SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30026
         (796 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BC094722-1|AAH94722.1|  548|Homo sapiens SV2 related protein hom...    43   0.001
BC033587-1|AAH33587.1|  548|Homo sapiens SV2 related protein hom...    43   0.001
BC100827-1|AAI00828.1|  727|Homo sapiens synaptic vesicle glycop...    42   0.003
BC100826-1|AAI00827.1|  727|Homo sapiens synaptic vesicle glycop...    42   0.003
BC100825-1|AAI00826.1|  727|Homo sapiens synaptic vesicle glycop...    42   0.003
BC100824-1|AAI00825.1|  727|Homo sapiens synaptic vesicle glycop...    42   0.003
CR457086-1|CAG33367.1|  683|Homo sapiens SV2B protein.                 40   0.010
BC030011-1|AAH30011.1|  683|Homo sapiens SV2B protein protein.         40   0.010
AB018278-1|BAA34455.2|  707|Homo sapiens KIAA0735 protein protein.     40   0.010
BX537754-1|CAD97824.1|  742|Homo sapiens hypothetical protein pr...    40   0.014
BC045111-1|AAH45111.1|  742|Homo sapiens synaptic vesicle glycop...    40   0.014
BC000776-1|AAH00776.2|  604|Homo sapiens SV2A protein protein.         40   0.014
AL591493-21|CAI12573.1|  682|Homo sapiens synaptic vesicle glyco...    40   0.014
AL591493-20|CAI12572.1|  742|Homo sapiens synaptic vesicle glyco...    40   0.014
AK075480-1|BAC11645.1|  682|Homo sapiens protein ( Homo sapiens ...    40   0.014
AB018279-1|BAA34456.2|  748|Homo sapiens KIAA0736 protein protein.     40   0.014
AB028977-1|BAA83006.1|  480|Homo sapiens KIAA1054 protein protein.     31   4.8  
L29162-1|AAA18893.1|  151|Homo sapiens immunoglobulin light chai...    30   8.4  
BC094730-1|AAH94730.1|  656|Homo sapiens SLC26A7 protein protein.      30   8.4  
AJ413229-1|CAC88371.1|  656|Homo sapiens anion transporter protein.    30   8.4  
AJ413228-1|CAC88370.1|  656|Homo sapiens anion transporter protein.    30   8.4  
AF462683-1|AAM92118.1|  130|Homo sapiens immunoglobulin light ch...    30   8.4  
AF331521-1|AAK95665.1|  656|Homo sapiens putative anion transpor...    30   8.4  

>BC094722-1|AAH94722.1|  548|Homo sapiens SV2 related protein
           homolog (rat) protein.
          Length = 548

 Score = 43.2 bits (97), Expect = 0.001
 Identities = 22/91 (24%), Positives = 40/91 (43%)
 Frame = +2

Query: 257 FFASGVQNCIMSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGRKSXX 436
           + A  ++  I+S + P   CE +L ++Q  L+      G ++S+  WG + D +GRK+  
Sbjct: 94  WMADAMEMMILSILAPQLHCEWRLPSWQVALLTSVVFVGMMSSSTLWGNISDQYGRKTGL 153

Query: 437 XXXXXXXXXXXXXQSTVPDYRLLLQLEPSMG 529
                         +  P Y  +L L   +G
Sbjct: 154 KISVLWTLYYGILSAFAPVYSWILVLRGLVG 184


>BC033587-1|AAH33587.1|  548|Homo sapiens SV2 related protein
           homolog (rat) protein.
          Length = 548

 Score = 43.2 bits (97), Expect = 0.001
 Identities = 22/91 (24%), Positives = 40/91 (43%)
 Frame = +2

Query: 257 FFASGVQNCIMSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGRKSXX 436
           + A  ++  I+S + P   CE +L ++Q  L+      G ++S+  WG + D +GRK+  
Sbjct: 94  WMADAMEMMILSILAPQLHCEWRLPSWQVALLTSVVFVGMMSSSTLWGNISDQYGRKTGL 153

Query: 437 XXXXXXXXXXXXXQSTVPDYRLLLQLEPSMG 529
                         +  P Y  +L L   +G
Sbjct: 154 KISVLWTLYYGILSAFAPVYSWILVLRGLVG 184


>BC100827-1|AAI00828.1|  727|Homo sapiens synaptic vesicle
           glycoprotein 2C protein.
          Length = 727

 Score = 41.9 bits (94), Expect = 0.003
 Identities = 30/115 (26%), Positives = 52/115 (45%)
 Frame = +2

Query: 83  SLTQNNGSENRPENRKPHSQRHGNLTRCHRRDGGLRNRAGQSRVRPLQPECFRSVRVPFF 262
           S+ Q  G E + + R+  S+R  +     ++   +    G  R    Q   F  + +   
Sbjct: 108 SVGQPKGDEYK-DRRELESERRADEEELAQQYELIIQECGHGR---FQWALFFVLGMALM 163

Query: 263 ASGVQNCIMSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGRK 427
           A GV+  ++ +VLP+A  +L +    +G +      G +  AFFWG + D  GRK
Sbjct: 164 ADGVEVFVVGFVLPSAETDLCIPNSGSGWLGSIVYLGMMVGAFFWGGLADKVGRK 218



 Score = 31.1 bits (67), Expect = 4.8
 Identities = 16/55 (29%), Positives = 29/55 (52%)
 Frame = +1

Query: 514 RTINGFIIGGPATLVFTYLSDLVGVKKRQFYLSMVGMSFVXXXXXXXXXXXMVIP 678
           R ++GF IGG    VF+Y ++++  +KR  +LS + M ++            +IP
Sbjct: 248 RLLSGFGIGGAIPTVFSYFAEVLAREKRGEHLSWLCMFWMIGGIYASAMAWAIIP 302


>BC100826-1|AAI00827.1|  727|Homo sapiens synaptic vesicle
           glycoprotein 2C protein.
          Length = 727

 Score = 41.9 bits (94), Expect = 0.003
 Identities = 30/115 (26%), Positives = 52/115 (45%)
 Frame = +2

Query: 83  SLTQNNGSENRPENRKPHSQRHGNLTRCHRRDGGLRNRAGQSRVRPLQPECFRSVRVPFF 262
           S+ Q  G E + + R+  S+R  +     ++   +    G  R    Q   F  + +   
Sbjct: 108 SVGQPKGDEYK-DRRELESERRADEEELAQQYELIIQECGHGR---FQWALFFVLGMALM 163

Query: 263 ASGVQNCIMSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGRK 427
           A GV+  ++ +VLP+A  +L +    +G +      G +  AFFWG + D  GRK
Sbjct: 164 ADGVEVFVVGFVLPSAETDLCIPNSGSGWLGSIVYLGMMVGAFFWGGLADKVGRK 218



 Score = 31.1 bits (67), Expect = 4.8
 Identities = 16/55 (29%), Positives = 29/55 (52%)
 Frame = +1

Query: 514 RTINGFIIGGPATLVFTYLSDLVGVKKRQFYLSMVGMSFVXXXXXXXXXXXMVIP 678
           R ++GF IGG    VF+Y ++++  +KR  +LS + M ++            +IP
Sbjct: 248 RLLSGFGIGGAIPTVFSYFAEVLAREKRGEHLSWLCMFWMIGGIYASAMAWAIIP 302


>BC100825-1|AAI00826.1|  727|Homo sapiens synaptic vesicle
           glycoprotein 2C protein.
          Length = 727

 Score = 41.9 bits (94), Expect = 0.003
 Identities = 30/115 (26%), Positives = 52/115 (45%)
 Frame = +2

Query: 83  SLTQNNGSENRPENRKPHSQRHGNLTRCHRRDGGLRNRAGQSRVRPLQPECFRSVRVPFF 262
           S+ Q  G E + + R+  S+R  +     ++   +    G  R    Q   F  + +   
Sbjct: 108 SVGQPKGDEYK-DRRELESERRADEEELAQQYELIIQECGHGR---FQWALFFVLGMALM 163

Query: 263 ASGVQNCIMSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGRK 427
           A GV+  ++ +VLP+A  +L +    +G +      G +  AFFWG + D  GRK
Sbjct: 164 ADGVEVFVVGFVLPSAETDLCIPNSGSGWLGSIVYLGMMVGAFFWGGLADKVGRK 218



 Score = 31.1 bits (67), Expect = 4.8
 Identities = 16/55 (29%), Positives = 29/55 (52%)
 Frame = +1

Query: 514 RTINGFIIGGPATLVFTYLSDLVGVKKRQFYLSMVGMSFVXXXXXXXXXXXMVIP 678
           R ++GF IGG    VF+Y ++++  +KR  +LS + M ++            +IP
Sbjct: 248 RLLSGFGIGGAIPTVFSYFAEVLAREKRGEHLSWLCMFWMIGGIYASAMAWAIIP 302


>BC100824-1|AAI00825.1|  727|Homo sapiens synaptic vesicle
           glycoprotein 2C protein.
          Length = 727

 Score = 41.9 bits (94), Expect = 0.003
 Identities = 30/115 (26%), Positives = 52/115 (45%)
 Frame = +2

Query: 83  SLTQNNGSENRPENRKPHSQRHGNLTRCHRRDGGLRNRAGQSRVRPLQPECFRSVRVPFF 262
           S+ Q  G E + + R+  S+R  +     ++   +    G  R    Q   F  + +   
Sbjct: 108 SVGQPKGDEYK-DRRELESERRADEEELAQQYELIIQECGHGR---FQWALFFVLGMALM 163

Query: 263 ASGVQNCIMSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGRK 427
           A GV+  ++ +VLP+A  +L +    +G +      G +  AFFWG + D  GRK
Sbjct: 164 ADGVEVFVVGFVLPSAETDLCIPNSGSGWLGSIVYLGMMVGAFFWGGLADKVGRK 218



 Score = 31.1 bits (67), Expect = 4.8
 Identities = 16/55 (29%), Positives = 29/55 (52%)
 Frame = +1

Query: 514 RTINGFIIGGPATLVFTYLSDLVGVKKRQFYLSMVGMSFVXXXXXXXXXXXMVIP 678
           R ++GF IGG    VF+Y ++++  +KR  +LS + M ++            +IP
Sbjct: 248 RLLSGFGIGGAIPTVFSYFAEVLAREKRGEHLSWLCMFWMIGGIYASAMAWAIIP 302


>CR457086-1|CAG33367.1|  683|Homo sapiens SV2B protein.
          Length = 683

 Score = 39.9 bits (89), Expect = 0.010
 Identities = 19/55 (34%), Positives = 33/55 (60%)
 Frame = +2

Query: 263 ASGVQNCIMSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGRK 427
           A GV+  ++S+ LP+A  ++ L++ + G++ M    G +A AF  G + D  GRK
Sbjct: 121 ADGVEVFVVSFALPSAEKDMCLSSSKKGMLGMIVYLGMMAGAFILGGLADKLGRK 175



 Score = 33.1 bits (72), Expect = 1.2
 Identities = 17/55 (30%), Positives = 28/55 (50%)
 Frame = +1

Query: 514 RTINGFIIGGPATLVFTYLSDLVGVKKRQFYLSMVGMSFVXXXXXXXXXXXMVIP 678
           R I+G  IGG   +VF Y S+ +  +KR  +LS +G+ ++            +IP
Sbjct: 205 RLISGIGIGGALPIVFAYFSEFLSREKRGEHLSWLGIFWMTGGLYASAMAWSIIP 259


>BC030011-1|AAH30011.1|  683|Homo sapiens SV2B protein protein.
          Length = 683

 Score = 39.9 bits (89), Expect = 0.010
 Identities = 19/55 (34%), Positives = 33/55 (60%)
 Frame = +2

Query: 263 ASGVQNCIMSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGRK 427
           A GV+  ++S+ LP+A  ++ L++ + G++ M    G +A AF  G + D  GRK
Sbjct: 121 ADGVEVFVVSFALPSAEKDMCLSSSKKGMLGMIVYLGMMAGAFILGGLADKLGRK 175



 Score = 33.1 bits (72), Expect = 1.2
 Identities = 17/55 (30%), Positives = 28/55 (50%)
 Frame = +1

Query: 514 RTINGFIIGGPATLVFTYLSDLVGVKKRQFYLSMVGMSFVXXXXXXXXXXXMVIP 678
           R I+G  IGG   +VF Y S+ +  +KR  +LS +G+ ++            +IP
Sbjct: 205 RLISGIGIGGALPIVFAYFSEFLSREKRGEHLSWLGIFWMTGGLYASAMAWSIIP 259


>AB018278-1|BAA34455.2|  707|Homo sapiens KIAA0735 protein protein.
          Length = 707

 Score = 39.9 bits (89), Expect = 0.010
 Identities = 19/55 (34%), Positives = 33/55 (60%)
 Frame = +2

Query: 263 ASGVQNCIMSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGRK 427
           A GV+  ++S+ LP+A  ++ L++ + G++ M    G +A AF  G + D  GRK
Sbjct: 145 ADGVEVFVVSFALPSAEKDMCLSSSKKGMLGMIVYLGMMAGAFILGGLADKLGRK 199



 Score = 33.1 bits (72), Expect = 1.2
 Identities = 17/55 (30%), Positives = 28/55 (50%)
 Frame = +1

Query: 514 RTINGFIIGGPATLVFTYLSDLVGVKKRQFYLSMVGMSFVXXXXXXXXXXXMVIP 678
           R I+G  IGG   +VF Y S+ +  +KR  +LS +G+ ++            +IP
Sbjct: 229 RLISGIGIGGALPIVFAYFSEFLSREKRGEHLSWLGIFWMTGGLYASAMAWSIIP 283


>BX537754-1|CAD97824.1|  742|Homo sapiens hypothetical protein
           protein.
          Length = 742

 Score = 39.5 bits (88), Expect = 0.014
 Identities = 17/55 (30%), Positives = 31/55 (56%)
 Frame = +2

Query: 263 ASGVQNCIMSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGRK 427
           A GV+  ++ +VLP+A  ++ L+    G++ +    G +  AF WG + D  GR+
Sbjct: 178 ADGVEVFVVGFVLPSAEKDMCLSDSNKGMLGLIVYLGMMVGAFLWGGLADRLGRR 232



 Score = 30.7 bits (66), Expect = 6.3
 Identities = 16/55 (29%), Positives = 28/55 (50%)
 Frame = +1

Query: 514 RTINGFIIGGPATLVFTYLSDLVGVKKRQFYLSMVGMSFVXXXXXXXXXXXMVIP 678
           R ++G  IGG   +VF+Y S+ +  +KR  +LS + M ++            +IP
Sbjct: 262 RLLSGVGIGGSIPIVFSYFSEFLAQEKRGEHLSWLCMFWMIGGVYAAAMAWAIIP 316


>BC045111-1|AAH45111.1|  742|Homo sapiens synaptic vesicle
           glycoprotein 2A protein.
          Length = 742

 Score = 39.5 bits (88), Expect = 0.014
 Identities = 17/55 (30%), Positives = 31/55 (56%)
 Frame = +2

Query: 263 ASGVQNCIMSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGRK 427
           A GV+  ++ +VLP+A  ++ L+    G++ +    G +  AF WG + D  GR+
Sbjct: 178 ADGVEVFVVGFVLPSAEKDMCLSDSNKGMLGLIVYLGMMVGAFLWGGLADRLGRR 232



 Score = 30.7 bits (66), Expect = 6.3
 Identities = 16/55 (29%), Positives = 28/55 (50%)
 Frame = +1

Query: 514 RTINGFIIGGPATLVFTYLSDLVGVKKRQFYLSMVGMSFVXXXXXXXXXXXMVIP 678
           R ++G  IGG   +VF+Y S+ +  +KR  +LS + M ++            +IP
Sbjct: 262 RLLSGVGIGGSIPIVFSYFSEFLAQEKRGEHLSWLCMFWMIGGVYAAAMAWAIIP 316


>BC000776-1|AAH00776.2|  604|Homo sapiens SV2A protein protein.
          Length = 604

 Score = 39.5 bits (88), Expect = 0.014
 Identities = 17/55 (30%), Positives = 31/55 (56%)
 Frame = +2

Query: 263 ASGVQNCIMSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGRK 427
           A GV+  ++ +VLP+A  ++ L+    G++ +    G +  AF WG + D  GR+
Sbjct: 40  ADGVEVFVVGFVLPSAEKDMCLSDSNKGMLGLIVYLGMMVGAFLWGGLADRLGRR 94



 Score = 30.7 bits (66), Expect = 6.3
 Identities = 16/55 (29%), Positives = 28/55 (50%)
 Frame = +1

Query: 514 RTINGFIIGGPATLVFTYLSDLVGVKKRQFYLSMVGMSFVXXXXXXXXXXXMVIP 678
           R ++G  IGG   +VF+Y S+ +  +KR  +LS + M ++            +IP
Sbjct: 124 RLLSGVGIGGSIPIVFSYFSEFLAQEKRGEHLSWLCMFWMIGGVYAAAMAWAIIP 178


>AL591493-21|CAI12573.1|  682|Homo sapiens synaptic vesicle
           glycoprotein 2A protein.
          Length = 682

 Score = 39.5 bits (88), Expect = 0.014
 Identities = 17/55 (30%), Positives = 31/55 (56%)
 Frame = +2

Query: 263 ASGVQNCIMSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGRK 427
           A GV+  ++ +VLP+A  ++ L+    G++ +    G +  AF WG + D  GR+
Sbjct: 178 ADGVEVFVVGFVLPSAEKDMCLSDSNKGMLGLIVYLGMMVGAFLWGGLADRLGRR 232



 Score = 30.7 bits (66), Expect = 6.3
 Identities = 16/55 (29%), Positives = 28/55 (50%)
 Frame = +1

Query: 514 RTINGFIIGGPATLVFTYLSDLVGVKKRQFYLSMVGMSFVXXXXXXXXXXXMVIP 678
           R ++G  IGG   +VF+Y S+ +  +KR  +LS + M ++            +IP
Sbjct: 262 RLLSGVGIGGSIPIVFSYFSEFLAQEKRGEHLSWLCMFWMIGGVYAAAMAWAIIP 316


>AL591493-20|CAI12572.1|  742|Homo sapiens synaptic vesicle
           glycoprotein 2A protein.
          Length = 742

 Score = 39.5 bits (88), Expect = 0.014
 Identities = 17/55 (30%), Positives = 31/55 (56%)
 Frame = +2

Query: 263 ASGVQNCIMSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGRK 427
           A GV+  ++ +VLP+A  ++ L+    G++ +    G +  AF WG + D  GR+
Sbjct: 178 ADGVEVFVVGFVLPSAEKDMCLSDSNKGMLGLIVYLGMMVGAFLWGGLADRLGRR 232



 Score = 30.7 bits (66), Expect = 6.3
 Identities = 16/55 (29%), Positives = 28/55 (50%)
 Frame = +1

Query: 514 RTINGFIIGGPATLVFTYLSDLVGVKKRQFYLSMVGMSFVXXXXXXXXXXXMVIP 678
           R ++G  IGG   +VF+Y S+ +  +KR  +LS + M ++            +IP
Sbjct: 262 RLLSGVGIGGSIPIVFSYFSEFLAQEKRGEHLSWLCMFWMIGGVYAAAMAWAIIP 316


>AK075480-1|BAC11645.1|  682|Homo sapiens protein ( Homo sapiens
           cDNA PSEC0174 fis, clone NT2RP2002760, highly similar to
           SYNAPTIC VESICLE PROTEIN 2. ).
          Length = 682

 Score = 39.5 bits (88), Expect = 0.014
 Identities = 17/55 (30%), Positives = 31/55 (56%)
 Frame = +2

Query: 263 ASGVQNCIMSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGRK 427
           A GV+  ++ +VLP+A  ++ L+    G++ +    G +  AF WG + D  GR+
Sbjct: 178 ADGVEVFVVGFVLPSAEKDMCLSDSNKGMLGLIVYLGMMVGAFLWGGLADRLGRR 232



 Score = 30.7 bits (66), Expect = 6.3
 Identities = 16/55 (29%), Positives = 28/55 (50%)
 Frame = +1

Query: 514 RTINGFIIGGPATLVFTYLSDLVGVKKRQFYLSMVGMSFVXXXXXXXXXXXMVIP 678
           R ++G  IGG   +VF+Y S+ +  +KR  +LS + M ++            +IP
Sbjct: 262 RLLSGVGIGGSIPIVFSYFSEFLAQEKRGEHLSWLCMFWMIGGVYAAAMAWAIIP 316


>AB018279-1|BAA34456.2|  748|Homo sapiens KIAA0736 protein protein.
          Length = 748

 Score = 39.5 bits (88), Expect = 0.014
 Identities = 17/55 (30%), Positives = 31/55 (56%)
 Frame = +2

Query: 263 ASGVQNCIMSYVLPAARCELQLTTYQAGLINMAFMSGGVASAFFWGIVGDVFGRK 427
           A GV+  ++ +VLP+A  ++ L+    G++ +    G +  AF WG + D  GR+
Sbjct: 184 ADGVEVFVVGFVLPSAEKDMCLSDSNKGMLGLIVYLGMMVGAFLWGGLADRLGRR 238



 Score = 30.7 bits (66), Expect = 6.3
 Identities = 16/55 (29%), Positives = 28/55 (50%)
 Frame = +1

Query: 514 RTINGFIIGGPATLVFTYLSDLVGVKKRQFYLSMVGMSFVXXXXXXXXXXXMVIP 678
           R ++G  IGG   +VF+Y S+ +  +KR  +LS + M ++            +IP
Sbjct: 268 RLLSGVGIGGSIPIVFSYFSEFLAQEKRGEHLSWLCMFWMIGGVYAAAMAWAIIP 322


>AB028977-1|BAA83006.1|  480|Homo sapiens KIAA1054 protein protein.
          Length = 480

 Score = 31.1 bits (67), Expect = 4.8
 Identities = 16/55 (29%), Positives = 29/55 (52%)
 Frame = +1

Query: 514 RTINGFIIGGPATLVFTYLSDLVGVKKRQFYLSMVGMSFVXXXXXXXXXXXMVIP 678
           R ++GF IGG    VF+Y ++++  +KR  +LS + M ++            +IP
Sbjct: 1   RLLSGFGIGGAIPTVFSYFAEVLAREKRGEHLSWLCMFWMIGGIYASAMAWAIIP 55


>L29162-1|AAA18893.1|  151|Homo sapiens immunoglobulin light chain
           variable region protein.
          Length = 151

 Score = 30.3 bits (65), Expect = 8.4
 Identities = 13/38 (34%), Positives = 21/38 (55%)
 Frame = -3

Query: 539 PIMNPLMVLAAAEVCSLERCFGLKLSLHPGATSSLGCS 426
           P++ PL++L    V S E      +S+ PG T+ + CS
Sbjct: 5   PLLLPLLILCTVSVASYELTQPSSVSVSPGQTARITCS 42


>BC094730-1|AAH94730.1|  656|Homo sapiens SLC26A7 protein protein.
          Length = 656

 Score = 30.3 bits (65), Expect = 8.4
 Identities = 14/38 (36%), Positives = 24/38 (63%), Gaps = 3/38 (7%)
 Frame = -3

Query: 107 LNHYFGLAKKKKYFF---TINLRHIYTNKNMSRLTAHS 3
           + +Y  L  +K  FF   +  + HI++NKN+S+L+ HS
Sbjct: 617 MTYYGNLDSEKPIFFESVSAAISHIHSNKNLSKLSDHS 654


>AJ413229-1|CAC88371.1|  656|Homo sapiens anion transporter protein.
          Length = 656

 Score = 30.3 bits (65), Expect = 8.4
 Identities = 14/38 (36%), Positives = 24/38 (63%), Gaps = 3/38 (7%)
 Frame = -3

Query: 107 LNHYFGLAKKKKYFF---TINLRHIYTNKNMSRLTAHS 3
           + +Y  L  +K  FF   +  + HI++NKN+S+L+ HS
Sbjct: 617 MTYYGNLDSEKPIFFESVSAAISHIHSNKNLSKLSDHS 654


>AJ413228-1|CAC88370.1|  656|Homo sapiens anion transporter protein.
          Length = 656

 Score = 30.3 bits (65), Expect = 8.4
 Identities = 14/38 (36%), Positives = 24/38 (63%), Gaps = 3/38 (7%)
 Frame = -3

Query: 107 LNHYFGLAKKKKYFF---TINLRHIYTNKNMSRLTAHS 3
           + +Y  L  +K  FF   +  + HI++NKN+S+L+ HS
Sbjct: 617 MTYYGNLDSEKPIFFESVSAAISHIHSNKNLSKLSDHS 654


>AF462683-1|AAM92118.1|  130|Homo sapiens immunoglobulin light chain
           variable region protein.
          Length = 130

 Score = 30.3 bits (65), Expect = 8.4
 Identities = 13/38 (34%), Positives = 21/38 (55%)
 Frame = -3

Query: 539 PIMNPLMVLAAAEVCSLERCFGLKLSLHPGATSSLGCS 426
           P++ PL++L    V S E      +S+ PG T+ + CS
Sbjct: 5   PLLLPLLILCTVSVASYELTQPSSVSVSPGQTARITCS 42


>AF331521-1|AAK95665.1|  656|Homo sapiens putative anion transporter
           protein.
          Length = 656

 Score = 30.3 bits (65), Expect = 8.4
 Identities = 14/38 (36%), Positives = 24/38 (63%), Gaps = 3/38 (7%)
 Frame = -3

Query: 107 LNHYFGLAKKKKYFF---TINLRHIYTNKNMSRLTAHS 3
           + +Y  L  +K  FF   +  + HI++NKN+S+L+ HS
Sbjct: 617 MTYYGNLDSEKPIFFESVSAAISHIHSNKNLSKLSDHS 654


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 132,881,519
Number of Sequences: 237096
Number of extensions: 3289932
Number of successful extensions: 7229
Number of sequences better than 10.0: 23
Number of HSP's better than 10.0 without gapping: 6771
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7225
length of database: 76,859,062
effective HSP length: 89
effective length of database: 55,757,518
effective search space used: 9757565650
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).