SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30024
         (540 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

D17554-1|BAA04491.1|  288|Homo sapiens DNA-binding protein TAXRE...    98   2e-20
BC104826-1|AAI04827.1|  288|Homo sapiens ribosomal protein L6 pr...    98   2e-20
BC104824-1|AAI04825.1|  288|Homo sapiens ribosomal protein L6 pr...    98   2e-20
BC071912-1|AAH71912.1|  288|Homo sapiens ribosomal protein L6 pr...    98   2e-20
BC032299-1|AAH32299.1|  288|Homo sapiens ribosomal protein L6 pr...    98   2e-20
BC031009-1|AAH31009.1|  288|Homo sapiens ribosomal protein L6 pr...    98   2e-20
BC022444-1|AAH22444.1|  288|Homo sapiens ribosomal protein L6 pr...    98   2e-20
BC020679-1|AAH20679.1|  288|Homo sapiens ribosomal protein L6 pr...    98   2e-20
BC004138-1|AAH04138.1|  288|Homo sapiens ribosomal protein L6 pr...    98   2e-20
AB042820-1|BAB17292.1|  288|Homo sapiens ribosomal protein L6 pr...    98   2e-20
AF261087-1|AAF99680.1|  289|Homo sapiens DNA-binding protein TAX...    89   1e-17
X69391-1|CAA49188.1|  288|Homo sapiens ribosomal protein L6 prot...    88   2e-17
S71022-1|AAB30819.1|  207|Homo sapiens neoplasm-related C140 pro...    60   4e-09
U16738-1|AAC16021.1|  213|Homo sapiens CAG-isl 7 protein.              30   4.5  
D87735-1|BAA13443.1|  220|Homo sapiens ribosomal protein L14 pro...    30   4.5  
DQ118667-1|AAZ38460.1|  215|Homo sapiens CAG-ISL 7 protein.            30   4.5  
BC071913-1|AAH71913.1|  220|Homo sapiens RPL14 protein protein.        30   4.5  
BC029036-1|AAH29036.1|  217|Homo sapiens ribosomal protein L14 p...    30   4.5  
BC022805-1|AAH22805.1|  216|Homo sapiens Unknown (protein for IM...    30   4.5  
BC019651-1|AAH19651.1|  219|Homo sapiens RPL14 protein protein.        30   4.5  
BC016379-1|AAH16379.1|  124|Homo sapiens Unknown (protein for IM...    30   4.5  
BC009294-1|AAH09294.1|  218|Homo sapiens RPL14 protein protein.        30   4.5  
BC005134-1|AAH05134.1|  222|Homo sapiens RPL14 protein protein.        30   4.5  
BC000606-1|AAH00606.1|  216|Homo sapiens ribosomal protein L14 p...    30   4.5  
AK223111-1|BAD96831.1|  218|Homo sapiens ribosomal protein L14 v...    30   4.5  
AK222750-1|BAD96470.1|  220|Homo sapiens ribosomal protein L14 v...    30   4.5  
AB061822-1|BAB79460.1|  220|Homo sapiens ribosomal protein L14 p...    30   4.5  

>D17554-1|BAA04491.1|  288|Homo sapiens DNA-binding protein
           TAXREB107 protein.
          Length = 288

 Score = 98.3 bits (234), Expect = 2e-20
 Identities = 45/75 (60%), Positives = 53/75 (70%)
 Frame = +3

Query: 264 GTVCILLAGRHAGKRVVLVGILPSGLLLVTGPFAFNSCPLRRIPQRYVIGTSTRISLGNF 443
           GT+ I+L GRH GKRVV +  L SGLLLVTGP   N  PLRR  Q++VI TST+I + N 
Sbjct: 147 GTILIILTGRHRGKRVVFLKQLASGLLLVTGPLVLNRVPLRRTHQKFVIATSTKIDISNV 206

Query: 444 KLPKHFNDDYFKKNK 488
           K+PKH  D YFKK K
Sbjct: 207 KIPKHLTDAYFKKKK 221



 Score = 66.5 bits (155), Expect = 6e-11
 Identities = 35/89 (39%), Positives = 51/89 (57%), Gaps = 6/89 (6%)
 Frame = +1

Query: 1   GVMRFSKSKMFHKKA----KYKFIGXXXXXXXXXXXLTVVVKQIGGEKNGGTRTVPLKRR 168
           G+ R+S+S M+ +KA    KY               L  V K +GG+KNGGTR V L++ 
Sbjct: 53  GIGRYSRSAMYSRKAMYKRKYSAAKSKVEKKKKEKVLATVTKPVGGDKNGGTRVVKLRKM 112

Query: 169 KSFYPTQEKIR--ASSGGRPFSKHVRRIR 249
             +YPT++  R   S G +PFS+HVR++R
Sbjct: 113 PRYYPTEDVPRKLLSHGKKPFSQHVRKLR 141


>BC104826-1|AAI04827.1|  288|Homo sapiens ribosomal protein L6
           protein.
          Length = 288

 Score = 98.3 bits (234), Expect = 2e-20
 Identities = 45/75 (60%), Positives = 53/75 (70%)
 Frame = +3

Query: 264 GTVCILLAGRHAGKRVVLVGILPSGLLLVTGPFAFNSCPLRRIPQRYVIGTSTRISLGNF 443
           GT+ I+L GRH GKRVV +  L SGLLLVTGP   N  PLRR  Q++VI TST+I + N 
Sbjct: 147 GTILIILTGRHRGKRVVFLKQLASGLLLVTGPLVLNRVPLRRTHQKFVIATSTKIDISNV 206

Query: 444 KLPKHFNDDYFKKNK 488
           K+PKH  D YFKK K
Sbjct: 207 KIPKHLTDAYFKKKK 221



 Score = 66.5 bits (155), Expect = 6e-11
 Identities = 35/89 (39%), Positives = 51/89 (57%), Gaps = 6/89 (6%)
 Frame = +1

Query: 1   GVMRFSKSKMFHKKA----KYKFIGXXXXXXXXXXXLTVVVKQIGGEKNGGTRTVPLKRR 168
           G+ R+S+S M+ +KA    KY               L  V K +GG+KNGGTR V L++ 
Sbjct: 53  GIGRYSRSAMYSRKAMYKRKYSAAKSKVEKKKKEKVLATVTKPVGGDKNGGTRVVKLRKM 112

Query: 169 KSFYPTQEKIR--ASSGGRPFSKHVRRIR 249
             +YPT++  R   S G +PFS+HVR++R
Sbjct: 113 PRYYPTEDVPRKLLSHGKKPFSQHVRKLR 141


>BC104824-1|AAI04825.1|  288|Homo sapiens ribosomal protein L6
           protein.
          Length = 288

 Score = 98.3 bits (234), Expect = 2e-20
 Identities = 45/75 (60%), Positives = 53/75 (70%)
 Frame = +3

Query: 264 GTVCILLAGRHAGKRVVLVGILPSGLLLVTGPFAFNSCPLRRIPQRYVIGTSTRISLGNF 443
           GT+ I+L GRH GKRVV +  L SGLLLVTGP   N  PLRR  Q++VI TST+I + N 
Sbjct: 147 GTILIILTGRHRGKRVVFLKQLASGLLLVTGPLVLNRVPLRRTHQKFVIATSTKIDISNV 206

Query: 444 KLPKHFNDDYFKKNK 488
           K+PKH  D YFKK K
Sbjct: 207 KIPKHLTDAYFKKKK 221



 Score = 66.5 bits (155), Expect = 6e-11
 Identities = 35/89 (39%), Positives = 51/89 (57%), Gaps = 6/89 (6%)
 Frame = +1

Query: 1   GVMRFSKSKMFHKKA----KYKFIGXXXXXXXXXXXLTVVVKQIGGEKNGGTRTVPLKRR 168
           G+ R+S+S M+ +KA    KY               L  V K +GG+KNGGTR V L++ 
Sbjct: 53  GIGRYSRSAMYSRKAMYKRKYSAAKSKVEKKKKEKVLATVTKPVGGDKNGGTRVVKLRKM 112

Query: 169 KSFYPTQEKIR--ASSGGRPFSKHVRRIR 249
             +YPT++  R   S G +PFS+HVR++R
Sbjct: 113 PRYYPTEDVPRKLLSHGKKPFSQHVRKLR 141


>BC071912-1|AAH71912.1|  288|Homo sapiens ribosomal protein L6
           protein.
          Length = 288

 Score = 98.3 bits (234), Expect = 2e-20
 Identities = 45/75 (60%), Positives = 53/75 (70%)
 Frame = +3

Query: 264 GTVCILLAGRHAGKRVVLVGILPSGLLLVTGPFAFNSCPLRRIPQRYVIGTSTRISLGNF 443
           GT+ I+L GRH GKRVV +  L SGLLLVTGP   N  PLRR  Q++VI TST+I + N 
Sbjct: 147 GTILIILTGRHRGKRVVFLKQLASGLLLVTGPLVLNRVPLRRTHQKFVIATSTKIDISNV 206

Query: 444 KLPKHFNDDYFKKNK 488
           K+PKH  D YFKK K
Sbjct: 207 KIPKHLTDAYFKKKK 221



 Score = 66.5 bits (155), Expect = 6e-11
 Identities = 35/89 (39%), Positives = 51/89 (57%), Gaps = 6/89 (6%)
 Frame = +1

Query: 1   GVMRFSKSKMFHKKA----KYKFIGXXXXXXXXXXXLTVVVKQIGGEKNGGTRTVPLKRR 168
           G+ R+S+S M+ +KA    KY               L  V K +GG+KNGGTR V L++ 
Sbjct: 53  GIGRYSRSAMYSRKAMYKRKYSAAKSKVEKKKKEKVLATVTKPVGGDKNGGTRVVKLRKM 112

Query: 169 KSFYPTQEKIR--ASSGGRPFSKHVRRIR 249
             +YPT++  R   S G +PFS+HVR++R
Sbjct: 113 PRYYPTEDVPRKLLSHGKKPFSQHVRKLR 141


>BC032299-1|AAH32299.1|  288|Homo sapiens ribosomal protein L6
           protein.
          Length = 288

 Score = 98.3 bits (234), Expect = 2e-20
 Identities = 45/75 (60%), Positives = 53/75 (70%)
 Frame = +3

Query: 264 GTVCILLAGRHAGKRVVLVGILPSGLLLVTGPFAFNSCPLRRIPQRYVIGTSTRISLGNF 443
           GT+ I+L GRH GKRVV +  L SGLLLVTGP   N  PLRR  Q++VI TST+I + N 
Sbjct: 147 GTILIILTGRHRGKRVVFLKQLASGLLLVTGPLVLNRVPLRRTHQKFVIATSTKIDISNV 206

Query: 444 KLPKHFNDDYFKKNK 488
           K+PKH  D YFKK K
Sbjct: 207 KIPKHLTDAYFKKKK 221



 Score = 66.5 bits (155), Expect = 6e-11
 Identities = 35/89 (39%), Positives = 51/89 (57%), Gaps = 6/89 (6%)
 Frame = +1

Query: 1   GVMRFSKSKMFHKKA----KYKFIGXXXXXXXXXXXLTVVVKQIGGEKNGGTRTVPLKRR 168
           G+ R+S+S M+ +KA    KY               L  V K +GG+KNGGTR V L++ 
Sbjct: 53  GIGRYSRSAMYSRKAMYKRKYSAAKSKVEKKKKEKVLATVTKPVGGDKNGGTRVVKLRKM 112

Query: 169 KSFYPTQEKIR--ASSGGRPFSKHVRRIR 249
             +YPT++  R   S G +PFS+HVR++R
Sbjct: 113 PRYYPTEDVPRKLLSHGKKPFSQHVRKLR 141


>BC031009-1|AAH31009.1|  288|Homo sapiens ribosomal protein L6
           protein.
          Length = 288

 Score = 98.3 bits (234), Expect = 2e-20
 Identities = 45/75 (60%), Positives = 53/75 (70%)
 Frame = +3

Query: 264 GTVCILLAGRHAGKRVVLVGILPSGLLLVTGPFAFNSCPLRRIPQRYVIGTSTRISLGNF 443
           GT+ I+L GRH GKRVV +  L SGLLLVTGP   N  PLRR  Q++VI TST+I + N 
Sbjct: 147 GTILIILTGRHRGKRVVFLKQLASGLLLVTGPLVLNRVPLRRTHQKFVIATSTKIDISNV 206

Query: 444 KLPKHFNDDYFKKNK 488
           K+PKH  D YFKK K
Sbjct: 207 KIPKHLTDAYFKKKK 221



 Score = 66.5 bits (155), Expect = 6e-11
 Identities = 35/89 (39%), Positives = 51/89 (57%), Gaps = 6/89 (6%)
 Frame = +1

Query: 1   GVMRFSKSKMFHKKA----KYKFIGXXXXXXXXXXXLTVVVKQIGGEKNGGTRTVPLKRR 168
           G+ R+S+S M+ +KA    KY               L  V K +GG+KNGGTR V L++ 
Sbjct: 53  GIGRYSRSAMYSRKAMYKRKYSAAKSKVEKKKKEKVLATVTKPVGGDKNGGTRVVKLRKM 112

Query: 169 KSFYPTQEKIR--ASSGGRPFSKHVRRIR 249
             +YPT++  R   S G +PFS+HVR++R
Sbjct: 113 PRYYPTEDVPRKLLSHGKKPFSQHVRKLR 141


>BC022444-1|AAH22444.1|  288|Homo sapiens ribosomal protein L6
           protein.
          Length = 288

 Score = 98.3 bits (234), Expect = 2e-20
 Identities = 45/75 (60%), Positives = 53/75 (70%)
 Frame = +3

Query: 264 GTVCILLAGRHAGKRVVLVGILPSGLLLVTGPFAFNSCPLRRIPQRYVIGTSTRISLGNF 443
           GT+ I+L GRH GKRVV +  L SGLLLVTGP   N  PLRR  Q++VI TST+I + N 
Sbjct: 147 GTILIILTGRHRGKRVVFLKQLASGLLLVTGPLVLNRVPLRRTHQKFVIATSTKIDISNV 206

Query: 444 KLPKHFNDDYFKKNK 488
           K+PKH  D YFKK K
Sbjct: 207 KIPKHLTDAYFKKKK 221



 Score = 66.9 bits (156), Expect = 4e-11
 Identities = 36/89 (40%), Positives = 51/89 (57%), Gaps = 6/89 (6%)
 Frame = +1

Query: 1   GVMRFSKSKMFHKKA----KYKFIGXXXXXXXXXXXLTVVVKQIGGEKNGGTRTVPLKRR 168
           GV R+S+S M+ +KA    KY               L  V K +GG+KNGGTR V L++ 
Sbjct: 53  GVGRYSRSAMYSRKAMYKRKYSAAKSKVEKKKKEKVLATVTKPVGGDKNGGTRVVKLRKM 112

Query: 169 KSFYPTQEKIR--ASSGGRPFSKHVRRIR 249
             +YPT++  R   S G +PFS+HVR++R
Sbjct: 113 PRYYPTEDVPRKLLSHGKKPFSQHVRKLR 141


>BC020679-1|AAH20679.1|  288|Homo sapiens ribosomal protein L6
           protein.
          Length = 288

 Score = 98.3 bits (234), Expect = 2e-20
 Identities = 45/75 (60%), Positives = 53/75 (70%)
 Frame = +3

Query: 264 GTVCILLAGRHAGKRVVLVGILPSGLLLVTGPFAFNSCPLRRIPQRYVIGTSTRISLGNF 443
           GT+ I+L GRH GKRVV +  L SGLLLVTGP   N  PLRR  Q++VI TST+I + N 
Sbjct: 147 GTILIILTGRHRGKRVVFLKQLASGLLLVTGPLVLNRVPLRRTHQKFVIATSTKIDISNV 206

Query: 444 KLPKHFNDDYFKKNK 488
           K+PKH  D YFKK K
Sbjct: 207 KIPKHLTDAYFKKKK 221



 Score = 66.5 bits (155), Expect = 6e-11
 Identities = 35/89 (39%), Positives = 51/89 (57%), Gaps = 6/89 (6%)
 Frame = +1

Query: 1   GVMRFSKSKMFHKKA----KYKFIGXXXXXXXXXXXLTVVVKQIGGEKNGGTRTVPLKRR 168
           G+ R+S+S M+ +KA    KY               L  V K +GG+KNGGTR V L++ 
Sbjct: 53  GIGRYSRSAMYSRKAMYKRKYSAAKSKVEKKKKEKVLATVTKPVGGDKNGGTRVVKLRKM 112

Query: 169 KSFYPTQEKIR--ASSGGRPFSKHVRRIR 249
             +YPT++  R   S G +PFS+HVR++R
Sbjct: 113 PRYYPTEDVPRKLLSHGKKPFSQHVRKLR 141


>BC004138-1|AAH04138.1|  288|Homo sapiens ribosomal protein L6
           protein.
          Length = 288

 Score = 98.3 bits (234), Expect = 2e-20
 Identities = 45/75 (60%), Positives = 53/75 (70%)
 Frame = +3

Query: 264 GTVCILLAGRHAGKRVVLVGILPSGLLLVTGPFAFNSCPLRRIPQRYVIGTSTRISLGNF 443
           GT+ I+L GRH GKRVV +  L SGLLLVTGP   N  PLRR  Q++VI TST+I + N 
Sbjct: 147 GTILIILTGRHRGKRVVFLKQLASGLLLVTGPLVLNRVPLRRTHQKFVIATSTKIDISNV 206

Query: 444 KLPKHFNDDYFKKNK 488
           K+PKH  D YFKK K
Sbjct: 207 KIPKHLTDAYFKKKK 221



 Score = 66.5 bits (155), Expect = 6e-11
 Identities = 35/89 (39%), Positives = 51/89 (57%), Gaps = 6/89 (6%)
 Frame = +1

Query: 1   GVMRFSKSKMFHKKA----KYKFIGXXXXXXXXXXXLTVVVKQIGGEKNGGTRTVPLKRR 168
           G+ R+S+S M+ +KA    KY               L  V K +GG+KNGGTR V L++ 
Sbjct: 53  GIGRYSRSAMYSRKAMYKRKYSAAKSKVEKKKKEKVLATVTKPVGGDKNGGTRVVKLRKM 112

Query: 169 KSFYPTQEKIR--ASSGGRPFSKHVRRIR 249
             +YPT++  R   S G +PFS+HVR++R
Sbjct: 113 PRYYPTEDVPRKLLSHGKKPFSQHVRKLR 141


>AB042820-1|BAB17292.1|  288|Homo sapiens ribosomal protein L6
           protein.
          Length = 288

 Score = 98.3 bits (234), Expect = 2e-20
 Identities = 45/75 (60%), Positives = 53/75 (70%)
 Frame = +3

Query: 264 GTVCILLAGRHAGKRVVLVGILPSGLLLVTGPFAFNSCPLRRIPQRYVIGTSTRISLGNF 443
           GT+ I+L GRH GKRVV +  L SGLLLVTGP   N  PLRR  Q++VI TST+I + N 
Sbjct: 147 GTILIILTGRHRGKRVVFLKQLASGLLLVTGPLVLNRVPLRRTHQKFVIATSTKIDISNV 206

Query: 444 KLPKHFNDDYFKKNK 488
           K+PKH  D YFKK K
Sbjct: 207 KIPKHLTDAYFKKKK 221



 Score = 66.5 bits (155), Expect = 6e-11
 Identities = 35/89 (39%), Positives = 51/89 (57%), Gaps = 6/89 (6%)
 Frame = +1

Query: 1   GVMRFSKSKMFHKKA----KYKFIGXXXXXXXXXXXLTVVVKQIGGEKNGGTRTVPLKRR 168
           G+ R+S+S M+ +KA    KY               L  V K +GG+KNGGTR V L++ 
Sbjct: 53  GIGRYSRSAMYSRKAMYKRKYSAAKSKVEKKKKEKVLATVTKPVGGDKNGGTRVVKLRKM 112

Query: 169 KSFYPTQEKIR--ASSGGRPFSKHVRRIR 249
             +YPT++  R   S G +PFS+HVR++R
Sbjct: 113 PRYYPTEDVPRKLLSHGKKPFSQHVRKLR 141


>AF261087-1|AAF99680.1|  289|Homo sapiens DNA-binding protein
           TAXREB107 protein.
          Length = 289

 Score = 88.6 bits (210), Expect = 1e-17
 Identities = 43/76 (56%), Positives = 51/76 (67%), Gaps = 1/76 (1%)
 Frame = +3

Query: 264 GTVCILLAGRHAGKR-VVLVGILPSGLLLVTGPFAFNSCPLRRIPQRYVIGTSTRISLGN 440
           GT+ I+L GR  GK  VV +  L SGLLLVTGP   N  PLRR  Q++VI TST+I + N
Sbjct: 147 GTILIILTGRRRGKNWVVFLKQLASGLLLVTGPLVLNRVPLRRTHQKFVIATSTKIDISN 206

Query: 441 FKLPKHFNDDYFKKNK 488
            K+PKH  D YFKK K
Sbjct: 207 VKIPKHLTDAYFKKKK 222



 Score = 66.5 bits (155), Expect = 6e-11
 Identities = 35/89 (39%), Positives = 51/89 (57%), Gaps = 6/89 (6%)
 Frame = +1

Query: 1   GVMRFSKSKMFHKKA----KYKFIGXXXXXXXXXXXLTVVVKQIGGEKNGGTRTVPLKRR 168
           G+ R+S+S M+ +KA    KY               L  V K +GG+KNGGTR V L++ 
Sbjct: 53  GIGRYSRSAMYSRKAMYKRKYSAAKSKVEKKKKEKVLATVTKPVGGDKNGGTRVVKLRKM 112

Query: 169 KSFYPTQEKIR--ASSGGRPFSKHVRRIR 249
             +YPT++  R   S G +PFS+HVR++R
Sbjct: 113 PRYYPTEDVPRKLLSHGKKPFSQHVRKLR 141


>X69391-1|CAA49188.1|  288|Homo sapiens ribosomal protein L6
           protein.
          Length = 288

 Score = 88.2 bits (209), Expect = 2e-17
 Identities = 42/75 (56%), Positives = 52/75 (69%)
 Frame = +3

Query: 264 GTVCILLAGRHAGKRVVLVGILPSGLLLVTGPFAFNSCPLRRIPQRYVIGTSTRISLGNF 443
           GT+ I+L GRH GKRVV +  L SGLLLVT  ++    PLRR  Q++VI TST+I + N 
Sbjct: 147 GTILIILTGRHRGKRVVFLKQLASGLLLVTDLWSSIEVPLRRTHQKFVIATSTKIDISNV 206

Query: 444 KLPKHFNDDYFKKNK 488
           K+PKH  D YFKK K
Sbjct: 207 KIPKHLTDAYFKKKK 221



 Score = 58.8 bits (136), Expect = 1e-08
 Identities = 31/84 (36%), Positives = 45/84 (53%), Gaps = 2/84 (2%)
 Frame = +1

Query: 4   VMRFSKSKMFHKKAKYKFIGXXXXXXXXXXXLTVVVKQIGGEKNGGTRTVPLKRRKSFYP 183
           +   S+  M+  K KY               L  V K +GG+KNGGTR V L++   +YP
Sbjct: 60  ICHVSRKAMY--KRKYSAAKSKVEKKKKEKVLATVTKPVGGDKNGGTRVVKLRKMPRYYP 117

Query: 184 TQEKIR--ASSGGRPFSKHVRRIR 249
           T++  R   S G +PFS+HVR++R
Sbjct: 118 TEDVPRKLLSHGKKPFSQHVRKLR 141


>S71022-1|AAB30819.1|  207|Homo sapiens neoplasm-related C140
           product protein.
          Length = 207

 Score = 60.5 bits (140), Expect = 4e-09
 Identities = 32/75 (42%), Positives = 39/75 (52%)
 Frame = +3

Query: 264 GTVCILLAGRHAGKRVVLVGILPSGLLLVTGPFAFNSCPLRRIPQRYVIGTSTRISLGNF 443
           GT+ I+L GRH GKRVV +  L SGLLLVTGP            +   +    +      
Sbjct: 86  GTILIILTGRHRGKRVVFLKQLASGLLLVTGPLVSIEFLYEEHTRNLSLPLQPKSISAIV 145

Query: 444 KLPKHFNDDYFKKNK 488
           K+PKH  D YFKK K
Sbjct: 146 KIPKHLTDAYFKKKK 160



 Score = 59.7 bits (138), Expect = 6e-09
 Identities = 31/81 (38%), Positives = 45/81 (55%), Gaps = 2/81 (2%)
 Frame = +1

Query: 13  FSKSKMFHKKAKYKFIGXXXXXXXXXXXLTVVVKQIGGEKNGGTRTVPLKRRKSFYPTQE 192
           +S+  M+  K KY               L  V K +GG+KNGGTR V L++   +YPT++
Sbjct: 2   YSRKAMY--KRKYSAAKSKVEKKKKEKVLATVTKPVGGDKNGGTRVVKLRKMPRYYPTED 59

Query: 193 KIR--ASSGGRPFSKHVRRIR 249
             R   S G +PFS+HVR++R
Sbjct: 60  VPRKLLSHGKKPFSQHVRKLR 80


>U16738-1|AAC16021.1|  213|Homo sapiens CAG-isl 7 protein.
          Length = 213

 Score = 30.3 bits (65), Expect = 4.5
 Identities = 13/35 (37%), Positives = 20/35 (57%)
 Frame = +3

Query: 255 LKIGTVCILLAGRHAGKRVVLVGILPSGLLLVTGP 359
           +++G V  +  G HAGK V +V ++     LV GP
Sbjct: 7   VEVGRVAYVSFGPHAGKLVAIVDVIDQNRALVDGP 41


>D87735-1|BAA13443.1|  220|Homo sapiens ribosomal protein L14
           protein.
          Length = 220

 Score = 30.3 bits (65), Expect = 4.5
 Identities = 13/35 (37%), Positives = 20/35 (57%)
 Frame = +3

Query: 255 LKIGTVCILLAGRHAGKRVVLVGILPSGLLLVTGP 359
           +++G V  +  G HAGK V +V ++     LV GP
Sbjct: 7   VEVGRVAYVSFGPHAGKLVAIVDVIDQNRALVDGP 41


>DQ118667-1|AAZ38460.1|  215|Homo sapiens CAG-ISL 7 protein.
          Length = 215

 Score = 30.3 bits (65), Expect = 4.5
 Identities = 13/35 (37%), Positives = 20/35 (57%)
 Frame = +3

Query: 255 LKIGTVCILLAGRHAGKRVVLVGILPSGLLLVTGP 359
           +++G V  +  G HAGK V +V ++     LV GP
Sbjct: 7   VEVGRVAYVSFGPHAGKLVAIVDVIDQNRALVDGP 41


>BC071913-1|AAH71913.1|  220|Homo sapiens RPL14 protein protein.
          Length = 220

 Score = 30.3 bits (65), Expect = 4.5
 Identities = 13/35 (37%), Positives = 20/35 (57%)
 Frame = +3

Query: 255 LKIGTVCILLAGRHAGKRVVLVGILPSGLLLVTGP 359
           +++G V  +  G HAGK V +V ++     LV GP
Sbjct: 7   VEVGRVAYVSFGPHAGKLVAIVDVIDQNRALVDGP 41


>BC029036-1|AAH29036.1|  217|Homo sapiens ribosomal protein L14
           protein.
          Length = 217

 Score = 30.3 bits (65), Expect = 4.5
 Identities = 13/35 (37%), Positives = 20/35 (57%)
 Frame = +3

Query: 255 LKIGTVCILLAGRHAGKRVVLVGILPSGLLLVTGP 359
           +++G V  +  G HAGK V +V ++     LV GP
Sbjct: 7   VEVGRVAYVSFGPHAGKLVAIVDVIDQNRALVDGP 41


>BC022805-1|AAH22805.1|  216|Homo sapiens Unknown (protein for
           IMAGE:5426295) protein.
          Length = 216

 Score = 30.3 bits (65), Expect = 4.5
 Identities = 13/35 (37%), Positives = 20/35 (57%)
 Frame = +3

Query: 255 LKIGTVCILLAGRHAGKRVVLVGILPSGLLLVTGP 359
           +++G V  +  G HAGK V +V ++     LV GP
Sbjct: 6   VEVGRVAYVSFGPHAGKLVAIVDVIDQNRALVDGP 40


>BC019651-1|AAH19651.1|  219|Homo sapiens RPL14 protein protein.
          Length = 219

 Score = 30.3 bits (65), Expect = 4.5
 Identities = 13/35 (37%), Positives = 20/35 (57%)
 Frame = +3

Query: 255 LKIGTVCILLAGRHAGKRVVLVGILPSGLLLVTGP 359
           +++G V  +  G HAGK V +V ++     LV GP
Sbjct: 7   VEVGRVAYVSFGPHAGKLVAIVDVIDQNRALVDGP 41


>BC016379-1|AAH16379.1|  124|Homo sapiens Unknown (protein for
           IMAGE:4667300) protein.
          Length = 124

 Score = 30.3 bits (65), Expect = 4.5
 Identities = 13/35 (37%), Positives = 20/35 (57%)
 Frame = +3

Query: 255 LKIGTVCILLAGRHAGKRVVLVGILPSGLLLVTGP 359
           +++G V  +  G HAGK V +V ++     LV GP
Sbjct: 7   VEVGRVAYVSFGPHAGKLVAIVDVIDQNRALVDGP 41


>BC009294-1|AAH09294.1|  218|Homo sapiens RPL14 protein protein.
          Length = 218

 Score = 30.3 bits (65), Expect = 4.5
 Identities = 13/35 (37%), Positives = 20/35 (57%)
 Frame = +3

Query: 255 LKIGTVCILLAGRHAGKRVVLVGILPSGLLLVTGP 359
           +++G V  +  G HAGK V +V ++     LV GP
Sbjct: 7   VEVGRVAYVSFGPHAGKLVAIVDVIDQNRALVDGP 41


>BC005134-1|AAH05134.1|  222|Homo sapiens RPL14 protein protein.
          Length = 222

 Score = 30.3 bits (65), Expect = 4.5
 Identities = 13/35 (37%), Positives = 20/35 (57%)
 Frame = +3

Query: 255 LKIGTVCILLAGRHAGKRVVLVGILPSGLLLVTGP 359
           +++G V  +  G HAGK V +V ++     LV GP
Sbjct: 7   VEVGRVAYVSFGPHAGKLVAIVDVIDQNRALVDGP 41


>BC000606-1|AAH00606.1|  216|Homo sapiens ribosomal protein L14
           protein.
          Length = 216

 Score = 30.3 bits (65), Expect = 4.5
 Identities = 13/35 (37%), Positives = 20/35 (57%)
 Frame = +3

Query: 255 LKIGTVCILLAGRHAGKRVVLVGILPSGLLLVTGP 359
           +++G V  +  G HAGK V +V ++     LV GP
Sbjct: 7   VEVGRVAYVSFGPHAGKLVAIVDVIDQNRALVDGP 41


>AK223111-1|BAD96831.1|  218|Homo sapiens ribosomal protein L14
           variant protein.
          Length = 218

 Score = 30.3 bits (65), Expect = 4.5
 Identities = 13/35 (37%), Positives = 20/35 (57%)
 Frame = +3

Query: 255 LKIGTVCILLAGRHAGKRVVLVGILPSGLLLVTGP 359
           +++G V  +  G HAGK V +V ++     LV GP
Sbjct: 7   VEVGRVAYVSFGPHAGKLVAIVDVIDQNRALVDGP 41


>AK222750-1|BAD96470.1|  220|Homo sapiens ribosomal protein L14
           variant protein.
          Length = 220

 Score = 30.3 bits (65), Expect = 4.5
 Identities = 13/35 (37%), Positives = 20/35 (57%)
 Frame = +3

Query: 255 LKIGTVCILLAGRHAGKRVVLVGILPSGLLLVTGP 359
           +++G V  +  G HAGK V +V ++     LV GP
Sbjct: 7   VEVGRVAYVSFGPHAGKLVAIVDVIDQNRALVDGP 41


>AB061822-1|BAB79460.1|  220|Homo sapiens ribosomal protein L14
           protein.
          Length = 220

 Score = 30.3 bits (65), Expect = 4.5
 Identities = 13/35 (37%), Positives = 20/35 (57%)
 Frame = +3

Query: 255 LKIGTVCILLAGRHAGKRVVLVGILPSGLLLVTGP 359
           +++G V  +  G HAGK V +V ++     LV GP
Sbjct: 7   VEVGRVAYVSFGPHAGKLVAIVDVIDQNRALVDGP 41


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 80,480,310
Number of Sequences: 237096
Number of extensions: 1712849
Number of successful extensions: 7121
Number of sequences better than 10.0: 27
Number of HSP's better than 10.0 without gapping: 7002
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7107
length of database: 76,859,062
effective HSP length: 86
effective length of database: 56,468,806
effective search space used: 5251598958
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).