SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30025
         (734 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U95044-1|AAB62180.1|  474|Homo sapiens zinc finger protein protein.    31   5.7  
BC094708-1|AAH94708.1|  474|Homo sapiens zinc finger protein 230...    31   5.7  
BC050340-1|AAH50340.2|  474|Homo sapiens zinc finger protein 230...    31   5.7  
AC067968-1|AAF66074.1|  397|Homo sapiens Zinc finger protein 230...    31   5.7  
AC018725-2|AAF18685.1|  474|Homo sapiens ZNF230-like protein.          31   5.7  

>U95044-1|AAB62180.1|  474|Homo sapiens zinc finger protein protein.
          Length = 474

 Score = 30.7 bits (66), Expect = 5.7
 Identities = 15/33 (45%), Positives = 17/33 (51%)
 Frame = -3

Query: 681 GKPFSNDMVSFSHKSLCHCRIEPINLESCFKHL 583
           GK FS      +HK L HCR +P   E C K L
Sbjct: 398 GKSFSRASSILNHKKL-HCRKKPFKCEDCGKRL 429


>BC094708-1|AAH94708.1|  474|Homo sapiens zinc finger protein 230
           protein.
          Length = 474

 Score = 30.7 bits (66), Expect = 5.7
 Identities = 15/33 (45%), Positives = 17/33 (51%)
 Frame = -3

Query: 681 GKPFSNDMVSFSHKSLCHCRIEPINLESCFKHL 583
           GK FS      +HK L HCR +P   E C K L
Sbjct: 398 GKSFSRASSILNHKKL-HCRKKPFKCEDCGKRL 429


>BC050340-1|AAH50340.2|  474|Homo sapiens zinc finger protein 230
           protein.
          Length = 474

 Score = 30.7 bits (66), Expect = 5.7
 Identities = 15/33 (45%), Positives = 17/33 (51%)
 Frame = -3

Query: 681 GKPFSNDMVSFSHKSLCHCRIEPINLESCFKHL 583
           GK FS      +HK L HCR +P   E C K L
Sbjct: 398 GKSFSRASSILNHKKL-HCRKKPFKCEDCGKRL 429


>AC067968-1|AAF66074.1|  397|Homo sapiens Zinc finger protein 230
           [amino acids 78-474] protein.
          Length = 397

 Score = 30.7 bits (66), Expect = 5.7
 Identities = 15/33 (45%), Positives = 17/33 (51%)
 Frame = -3

Query: 681 GKPFSNDMVSFSHKSLCHCRIEPINLESCFKHL 583
           GK FS      +HK L HCR +P   E C K L
Sbjct: 321 GKSFSRASSILNHKKL-HCRKKPFKCEDCGKRL 352


>AC018725-2|AAF18685.1|  474|Homo sapiens ZNF230-like protein.
          Length = 474

 Score = 30.7 bits (66), Expect = 5.7
 Identities = 15/33 (45%), Positives = 17/33 (51%)
 Frame = -3

Query: 681 GKPFSNDMVSFSHKSLCHCRIEPINLESCFKHL 583
           GK FS      +HK L HCR +P   E C K L
Sbjct: 398 GKSFSRASSILNHKKL-HCRKKPFKCEDCGKRL 429


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 100,018,622
Number of Sequences: 237096
Number of extensions: 2060458
Number of successful extensions: 6652
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 6569
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6652
length of database: 76,859,062
effective HSP length: 88
effective length of database: 55,994,614
effective search space used: 8735159784
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).