (103), Expect = 2e-04
 Identities = 21/68 (30%), Positives = 41/68 (60%)
 Frame = +3

Query: 276 NTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVR 455
           ++++L V+DEAD + S GF++++  +   L    Q  L+SAT  +DV  +    + +PV 
Sbjct: 158 DSLELLVVDEADLLFSFGFEEELKSLLCHLPRIYQAFLMSATFNEDVQALKELILHNPVT 217

Query: 456 ILVQKEEL 479
           + +Q+ +L
Sbjct: 218 LKLQESQL 225



 Score = 33.1 bits (72), Expect = 1.1
 Identities = 28/92 (30%), Positives = 44/92 (47%), Gaps = 11/92 (11%)
 Frame = +1

Query: 1   GKTATFSISILQQI-------DTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHA 159
           GKTA ++I +LQ +           +  + L+L PT+ELA+Q Q ++  L  +       
Sbjct: 56  GKTAAYAIPMLQLLLHRKATGPVVEQAVRGLVLVPTKELARQAQSMIQQLATYCARDVR- 114

Query: 160 CIGGTNVRED-IRQ---LESGVHVVVGTPGRV 243
            +   +  ED + Q   L     VVVGTP R+
Sbjct: 115 -VANVSAAEDSVSQRAVLMEKPDVVVGTPSRI 145


>AK022774-1|BAB14238.1|  547|Homo sapiens protein ( Homo sapiens
           cDNA FLJ12712 fis, clone NT2RP1001080, weakly similar to
           PROBABLE ATP-DEPENDENT RNA HELICASE DBP9. ).
          Length = 547

 Score = 45.6 bits (103), Expect = 2e-04
 Identities = 21/68 (30%), Positives = 41/68 (60%)
 Frame = +3

Query: 276 NTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVR 455
           ++++L V+DEAD + S GF++++  +   L    Q  L+SAT  +DV  +    + +PV 
Sbjct: 158 DSLELLVVDEADLLFSFGFEEELKSLLCHLPRIYQAFLMSATFNEDVQALKELILHNPVT 217

Query: 456 ILVQKEEL 479
           + +Q+ +L
Sbjct: 218 LKLQESQL 225



 Score = 31.9 bits (69), Expect = 2.6
 Identities = 28/91 (30%), Positives = 43/91 (47%), Gaps = 11/91 (12%)
 Frame = +1

Query: 1   GKTATFSISILQQI-------DTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHA 159
           GKTA ++I +LQ +           +  + L+L PT+ELA+Q Q ++  L  +       
Sbjct: 56  GKTAAYAIPMLQLLLHRKATGPVVEQAVRGLVLVPTKELARQAQSMIQQLATYCARDVR- 114

Query: 160 CIGGTNVRED-IRQ---LESGVHVVVGTPGR 240
            +   +  ED + Q   L     VVVGTP R
Sbjct: 115 -VANVSAAEDSVSQRAVLMEKPDVVVGTPSR 144


>AJ131712-1|CAB87992.1|  547|Homo sapiens nucleolar RNA-helicase
           protein.
          Length = 547

 Score = 45.6 bits (103), Expect = 2e-04
 Identities = 21/68 (30%), Positives = 41/68 (60%)
 Frame = +3

Query: 276 NTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVR 455
           ++++L V+DEAD + S GF++++  +   L    Q  L+SAT  +DV  +    + +PV 
Sbjct: 158 DSLELLVVDEADLLFSFGFEEELKSLLCHLPRIYQAFLMSATFNEDVQALKELILHNPVT 217

Query: 456 ILVQKEEL 479
           + +Q+ +L
Sbjct: 218 LKLQESQL 225



 Score = 33.1 bits (72), Expect = 1.1
 Identities = 28/92 (30%), Positives = 44/92 (47%), Gaps = 11/92 (11%)
 Frame = +1

Query: 1   GKTATFSISILQQI-------DTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHA 159
           GKTA ++I +LQ +           +  + L+L PT+ELA+Q Q ++  L  +       
Sbjct: 56  GKTAAYAIPMLQLLLHRKATGPVVEQAVRGLVLVPTKELARQAQSMIQQLATYCARDVR- 114

Query: 160 CIGGTNVRED-IRQ---LESGVHVVVGTPGRV 243
            +   +  ED + Q   L     VVVGTP R+
Sbjct: 115 -VANVSAAEDSVSQRAVLMEKPDVVVGTPSRI 145


>AF247666-1|AAG36876.1|  547|Homo sapiens DEAD-box RNA helicase
           protein.
          Length = 547

 Score = 45.6 bits (103), Expect = 2e-04
 Identities = 21/68 (30%), Positives = 41/68 (60%)
 Frame = +3

Query: 276 NTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVR 455
           ++++L V+DEAD + S GF++++  +   L    Q  L+SAT  +DV  +    + +PV 
Sbjct: 158 DSLELLVVDEADLLFSFGFEEELKSLLCHLPRIYQAFLMSATFNEDVQALKELILHNPVT 217

Query: 456 ILVQKEEL 479
           + +Q+ +L
Sbjct: 218 LKLQESQL 225



 Score = 33.1 bits (72), Expect = 1.1
 Identities = 28/92 (30%), Positives = 44/92 (47%), Gaps = 11/92 (11%)
 Frame = +1

Query: 1   GKTATFSISILQQI-------DTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHA 159
           GKTA ++I +LQ +           +  + L+L PT+ELA+Q Q ++  L  +       
Sbjct: 56  GKTAAYAIPMLQLLLHRKATGPVVEQAVRGLVLVPTKELARQAQSMIQQLATYCARDVR- 114

Query: 160 CIGGTNVRED-IRQ---LESGVHVVVGTPGRV 243
            +   +  ED + Q   L     VVVGTP R+
Sbjct: 115 -VANVSAAEDSVSQRAVLMEKPDVVVGTPSRI 145


>AY207392-1|AAO66460.1|  101|Homo sapiens eukaryotic translation
           initiation factor 4A isoform 2-like protein protein.
          Length = 101

 Score = 44.0 bits (99), Expect = 6e-04
 Identities = 19/29 (65%), Positives = 25/29 (86%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPT 87
           GKTATF+ISILQQ++   +E QAL+LAP+
Sbjct: 72  GKTATFAISILQQLEIEFKETQALVLAPS 100


>AK222662-1|BAD96382.1|  547|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 56 variant protein.
          Length = 547

 Score = 44.0 bits (99), Expect = 6e-04
 Identities = 20/68 (29%), Positives = 40/68 (58%)
 Frame = +3

Query: 276 NTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVR 455
           ++++L V+DEAD + S GF++++  +   L    Q  L+SAT  +DV  +    + +P  
Sbjct: 158 DSLELLVVDEADLLFSFGFEEELKSLLCHLPRIYQAFLMSATFNEDVQALKELILHNPAT 217

Query: 456 ILVQKEEL 479
           + +Q+ +L
Sbjct: 218 LKLQESQL 225



 Score = 33.1 bits (72), Expect = 1.1
 Identities = 28/92 (30%), Positives = 44/92 (47%), Gaps = 11/92 (11%)
 Frame = +1

Query: 1   GKTATFSISILQQI-------DTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHA 159
           GKTA ++I +LQ +           +  + L+L PT+ELA+Q Q ++  L  +       
Sbjct: 56  GKTAAYAIPMLQLLLHRKATGPVVEQAVRGLVLVPTKELARQAQSMIQQLATYCARDVR- 114

Query: 160 CIGGTNVRED-IRQ---LESGVHVVVGTPGRV 243
            +   +  ED + Q   L     VVVGTP R+
Sbjct: 115 -VANVSAAEDSVSQRAVLMEKPDVVVGTPSRI 145


>BC012726-1|AAH12726.2|  777|Homo sapiens DDX31 protein protein.
          Length = 777

 Score = 42.7 bits (96), Expect = 0.001
 Identities = 23/69 (33%), Positives = 39/69 (56%), Gaps = 3/69 (4%)
 Frame = +3

Query: 267 LHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQV---ILLSATMPDDVLEVSRCF 437
           +H + ++  V DEAD +L  GF+  I  +   ++A+ Q    +LLSAT+ + V  ++   
Sbjct: 303 IHFSRLRWLVFDEADRILDLGFEKDITVILNAVNAECQKRQNVLLSATLTEGVTRLADIS 362

Query: 438 MRDPVRILV 464
           + DPV I V
Sbjct: 363 LHDPVSISV 371



 Score = 41.9 bits (94), Expect = 0.002
 Identities = 28/92 (30%), Positives = 44/92 (47%), Gaps = 7/92 (7%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQ------ALILAPTRELA-QQIQKVVIALGDHLNAKCHA 159
           GKT  + I ++Q +     + Q      AL+L PTRELA Q    V   L          
Sbjct: 206 GKTLAYCIPVVQSLQAMESKIQRSDGPYALVLVPTRELALQSFDTVQKLLKPFTWIVPGV 265

Query: 160 CIGGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
            +GG   + +  +L  G+++++ TPGR+ D I
Sbjct: 266 LMGGEKRKSEKARLRKGINILISTPGRLVDHI 297


>AL354735-2|CAI16565.1|  775|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 31 protein.
          Length = 775

 Score = 42.7 bits (96), Expect = 0.001
 Identities = 23/69 (33%), Positives = 39/69 (56%), Gaps = 3/69 (4%)
 Frame = +3

Query: 267 LHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQV---ILLSATMPDDVLEVSRCF 437
           +H + ++  V DEAD +L  GF+  I  +   ++A+ Q    +LLSAT+ + V  ++   
Sbjct: 377 IHFSRLRWLVFDEADRILDLGFEKDITVILNAVNAECQKRQNVLLSATLTEGVTRLADIS 436

Query: 438 MRDPVRILV 464
           + DPV I V
Sbjct: 437 LHDPVSISV 445



 Score = 41.9 bits (94), Expect = 0.002
 Identities = 28/92 (30%), Positives = 44/92 (47%), Gaps = 7/92 (7%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQ------ALILAPTRELA-QQIQKVVIALGDHLNAKCHA 159
           GKT  + I ++Q +     + Q      AL+L PTRELA Q    V   L          
Sbjct: 280 GKTLAYCIPVVQSLQAMESKIQRSDGPYALVLVPTRELALQSFDTVQKLLKPFTWIVPGV 339

Query: 160 CIGGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
            +GG   + +  +L  G+++++ TPGR+ D I
Sbjct: 340 LMGGEKRKSEKARLRKGINILISTPGRLVDHI 371


>AL354735-1|CAI16564.1|  851|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 31 protein.
          Length = 851

 Score = 42.7 bits (96), Expect = 0.001
 Identities = 23/69 (33%), Positives = 39/69 (56%), Gaps = 3/69 (4%)
 Frame = +3

Query: 267 LHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQV---ILLSATMPDDVLEVSRCF 437
           +H + ++  V DEAD +L  GF+  I  +   ++A+ Q    +LLSAT+ + V  ++   
Sbjct: 377 IHFSRLRWLVFDEADRILDLGFEKDITVILNAVNAECQKRQNVLLSATLTEGVTRLADIS 436

Query: 438 MRDPVRILV 464
           + DPV I V
Sbjct: 437 LHDPVSISV 445



 Score = 41.9 bits (94), Expect = 0.002
 Identities = 28/92 (30%), Positives = 44/92 (47%), Gaps = 7/92 (7%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQ------ALILAPTRELA-QQIQKVVIALGDHLNAKCHA 159
           GKT  + I ++Q +     + Q      AL+L PTRELA Q    V   L          
Sbjct: 280 GKTLAYCIPVVQSLQAMESKIQRSDGPYALVLVPTRELALQSFDTVQKLLKPFTWIVPGV 339

Query: 160 CIGGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
            +GG   + +  +L  G+++++ TPGR+ D I
Sbjct: 340 LMGGEKRKSEKARLRKGINILISTPGRLVDHI 371


>AL160165-3|CAH70532.1|  775|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 31 protein.
          Length = 775

 Score = 42.7 bits (96), Expect = 0.001
 Identities = 23/69 (33%), Positives = 39/69 (56%), Gaps = 3/69 (4%)
 Frame = +3

Query: 267 LHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQV---ILLSATMPDDVLEVSRCF 437
           +H + ++  V DEAD +L  GF+  I  +   ++A+ Q    +LLSAT+ + V  ++   
Sbjct: 377 IHFSRLRWLVFDEADRILDLGFEKDITVILNAVNAECQKRQNVLLSATLTEGVTRLADIS 436

Query: 438 MRDPVRILV 464
           + DPV I V
Sbjct: 437 LHDPVSISV 445



 Score = 41.9 bits (94), Expect = 0.002
 Identities = 28/92 (30%), Positives = 44/92 (47%), Gaps = 7/92 (7%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQ------ALILAPTRELA-QQIQKVVIALGDHLNAKCHA 159
           GKT  + I ++Q +     + Q      AL+L PTRELA Q    V   L          
Sbjct: 280 GKTLAYCIPVVQSLQAMESKIQRSDGPYALVLVPTRELALQSFDTVQKLLKPFTWIVPGV 339

Query: 160 CIGGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
            +GG   + +  +L  G+++++ TPGR+ D I
Sbjct: 340 LMGGEKRKSEKARLRKGINILISTPGRLVDHI 371


>AL160165-2|CAH70531.1|  851|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 31 protein.
          Length = 851

 Score = 42.7 bits (96), Expect = 0.001
 Identities = 23/69 (33%), Positives = 39/69 (56%), Gaps = 3/69 (4%)
 Frame = +3

Query: 267 LHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQV---ILLSATMPDDVLEVSRCF 437
           +H + ++  V DEAD +L  GF+  I  +   ++A+ Q    +LLSAT+ + V  ++   
Sbjct: 377 IHFSRLRWLVFDEADRILDLGFEKDITVILNAVNAECQKRQNVLLSATLTEGVTRLADIS 436

Query: 438 MRDPVRILV 464
           + DPV I V
Sbjct: 437 LHDPVSISV 445



 Score = 41.9 bits (94), Expect = 0.002
 Identities = 28/92 (30%), Positives = 44/92 (47%), Gaps = 7/92 (7%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQ------ALILAPTRELA-QQIQKVVIALGDHLNAKCHA 159
           GKT  + I ++Q +     + Q      AL+L PTRELA Q    V   L          
Sbjct: 280 GKTLAYCIPVVQSLQAMESKIQRSDGPYALVLVPTRELALQSFDTVQKLLKPFTWIVPGV 339

Query: 160 CIGGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
            +GG   + +  +L  G+++++ TPGR+ D I
Sbjct: 340 LMGGEKRKSEKARLRKGINILISTPGRLVDHI 371


>AL160165-1|CAH70530.1|  585|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 31 protein.
          Length = 585

 Score = 42.7 bits (96), Expect = 0.001
 Identities = 23/69 (33%), Positives = 39/69 (56%), Gaps = 3/69 (4%)
 Frame = +3

Query: 267 LHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQV---ILLSATMPDDVLEVSRCF 437
           +H + ++  V DEAD +L  GF+  I  +   ++A+ Q    +LLSAT+ + V  ++   
Sbjct: 377 IHFSRLRWLVFDEADRILDLGFEKDITVILNAVNAECQKRQNVLLSATLTEGVTRLADIS 436

Query: 438 MRDPVRILV 464
           + DPV I V
Sbjct: 437 LHDPVSISV 445



 Score = 41.9 bits (94), Expect = 0.002
 Identities = 28/92 (30%), Positives = 44/92 (47%), Gaps = 7/92 (7%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQ------ALILAPTRELA-QQIQKVVIALGDHLNAKCHA 159
           GKT  + I ++Q +     + Q      AL+L PTRELA Q    V   L          
Sbjct: 280 GKTLAYCIPVVQSLQAMESKIQRSDGPYALVLVPTRELALQSFDTVQKLLKPFTWIVPGV 339

Query: 160 CIGGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
            +GG   + +  +L  G+++++ TPGR+ D I
Sbjct: 340 LMGGEKRKSEKARLRKGINILISTPGRLVDHI 371


>AK027484-1|BAB55146.1|  585|Homo sapiens protein ( Homo sapiens
           cDNA FLJ14578 fis, clone NT2RM4001178, weakly similar to
           PROBABLE ATP-DEPENDENT RNA HELICASE HAS1. ).
          Length = 585

 Score = 42.7 bits (96), Expect = 0.001
 Identities = 23/69 (33%), Positives = 39/69 (56%), Gaps = 3/69 (4%)
 Frame = +3

Query: 267 LHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQV---ILLSATMPDDVLEVSRCF 437
           +H + ++  V DEAD +L  GF+  I  +   ++A+ Q    +LLSAT+ + V  ++   
Sbjct: 377 IHFSRLRWLVFDEADRILDLGFEKDITVILNAVNAECQKRQNVLLSATLTEGVTRLADIS 436

Query: 438 MRDPVRILV 464
           + DPV I V
Sbjct: 437 LHDPVSISV 445



 Score = 41.9 bits (94), Expect = 0.002
 Identities = 28/92 (30%), Positives = 44/92 (47%), Gaps = 7/92 (7%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQ------ALILAPTRELA-QQIQKVVIALGDHLNAKCHA 159
           GKT  + I ++Q +     + Q      AL+L PTRELA Q    V   L          
Sbjct: 280 GKTLAYCIPVVQSLQAMESKIQRSDGPYALVLVPTRELALQSFDTVQKLLKPFTWIVPGV 339

Query: 160 CIGGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
            +GG   + +  +L  G+++++ TPGR+ D I
Sbjct: 340 LMGGEKRKSEKARLRKGINILISTPGRLVDHI 371


>AK023695-1|BAB14644.1|  556|Homo sapiens protein ( Homo sapiens
           cDNA FLJ13633 fis, clone PLACE1011114, weakly similar to
           PROBABLE ATP-DEPENDENT RNA HELICASE HAS1. ).
          Length = 556

 Score = 42.7 bits (96), Expect = 0.001
 Identities = 23/69 (33%), Positives = 39/69 (56%), Gaps = 3/69 (4%)
 Frame = +3

Query: 267 LHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQV---ILLSATMPDDVLEVSRCF 437
           +H + ++  V DEAD +L  GF+  I  +   ++A+ Q    +LLSAT+ + V  ++   
Sbjct: 82  IHFSRLRWLVFDEADRILDLGFEKDITVILNAVNAECQKRQNVLLSATLTEGVTRLADIS 141

Query: 438 MRDPVRILV 464
           + DPV I V
Sbjct: 142 LHDPVSISV 150



 Score = 37.9 bits (84), Expect = 0.039
 Identities = 22/64 (34%), Positives = 33/64 (51%), Gaps = 1/64 (1%)
 Frame = +1

Query: 67  ALILAPTRELA-QQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTPGRV 243
           AL+L PTRELA Q    V   L           +GG   + +  +L  G+++++ TPGR+
Sbjct: 13  ALVLVPTRELALQSFDTVQKLLKPFTWIVPGVLMGGEKRKSEKARLRKGINILISTPGRL 72

Query: 244 YDMI 255
            D I
Sbjct: 73  VDHI 76


>AF427339-1|AAL26549.1|  851|Homo sapiens DEAD/DEXH helicase DDX31
           protein.
          Length = 851

 Score = 42.7 bits (96), Expect = 0.001
 Identities = 23/69 (33%), Positives = 39/69 (56%), Gaps = 3/69 (4%)
 Frame = +3

Query: 267 LHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQV---ILLSATMPDDVLEVSRCF 437
           +H + ++  V DEAD +L  GF+  I  +   ++A+ Q    +LLSAT+ + V  ++   
Sbjct: 377 IHFSRLRWLVFDEADRILDLGFEKDITVILNAVNAECQKRQNVLLSATLTEGVTRLADIS 436

Query: 438 MRDPVRILV 464
           + DPV I V
Sbjct: 437 LHDPVSISV 445



 Score = 41.9 bits (94), Expect = 0.002
 Identities = 28/92 (30%), Positives = 44/92 (47%), Gaps = 7/92 (7%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQ------ALILAPTRELA-QQIQKVVIALGDHLNAKCHA 159
           GKT  + I ++Q +     + Q      AL+L PTRELA Q    V   L          
Sbjct: 280 GKTLAYCIPVVQSLQAMESKIQRSDGPYALVLVPTRELALQSFDTVQKLLKPFTWIVPGV 339

Query: 160 CIGGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
            +GG   + +  +L  G+++++ TPGR+ D I
Sbjct: 340 LMGGEKRKSEKARLRKGINILISTPGRLVDHI 371


>AF335569-1|AAQ14890.1|  758|Homo sapiens helicain C protein.
          Length = 758

 Score = 42.7 bits (96), Expect = 0.001
 Identities = 23/69 (33%), Positives = 39/69 (56%), Gaps = 3/69 (4%)
 Frame = +3

Query: 267 LHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQV---ILLSATMPDDVLEVSRCF 437
           +H + ++  V DEAD +L  GF+  I  +   ++A+ Q    +LLSAT+ + V  ++   
Sbjct: 377 IHFSRLRWLVFDEADRILDLGFEKDITVILNAVNAECQKRQNVLLSATLTEGVTRLADIS 436

Query: 438 MRDPVRILV 464
           + DPV I V
Sbjct: 437 LHDPVSISV 445



 Score = 41.9 bits (94), Expect = 0.002
 Identities = 28/92 (30%), Positives = 44/92 (47%), Gaps = 7/92 (7%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQ------ALILAPTRELA-QQIQKVVIALGDHLNAKCHA 159
           GKT  + I ++Q +     + Q      AL+L PTRELA Q    V   L          
Sbjct: 280 GKTLAYCIPVVQSLQAMESKIQRSDGPYALVLVPTRELALQSFDTVQKLLKPFTWIVPGV 339

Query: 160 CIGGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
            +GG   + +  +L  G+++++ TPGR+ D I
Sbjct: 340 LMGGEKRKSEKARLRKGINILISTPGRLVDHI 371


>AF335568-1|AAQ14889.1|  851|Homo sapiens helicain B protein.
          Length = 851

 Score = 42.7 bits (96), Expect = 0.001
 Identities = 23/69 (33%), Positives = 39/69 (56%), Gaps = 3/69 (4%)
 Frame = +3

Query: 267 LHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQV---ILLSATMPDDVLEVSRCF 437
           +H + ++  V DEAD +L  GF+  I  +   ++A+ Q    +LLSAT+ + V  ++   
Sbjct: 377 IHFSRLRWLVFDEADRILDLGFEKDITVILNAVNAECQKRQNVLLSATLTEGVTRLADIS 436

Query: 438 MRDPVRILV 464
           + DPV I V
Sbjct: 437 LHDPVSISV 445



 Score = 41.9 bits (94), Expect = 0.002
 Identities = 28/92 (30%), Positives = 44/92 (47%), Gaps = 7/92 (7%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQ------ALILAPTRELA-QQIQKVVIALGDHLNAKCHA 159
           GKT  + I ++Q +     + Q      AL+L PTRELA Q    V   L          
Sbjct: 280 GKTLAYCIPVVQSLQAMESKIQRSDGPYALVLVPTRELALQSFDTVQKLLKPFTWIVPGV 339

Query: 160 CIGGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
            +GG   + +  +L  G+++++ TPGR+ D I
Sbjct: 340 LMGGEKRKSEKARLRKGINILISTPGRLVDHI 371


>BX248516-15|CAM25884.1|  187|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 187

 Score = 42.3 bits (95), Expect = 0.002
 Identities = 22/64 (34%), Positives = 35/64 (54%), Gaps = 1/64 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTN 177
           GKTA F ++ LQQ++    +   L++  TRELA QI K       ++ N K     GG +
Sbjct: 117 GKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLS 176

Query: 178 VRED 189
           +++D
Sbjct: 177 IKKD 180


>BX001040-10|CAI18638.1|  187|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 187

 Score = 42.3 bits (95), Expect = 0.002
 Identities = 22/64 (34%), Positives = 35/64 (54%), Gaps = 1/64 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTN 177
           GKTA F ++ LQQ++    +   L++  TRELA QI K       ++ N K     GG +
Sbjct: 117 GKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLS 176

Query: 178 VRED 189
           +++D
Sbjct: 177 IKKD 180


>AL662847-32|CAO72093.1|  187|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 187

 Score = 42.3 bits (95), Expect = 0.002
 Identities = 22/64 (34%), Positives = 35/64 (54%), Gaps = 1/64 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTN 177
           GKTA F ++ LQQ++    +   L++  TRELA QI K       ++ N K     GG +
Sbjct: 117 GKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLS 176

Query: 178 VRED 189
           +++D
Sbjct: 177 IKKD 180


>AL662801-15|CAM25579.1|  187|Homo sapiens HLA-B associated
           transcript 1 protein.
          Length = 187

 Score = 42.3 bits (95), Expect = 0.002
 Identities = 22/64 (34%), Positives = 35/64 (54%), Gaps = 1/64 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTN 177
           GKTA F ++ LQQ++    +   L++  TRELA QI K       ++ N K     GG +
Sbjct: 117 GKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLS 176

Query: 178 VRED 189
           +++D
Sbjct: 177 IKKD 180


>BC041785-1|AAH41785.1|  599|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 52 protein.
          Length = 599

 Score = 41.9 bits (94), Expect = 0.002
 Identities = 22/53 (41%), Positives = 32/53 (60%), Gaps = 1/53 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRE-CQALILAPTRELAQQIQKVVIALGDHLNAKCH 156
           GKT  FSI IL Q+     +  +ALI++PTRELA QI + +I + +    + H
Sbjct: 214 GKTLAFSIPILMQLKQPANKGFRALIISPTRELASQIHRELIKISEGTGFRIH 266


>AL445483-3|CAI17051.1|  205|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 59 protein.
          Length = 205

 Score = 41.9 bits (94), Expect = 0.002
 Identities = 17/60 (28%), Positives = 36/60 (60%)
 Frame = +3

Query: 330 FKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRILVQKEELTLEGIKQFYM 509
           F+ Q+ D+ + +  D Q IL+SAT+P  + +++   + +PVRI+  ++ L    ++Q  +
Sbjct: 1   FQQQVLDILENIPNDCQTILVSATIPTSIEQLASQLLHNPVRIITGEKNLPCANVRQIIL 60


>AK093661-1|BAC04214.1|  360|Homo sapiens protein ( Homo sapiens
           cDNA FLJ36342 fis, clone THYMU2006666, highly similar to
           Homo sapiens putative ATP-dependent RNA helicase ROK1
           mRNA. ).
          Length = 360

 Score = 41.9 bits (94), Expect = 0.002
 Identities = 22/53 (41%), Positives = 32/53 (60%), Gaps = 1/53 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRE-CQALILAPTRELAQQIQKVVIALGDHLNAKCH 156
           GKT  FSI IL Q+     +  +ALI++PTRELA QI + +I + +    + H
Sbjct: 106 GKTLAFSIPILMQLKQPANKGFRALIISPTRELASQIHRELIKISEGTGFRIH 158


>AK027002-1|BAB15620.1|  674|Homo sapiens protein ( Homo sapiens
           cDNA: FLJ23349 fis, clone HEP13913. ).
          Length = 674

 Score = 41.9 bits (94), Expect = 0.002
 Identities = 28/92 (30%), Positives = 44/92 (47%), Gaps = 7/92 (7%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQ------ALILAPTRELA-QQIQKVVIALGDHLNAKCHA 159
           GKT  + I ++Q +     + Q      AL+L PTRELA Q    V   L          
Sbjct: 103 GKTLAYCIPVVQSLQAMESKIQRSDGPYALVLVPTRELALQSFDTVQKLLKPFTWIVPGV 162

Query: 160 CIGGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
            +GG   + +  +L  G+++++ TPGR+ D I
Sbjct: 163 LMGGEKRKSEKARLRKGINILISTPGRLVDHI 194



 Score = 41.1 bits (92), Expect = 0.004
 Identities = 23/69 (33%), Positives = 39/69 (56%), Gaps = 3/69 (4%)
 Frame = +3

Query: 267 LHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQV---ILLSATMPDDVLEVSRCF 437
           +H + ++  V DEAD +L  GF+  I  +   ++A+ Q    +LLSAT+ + V  ++   
Sbjct: 200 IHFSRLRWLVFDEADRILDLGFEKDITVIPNAVNAECQKRQNVLLSATLTEGVTRLADIS 259

Query: 438 MRDPVRILV 464
           + DPV I V
Sbjct: 260 LHDPVSISV 268


>AK001652-1|BAA91812.1|  491|Homo sapiens protein ( Homo sapiens
           cDNA FLJ10790 fis, clone NT2RP4000518, weakly similar to
           ATP-DEPENDENT RNA HELICASE ROK1. ).
          Length = 491

 Score = 41.9 bits (94), Expect = 0.002
 Identities = 22/53 (41%), Positives = 32/53 (60%), Gaps = 1/53 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRE-CQALILAPTRELAQQIQKVVIALGDHLNAKCH 156
           GKT  FSI IL Q+     +  +ALI++PTRELA QI + +I + +    + H
Sbjct: 106 GKTLAFSIPILMQLKQPANKGFRALIISPTRELASQIHRELIKISEGTGFRIH 158


>AJ010840-1|CAA09374.1|  420|Homo sapiens ATP-dependent RNA helicase
           protein.
          Length = 420

 Score = 41.9 bits (94), Expect = 0.002
 Identities = 22/53 (41%), Positives = 32/53 (60%), Gaps = 1/53 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRE-CQALILAPTRELAQQIQKVVIALGDHLNAKCH 156
           GKT  FSI IL Q+     +  +ALI++PTRELA QI + +I + +    + H
Sbjct: 35  GKTLAFSIPILMQLKQPANKGFRALIISPTRELASQIHRELIKISEGTGFRIH 87


>AB208938-1|BAD92175.1|  512|Homo sapiens ATP-dependent RNA helicase
           ROK1 isoform a variant protein.
          Length = 512

 Score = 41.9 bits (94), Expect = 0.002
 Identities = 22/53 (41%), Positives = 32/53 (60%), Gaps = 1/53 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRE-CQALILAPTRELAQQIQKVVIALGDHLNAKCH 156
           GKT  FSI IL Q+     +  +ALI++PTRELA QI + +I + +    + H
Sbjct: 213 GKTLAFSIPILMQLKQPANKGFRALIISPTRELASQIHRELIKISEGTGFRIH 265


>AB000267-1|BAA20379.1|  124|Homo sapiens NUP98-DDX10 fusion protein
           type 1 protein.
          Length = 124

 Score = 41.9 bits (94), Expect = 0.002
 Identities = 21/60 (35%), Positives = 35/60 (58%)
 Frame = +3

Query: 294 VLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRILVQKE 473
           VLDEAD +L  GF D ++ V + L    Q +L SAT    V +++R  +++P  + V ++
Sbjct: 45  VLDEADRILDMGFADTMNAVIENLPKKRQTLLFSATQTKSVKDLARLSLKNPEYVWVHEK 104


>BC000210-1|AAH00210.1|  467|Homo sapiens DDX50 protein protein.
          Length = 467

 Score = 41.5 bits (93), Expect = 0.003
 Identities = 31/85 (36%), Positives = 46/85 (54%), Gaps = 11/85 (12%)
 Frame = +3

Query: 267 LHANTIKLFVLDEADEMLSRGFKDQ----IHDVFKILSAD-VQVILLSATMPDDVLEVSR 431
           L  + ++  VLDE D+ML  GF +Q    IH+ +K  S D  Q +L SAT P  V +V++
Sbjct: 9   LDLSKLRHVVLDEVDQMLDLGFAEQVEDIIHESYKTDSEDNPQTLLFSATCPQWVYKVAK 68

Query: 432 CFMR------DPVRILVQKEELTLE 488
            +M+      D V  + QK   T+E
Sbjct: 69  KYMKSRYEQVDLVGKMTQKAATTVE 93


>BC024273-1|AAH24273.1|  540|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 28 protein.
          Length = 540

 Score = 40.3 bits (90), Expect = 0.007
 Identities = 29/91 (31%), Positives = 45/91 (49%), Gaps = 9/91 (9%)
 Frame = +1

Query: 1   GKTATFSISILQQI-------DTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHA 159
           GKT ++ + +LQ++          I   + L+L P+RELAQQ++ V   LG  L      
Sbjct: 177 GKTLSYLLPLLQRLLGQPSLDSLPIPAPRGLVLVPSRELAQQVRAVAQPLGRSLGLLVRD 236

Query: 160 CIGGTNVREDIRQL--ESGVHVVVGTPGRVY 246
             GG  +R    QL  +    V+V TPG ++
Sbjct: 237 LEGGHGMRRIRLQLSRQPSADVLVATPGALW 267


>AK002144-1|BAA92106.1|  540|Homo sapiens protein ( Homo sapiens
           cDNA FLJ11282 fis, clone PLACE1009476, weakly similar to
           PUTATIVE ATP-DEPENDENT RNA HELICASE T26G10.1 IN
           CHROMOSOME III. ).
          Length = 540

 Score = 40.3 bits (90), Expect = 0.007
 Identities = 29/91 (31%), Positives = 45/91 (49%), Gaps = 9/91 (9%)
 Frame = +1

Query: 1   GKTATFSISILQQI-------DTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHA 159
           GKT ++ + +LQ++          I   + L+L P+RELAQQ++ V   LG  L      
Sbjct: 177 GKTLSYLLPLLQRLLGQPSLDSLPIPAPRGLVLVPSRELAQQVRAVAQPLGRSLGLLVRD 236

Query: 160 CIGGTNVREDIRQL--ESGVHVVVGTPGRVY 246
             GG  +R    QL  +    V+V TPG ++
Sbjct: 237 LEGGHGMRRIRLQLSRQPSADVLVATPGALW 267


>AF329821-1|AAG59833.1|  540|Homo sapiens putative DEAD-box helicase
           MDDX28 protein.
          Length = 540

 Score = 40.3 bits (90), Expect = 0.007
 Identities = 29/91 (31%), Positives = 45/91 (49%), Gaps = 9/91 (9%)
 Frame = +1

Query: 1   GKTATFSISILQQI-------DTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHA 159
           GKT ++ + +LQ++          I   + L+L P+RELAQQ++ V   LG  L      
Sbjct: 177 GKTLSYLLPLLQRLLGQPSLDSLPIPAPRGLVLVPSRELAQQVRAVAQPLGRSLGLLVRD 236

Query: 160 CIGGTNVREDIRQL--ESGVHVVVGTPGRVY 246
             GG  +R    QL  +    V+V TPG ++
Sbjct: 237 LEGGHGMRRIRLQLSRQPSADVLVATPGALW 267


>AK097078-1|BAC04942.1|  666|Homo sapiens protein ( Homo sapiens
           cDNA FLJ39759 fis, clone SMINT2019153, weakly similar to
           ATP-DEPENDENT RNA HELICASE DBP73D. ).
          Length = 666

 Score = 39.9 bits (89), Expect = 0.010
 Identities = 30/94 (31%), Positives = 47/94 (50%), Gaps = 9/94 (9%)
 Frame = +1

Query: 1   GKTATFSISILQQI-DTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTN 177
           GKT  F I ++Q +    +   +AL++ PT+ELAQQ+ KV     D    +     G  +
Sbjct: 261 GKTLAFVIPVVQALLSRVVCHIRALVVLPTKELAQQVSKVFNIYTDATPLRVSLVTGQKS 320

Query: 178 -VRED---IRQLESG----VHVVVGTPGRVYDMI 255
            V+E    +++   G      +VV TPGR+ D I
Sbjct: 321 LVKEQESLVQKTADGYRCLADIVVATPGRLVDHI 354


>BC040185-1|AAH40185.1|  666|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 51 protein.
          Length = 666

 Score = 38.7 bits (86), Expect = 0.023
 Identities = 27/94 (28%), Positives = 47/94 (50%), Gaps = 9/94 (9%)
 Frame = +1

Query: 1   GKTATFSISILQQI-DTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTN 177
           GKT  F I ++Q +    +   +AL++ PT+ELA+Q+ KV     D    +     G  +
Sbjct: 261 GKTLAFVIPVVQALLSRVVCHIRALVVLPTKELARQVSKVFNIYTDATPLRVSLVTGQKS 320

Query: 178 VRED----IRQLESG----VHVVVGTPGRVYDMI 255
           + ++    +++   G      +VV TPGR+ D I
Sbjct: 321 LAKEQESLVQKTADGYRCLADIVVATPGRLVDHI 354


>AY776161-1|AAV52794.1|  362|Homo sapiens unknown protein.
          Length = 362

 Score = 38.7 bits (86), Expect = 0.023
 Identities = 15/30 (50%), Positives = 22/30 (73%)
 Frame = +1

Query: 166 GGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
           GG ++ + IR LE G H++V TPGR+ DM+
Sbjct: 19  GGADIGQQIRDLERGCHLLVATPGRLADMM 48



 Score = 37.9 bits (84), Expect = 0.039
 Identities = 24/76 (31%), Positives = 40/76 (52%), Gaps = 4/76 (5%)
 Frame = +3

Query: 285 KLFVLDEADEMLSRGFKDQIHDVFKILSADVQ----VILLSATMPDDVLEVSRCFMRDPV 452
           K  VLDEAD ML  GF+ QI  + +  +   +     ++ SAT P ++  ++R F+ + +
Sbjct: 59  KYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLDEYI 118

Query: 453 RILVQKEELTLEGIKQ 500
            + V +   T E I Q
Sbjct: 119 FLAVGRVGSTSENITQ 134


>AK131260-1|BAD18438.1|  528|Homo sapiens protein ( Homo sapiens
           cDNA FLJ16192 fis, clone BRTHA2017364, weakly  similar
           to ATP-DEPENDENT RNA HELICASE T26G10.1 IN CHROMOSOME
           III. ).
          Length = 528

 Score = 38.3 bits (85), Expect = 0.030
 Identities = 22/65 (33%), Positives = 33/65 (50%), Gaps = 1/65 (1%)
 Frame = +1

Query: 64  QALILAPTRELAQQIQKVVIALG-DHLNAKCHACIGGTNVREDIRQLESGVHVVVGTPGR 240
           + L+LAPT ELA Q+     +L    +  K     GG   +  +  L+ GV V++ TPGR
Sbjct: 204 RVLVLAPTAELASQVLDNCRSLSKSGVPFKSMVVTGGFRQKTQLENLQQGVDVLIATPGR 263

Query: 241 VYDMI 255
              +I
Sbjct: 264 FLFLI 268


>BC000979-1|AAH00979.2|  254|Homo sapiens DDX49 protein protein.
          Length = 254

 Score = 37.9 bits (84), Expect = 0.039
 Identities = 26/79 (32%), Positives = 39/79 (49%), Gaps = 3/79 (3%)
 Frame = +3

Query: 282 IKLFVLDEADEMLSRGFKDQIHDVFKILS---ADVQVILLSATMPDDVLEVSRCFMRDPV 452
           I+  V+DEAD +L +G  D   D+  IL+   A  Q +L SAT+ D + E+       P 
Sbjct: 39  IRFLVMDEADRLLEQGCTDFTVDLEAILAAVPARRQTLLFSATLTDTLRELQGLATNQPF 98

Query: 453 RILVQKEELTLEGIKQFYM 509
               Q    T+E + Q Y+
Sbjct: 99  FWEAQAPVSTVEQLDQRYL 117


>BC039826-1|AAH39826.1|  187|Homo sapiens DDX6 protein protein.
          Length = 187

 Score = 37.1 bits (82), Expect = 0.069
 Identities = 14/39 (35%), Positives = 26/39 (66%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKV 117
           GK+  + I +L+++D      QA+++ PTRELA Q+ ++
Sbjct: 145 GKSGAYLIPLLERLDLKKDNIQAMVIVPTRELALQVSQI 183


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 125,685,812
Number of Sequences: 237096
Number of extensions: 2977792
Number of successful extensions: 7240
Number of sequences better than 10.0: 269
Number of HSP's better than 10.0 without gapping: 6341
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7000
length of database: 76,859,062
effective HSP length: 89
effective length of database: 55,757,518
effective search space used: 9199990470
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).