SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30023
         (770 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

J04982-1|AAA51736.1|  298|Homo sapiens ANT1 protein.                  118   3e-26
BC063643-1|AAH63643.1|  298|Homo sapiens solute carrier family 2...   118   3e-26
BC061589-1|AAH61589.1|  298|Homo sapiens solute carrier family 2...   118   3e-26
BC008664-1|AAH08664.1|  298|Homo sapiens solute carrier family 2...   118   3e-26
J02966-1|AAA61223.1|  297|Homo sapiens ANT1 protein.                  117   4e-26
J03592-1|AAA36750.1|  262|Homo sapiens protein ( Human ADP/ATP t...   115   2e-25
CR457400-1|CAG33681.1|  298|Homo sapiens SLC25A6 protein.             115   2e-25
BC031912-1|AAH31912.1|  298|Homo sapiens solute carrier family 2...   115   2e-25
BC008935-1|AAH08935.1|  298|Homo sapiens solute carrier family 2...   115   2e-25
BC008737-1|AAH08737.1|  298|Homo sapiens solute carrier family 2...   115   2e-25
BC007850-1|AAH07850.1|  298|Homo sapiens solute carrier family 2...   115   2e-25
BC007295-1|AAH07295.1|  298|Homo sapiens solute carrier family 2...   115   2e-25
AY007135-1|AAG01998.1|  298|Homo sapiens protein ( Homo sapiens ...   115   2e-25
AL683870-1|CAI39843.1|  298|Homo sapiens solute carrier family 2...   115   2e-25
AB209822-1|BAD93059.1|  323|Homo sapiens ADP,ATP carrier protein...   115   2e-25
M57424-1|AAA51737.1|  298|Homo sapiens adenine nucleotide transl...   113   5e-25
L78810-1|AAB39266.1|  298|Homo sapiens ANT-2 protein.                 113   5e-25
J03591-1|AAA36749.1|  252|Homo sapiens protein ( Human ADP/ATP t...   113   5e-25
J02683-1|AAA35579.1|  298|Homo sapiens protein ( Human ADP/ATP c...   113   5e-25
BC068199-1|AAH68199.1|  323|Homo sapiens SLC25A5 protein protein.     113   5e-25
BC056160-1|AAH56160.1|  298|Homo sapiens solute carrier family 2...   113   5e-25
AC004000-1|AAB96347.1|  298|Homo sapiens ADP/ATP carrier protein...   113   5e-25
BC014775-1|AAH14775.1|  298|Homo sapiens solute carrier family 2...   113   9e-25
BC022032-1|AAH22032.1|  315|Homo sapiens solute carrier family 2...   103   9e-22
AY550240-1|AAT42263.1|  315|Homo sapiens sperm flagellar energy ...   103   9e-22
AJ863129-1|CAI05952.1|  315|Homo sapiens ADP/ATP carrier isoform...   103   9e-22
AC093591-1|AAY40974.1|  315|Homo sapiens unknown protein.             103   9e-22
U94592-1|AAB53091.1|  309|Homo sapiens uncoupling protein homolo...    40   0.007
U82819-1|AAC51336.1|  309|Homo sapiens UCP2 protein.                   40   0.007
U76367-1|AAB48411.1|  309|Homo sapiens uncoupling protein-2 prot...    40   0.007
DQ087219-1|AAY68217.1|  309|Homo sapiens uncoupling protein 2 (m...    40   0.007
BC011737-1|AAH11737.1|  309|Homo sapiens uncoupling protein 2 (m...    40   0.007
AK222557-1|BAD96277.1|  309|Homo sapiens uncoupling protein 2 va...    40   0.007
AK222540-1|BAD96260.1|  309|Homo sapiens uncoupling protein 2 va...    40   0.007
AJ223477-1|CAA11402.1|  309|Homo sapiens uncoupling protein 2 pr...    40   0.007
AF096289-1|AAD21151.1|  309|Homo sapiens uncoupling protein-2 pr...    40   0.007
AF019409-1|AAC39690.1|  309|Homo sapiens uncoupling protein 2 pr...    40   0.007
BC113365-1|AAI13366.1|  299|Homo sapiens solute carrier family 2...    40   0.013
BC101521-1|AAI01522.1|  299|Homo sapiens solute carrier family 2...    40   0.013
AK172788-1|BAD18767.1|  303|Homo sapiens protein ( Homo sapiens ...    40   0.013
AJ278148-1|CAC27562.1|  299|Homo sapiens oxodicarboxylate carrie...    40   0.013
BC119667-1|AAI19668.1|  325|Homo sapiens solute carrier family 2...    39   0.017
BC119666-1|AAI19667.1|  325|Homo sapiens solute carrier family 2...    39   0.017
AY358099-1|AAQ88466.1|  325|Homo sapiens UCP5 protein.                 39   0.017
AL035423-5|CAI42440.1|  353|Homo sapiens solute carrier family 2...    39   0.017
AL035423-4|CAI42441.1|  322|Homo sapiens solute carrier family 2...    39   0.017
AL035423-3|CAB41251.1|  325|Homo sapiens solute carrier family 2...    39   0.017
AF155811-1|AAG29584.1|  322|Homo sapiens mitochondrial uncouplin...    39   0.017
AF155810-1|AAG29583.1|  353|Homo sapiens mitochondrial uncouplin...    39   0.017
AF155809-1|AAG29582.1|  325|Homo sapiens mitochondrial uncouplin...    39   0.017
AF078544-1|AAD04346.1|  325|Homo sapiens brain mitochondrial car...    39   0.017
U84763-1|AAC51367.1|  312|Homo sapiens UCP3 protein.                   38   0.030
U82818-1|AAC51356.1|  275|Homo sapiens UCP3S protein.                  38   0.030
BC132739-1|AAI32740.1|  291|Homo sapiens solute carrier family 2...    38   0.030
AL627107-4|CAI23613.1|  291|Homo sapiens protein ( udogene, a no...    38   0.030
AF050113-1|AAG02284.1|  312|Homo sapiens uncoupling protein-3 pr...    38   0.030
AF012202-1|AAC51785.1|  300|Homo sapiens uncoupling protein 3 pr...    38   0.030
AF011449-1|AAC51767.1|  312|Homo sapiens uncoupling protein-3 pr...    38   0.030
AF001787-1|AAC51369.1|  312|Homo sapiens uncoupling protein 3 pr...    38   0.030
X96924-1|CAA65633.1|  318|Homo sapiens mitochondrial citrate tra...    38   0.040
X51952-1|CAA36214.1|  307|Homo sapiens uncoupling protein protein.     38   0.040
U28480-1|AAA85271.1|  307|Homo sapiens uncoupling protein protein.     38   0.040
U25147-1|AAB08515.1|  311|Homo sapiens citrate transporter prote...    38   0.040
L76134-1|AAL40091.1|  311|Homo sapiens citrate transport protein...    38   0.040
L75823-1|AAL40090.1|  311|Homo sapiens citrate transport protein...    38   0.040
BC098352-1|AAH98352.1|  306|Homo sapiens uncoupling protein 1 (m...    38   0.040
BC098258-1|AAH98258.1|  307|Homo sapiens uncoupling protein 1 (m...    38   0.040
BC098168-1|AAH98168.1|  307|Homo sapiens uncoupling protein 1 (m...    38   0.040
BC096736-1|AAH96736.1|  306|Homo sapiens uncoupling protein 1 (m...    38   0.040
BC069556-1|AAH69556.1|  307|Homo sapiens UCP1 protein protein.         38   0.040
BC008061-1|AAH08061.1|  311|Homo sapiens solute carrier family 2...    38   0.040
BC004980-1|AAH04980.1|  311|Homo sapiens solute carrier family 2...    38   0.040
AF026958-1|AAC18822.1|  312|Homo sapiens uncoupling protein 3 pr...    38   0.040
AC108019-1|AAY41026.1|  307|Homo sapiens unknown protein.              38   0.040
BC071871-1|AAH71871.1|  341|Homo sapiens solute carrier family 2...    37   0.092
BC019584-1|AAH19584.1|  341|Homo sapiens solute carrier family 2...    37   0.092
AK094254-1|BAC04318.1|  289|Homo sapiens protein ( Homo sapiens ...    37   0.092
BC041100-1|AAH41100.1|  335|Homo sapiens SLC25A45 protein protein.     35   0.37 
BC036869-1|AAH36869.1|  246|Homo sapiens solute carrier family 2...    35   0.37 
AK090434-1|BAC03415.1|  194|Homo sapiens FLJ00351 protein protein.     35   0.37 
AY597807-1|AAT09000.1|  184|Homo sapiens hypothetical protein pr...    34   0.65 
AY358711-1|AAQ89951.1|  323|Homo sapiens UCP4 protein.                 34   0.65 
AL591242-2|CAH73900.1|  323|Homo sapiens RP11-446F17.2 protein.        34   0.65 
AF110532-1|AAD16995.1|  323|Homo sapiens uncoupling protein UCP-...    34   0.65 
BC016932-1|AAH16932.1|  678|Homo sapiens solute carrier family 2...    33   0.86 
AY569438-1|AAS80155.1|  308|Homo sapiens hepatocellular carcinom...    33   0.86 
AJ496568-1|CAD43090.1|  678|Homo sapiens mitochondrial aspartate...    33   0.86 
AC068039-2|AAY24134.1|  678|Homo sapiens unknown protein.              33   0.86 
Y14494-1|CAA74834.1|  678|Homo sapiens aralar1 protein.                33   1.1  
Z98048-2|CAI20491.1|  307|Homo sapiens solute carrier family 25 ...    32   2.6  
Y12860-1|CAA73367.1|  307|Homo sapiens peroxisomal integral memb...    32   2.6  
CR456578-1|CAG30464.1|  315|Homo sapiens SLC25A18 protein.             32   2.6  
CR456577-1|CAG30463.1|  307|Homo sapiens SLC25A17 protein.             32   2.6  
BC031644-1|AAH31644.1|  315|Homo sapiens SLC25A18 protein protein.     32   2.6  
BC012998-1|AAH12998.1|  307|Homo sapiens solute carrier family 2...    32   2.6  
BC005957-1|AAH05957.1|  307|Homo sapiens solute carrier family 2...    32   2.6  
AY008285-1|AAG22855.1|  315|Homo sapiens solute carrier protein.       32   2.6  
AL683870-2|CAI39844.1|  158|Homo sapiens solute carrier family 2...    32   2.6  
AL049764-1|CAI20333.1|  307|Homo sapiens solute carrier family 2...    32   2.6  
AK126812-1|BAC86705.1|  291|Homo sapiens protein ( Homo sapiens ...    32   2.6  
AJ428203-1|CAD21008.1|  315|Homo sapiens glutamate carrier protein.    32   2.6  
Y17571-1|CAB62206.1|  675|Homo sapiens aralar2 protein.                30   8.0  
BC025747-1|AAH25747.1|  157|Homo sapiens LOC153328 protein protein.    30   8.0  
BC006566-1|AAH06566.1|  675|Homo sapiens solute carrier family 2...    30   8.0  
AK222864-1|BAD96584.1|  675|Homo sapiens solute carrier family 2...    30   8.0  
AJ496569-1|CAD43091.1|  676|Homo sapiens mitochondrial aspartate...    30   8.0  
AF118838-1|AAD38501.1|  675|Homo sapiens citrin protein.               30   8.0  
AC002540-1|AAB70112.1|  238|Homo sapiens unknown protein.              30   8.0  

>J04982-1|AAA51736.1|  298|Homo sapiens ANT1 protein.
          Length = 298

 Score =  118 bits (283), Expect = 3e-26
 Identities = 53/71 (74%), Positives = 59/71 (83%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGA 180
           ++SYPFDTVRRRMMMQSGR  +DI+Y  T+ CW  IAK EG   FFKGA+SNVLRG GGA
Sbjct: 226 LVSYPFDTVRRRMMMQSGRKGADIMYTGTVDCWRKIAKDEGAKAFFKGAWSNVLRGMGGA 285

Query: 181 FVLVLYDEIKK 213
           FVLVLYDEIKK
Sbjct: 286 FVLVLYDEIKK 296



 Score = 30.3 bits (65), Expect = 8.0
 Identities = 16/53 (30%), Positives = 28/53 (52%), Gaps = 2/53 (3%)
 Frame = +1

Query: 13  PFDTVRRRMMMQ--SGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR 165
           P + V+  + +Q  S +  ++  YK  I C   I K +G   F++G  +NV+R
Sbjct: 28  PIERVKLLLQVQHASKQISAEKQYKGIIDCVVRIPKEQGFLSFWRGNLANVIR 80


>BC063643-1|AAH63643.1|  298|Homo sapiens solute carrier family 25
           (mitochondrial carrier; adenine nucleotide translocato
           protein.
          Length = 298

 Score =  118 bits (283), Expect = 3e-26
 Identities = 53/71 (74%), Positives = 59/71 (83%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGA 180
           ++SYPFDTVRRRMMMQSGR  +DI+Y  T+ CW  IAK EG   FFKGA+SNVLRG GGA
Sbjct: 226 LVSYPFDTVRRRMMMQSGRKGADIMYTGTVDCWRKIAKDEGAKAFFKGAWSNVLRGMGGA 285

Query: 181 FVLVLYDEIKK 213
           FVLVLYDEIKK
Sbjct: 286 FVLVLYDEIKK 296



 Score = 30.3 bits (65), Expect = 8.0
 Identities = 16/53 (30%), Positives = 28/53 (52%), Gaps = 2/53 (3%)
 Frame = +1

Query: 13  PFDTVRRRMMMQ--SGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR 165
           P + V+  + +Q  S +  ++  YK  I C   I K +G   F++G  +NV+R
Sbjct: 28  PIERVKLLLQVQHASKQISAEKQYKGIIDCVVRIPKEQGFLSFWRGNLANVIR 80


>BC061589-1|AAH61589.1|  298|Homo sapiens solute carrier family 25
           (mitochondrial carrier; adenine nucleotide translocato
           protein.
          Length = 298

 Score =  118 bits (283), Expect = 3e-26
 Identities = 53/71 (74%), Positives = 59/71 (83%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGA 180
           ++SYPFDTVRRRMMMQSGR  +DI+Y  T+ CW  IAK EG   FFKGA+SNVLRG GGA
Sbjct: 226 LVSYPFDTVRRRMMMQSGRKGADIMYTGTVDCWRKIAKDEGAKAFFKGAWSNVLRGMGGA 285

Query: 181 FVLVLYDEIKK 213
           FVLVLYDEIKK
Sbjct: 286 FVLVLYDEIKK 296



 Score = 30.3 bits (65), Expect = 8.0
 Identities = 16/53 (30%), Positives = 28/53 (52%), Gaps = 2/53 (3%)
 Frame = +1

Query: 13  PFDTVRRRMMMQ--SGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR 165
           P + V+  + +Q  S +  ++  YK  I C   I K +G   F++G  +NV+R
Sbjct: 28  PIERVKLLLQVQHASKQISAEKQYKGIIDCVVRIPKEQGFLSFWRGNLANVIR 80


>BC008664-1|AAH08664.1|  298|Homo sapiens solute carrier family 25
           (mitochondrial carrier; adenine nucleotide translocato
           protein.
          Length = 298

 Score =  118 bits (283), Expect = 3e-26
 Identities = 53/71 (74%), Positives = 59/71 (83%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGA 180
           ++SYPFDTVRRRMMMQSGR  +DI+Y  T+ CW  IAK EG   FFKGA+SNVLRG GGA
Sbjct: 226 LVSYPFDTVRRRMMMQSGRKGADIMYTGTVDCWRKIAKDEGAKAFFKGAWSNVLRGMGGA 285

Query: 181 FVLVLYDEIKK 213
           FVLVLYDEIKK
Sbjct: 286 FVLVLYDEIKK 296



 Score = 30.3 bits (65), Expect = 8.0
 Identities = 16/53 (30%), Positives = 28/53 (52%), Gaps = 2/53 (3%)
 Frame = +1

Query: 13  PFDTVRRRMMMQ--SGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR 165
           P + V+  + +Q  S +  ++  YK  I C   I K +G   F++G  +NV+R
Sbjct: 28  PIERVKLLLQVQHASKQISAEKQYKGIIDCVVRIPKEQGFLSFWRGNLANVIR 80


>J02966-1|AAA61223.1|  297|Homo sapiens ANT1 protein.
          Length = 297

 Score =  117 bits (282), Expect = 4e-26
 Identities = 53/71 (74%), Positives = 59/71 (83%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGA 180
           ++SYPFDTVRRRMMMQSGR  +DI+Y  T+ CW  IAK EG   FFKGA+SNVLRG GGA
Sbjct: 225 LLSYPFDTVRRRMMMQSGRKGADIMYTGTVDCWRKIAKDEGAKAFFKGAWSNVLRGMGGA 284

Query: 181 FVLVLYDEIKK 213
           FVLVLYDEIKK
Sbjct: 285 FVLVLYDEIKK 295



 Score = 30.3 bits (65), Expect = 8.0
 Identities = 16/53 (30%), Positives = 28/53 (52%), Gaps = 2/53 (3%)
 Frame = +1

Query: 13  PFDTVRRRMMMQ--SGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR 165
           P + V+  + +Q  S +  ++  YK  I C   I K +G   F++G  +NV+R
Sbjct: 28  PIERVKLLLQVQHASKQISAEKQYKGIIDCVVRIPKEQGFLSFWRGNLANVIR 80


>J03592-1|AAA36750.1|  262|Homo sapiens protein ( Human ADP/ATP
           translocase mRNA, 3' end, clone pHAT8. ).
          Length = 262

 Score =  115 bits (277), Expect = 2e-25
 Identities = 51/73 (69%), Positives = 60/73 (82%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGA 180
           ++SYPFDTVRRRMMMQSGR  +DI+Y  T+ CW  I + EG   FFKGA+SNVLRG GGA
Sbjct: 190 VVSYPFDTVRRRMMMQSGRKGADIMYTGTVDCWRKIFRDEGGKAFFKGAWSNVLRGMGGA 249

Query: 181 FVLVLYDEIKKVL 219
           FVLVLYDE+KKV+
Sbjct: 250 FVLVLYDELKKVI 262


>CR457400-1|CAG33681.1|  298|Homo sapiens SLC25A6 protein.
          Length = 298

 Score =  115 bits (277), Expect = 2e-25
 Identities = 51/73 (69%), Positives = 60/73 (82%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGA 180
           ++SYPFDTVRRRMMMQSGR  +DI+Y  T+ CW  I + EG   FFKGA+SNVLRG GGA
Sbjct: 226 VVSYPFDTVRRRMMMQSGRKGADIMYTGTVDCWRKIFRDEGGKAFFKGAWSNVLRGMGGA 285

Query: 181 FVLVLYDEIKKVL 219
           FVLVLYDE+KKV+
Sbjct: 286 FVLVLYDELKKVI 298



 Score = 31.9 bits (69), Expect = 2.6
 Identities = 16/53 (30%), Positives = 28/53 (52%), Gaps = 2/53 (3%)
 Frame = +1

Query: 13  PFDTVRRRMMMQ--SGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR 165
           P + V+  + +Q  S +  +D  YK  + C   I K +G   F++G  +NV+R
Sbjct: 28  PIERVKLLLQVQHASKQIAADKQYKGIVDCIVRIPKEQGVLSFWRGNLANVIR 80


>BC031912-1|AAH31912.1|  298|Homo sapiens solute carrier family 25
           (mitochondrial carrier; adenine nucleotide translocato
           protein.
          Length = 298

 Score =  115 bits (277), Expect = 2e-25
 Identities = 51/73 (69%), Positives = 60/73 (82%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGA 180
           ++SYPFDTVRRRMMMQSGR  +DI+Y  T+ CW  I + EG   FFKGA+SNVLRG GGA
Sbjct: 226 VVSYPFDTVRRRMMMQSGRKGADIMYTGTVDCWRKIFRDEGGKAFFKGAWSNVLRGMGGA 285

Query: 181 FVLVLYDEIKKVL 219
           FVLVLYDE+KKV+
Sbjct: 286 FVLVLYDELKKVI 298



 Score = 31.9 bits (69), Expect = 2.6
 Identities = 16/53 (30%), Positives = 28/53 (52%), Gaps = 2/53 (3%)
 Frame = +1

Query: 13  PFDTVRRRMMMQ--SGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR 165
           P + V+  + +Q  S +  +D  YK  + C   I K +G   F++G  +NV+R
Sbjct: 28  PIERVKLLLQVQHASKQIAADKQYKGIVDCIVRIPKEQGVLSFWRGNLANVIR 80


>BC008935-1|AAH08935.1|  298|Homo sapiens solute carrier family 25
           (mitochondrial carrier; adenine nucleotide translocato
           protein.
          Length = 298

 Score =  115 bits (277), Expect = 2e-25
 Identities = 51/73 (69%), Positives = 60/73 (82%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGA 180
           ++SYPFDTVRRRMMMQSGR  +DI+Y  T+ CW  I + EG   FFKGA+SNVLRG GGA
Sbjct: 226 VVSYPFDTVRRRMMMQSGRKGADIMYTGTVDCWRKIFRDEGGKAFFKGAWSNVLRGMGGA 285

Query: 181 FVLVLYDEIKKVL 219
           FVLVLYDE+KKV+
Sbjct: 286 FVLVLYDELKKVI 298



 Score = 31.9 bits (69), Expect = 2.6
 Identities = 16/53 (30%), Positives = 28/53 (52%), Gaps = 2/53 (3%)
 Frame = +1

Query: 13  PFDTVRRRMMMQ--SGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR 165
           P + V+  + +Q  S +  +D  YK  + C   I K +G   F++G  +NV+R
Sbjct: 28  PIERVKLLLQVQHASKQIAADKQYKGIVDCIVRIPKEQGVLSFWRGNLANVIR 80


>BC008737-1|AAH08737.1|  298|Homo sapiens solute carrier family 25
           (mitochondrial carrier; adenine nucleotide translocato
           protein.
          Length = 298

 Score =  115 bits (277), Expect = 2e-25
 Identities = 51/73 (69%), Positives = 60/73 (82%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGA 180
           ++SYPFDTVRRRMMMQSGR  +DI+Y  T+ CW  I + EG   FFKGA+SNVLRG GGA
Sbjct: 226 VVSYPFDTVRRRMMMQSGRKGADIMYTGTVDCWRKIFRDEGGKAFFKGAWSNVLRGMGGA 285

Query: 181 FVLVLYDEIKKVL 219
           FVLVLYDE+KKV+
Sbjct: 286 FVLVLYDELKKVI 298



 Score = 31.9 bits (69), Expect = 2.6
 Identities = 16/53 (30%), Positives = 28/53 (52%), Gaps = 2/53 (3%)
 Frame = +1

Query: 13  PFDTVRRRMMMQ--SGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR 165
           P + V+  + +Q  S +  +D  YK  + C   I K +G   F++G  +NV+R
Sbjct: 28  PIERVKLLLQVQHASKQIAADKQYKGIVDCIVRIPKEQGVLSFWRGNLANVIR 80


>BC007850-1|AAH07850.1|  298|Homo sapiens solute carrier family 25
           (mitochondrial carrier; adenine nucleotide translocato
           protein.
          Length = 298

 Score =  115 bits (277), Expect = 2e-25
 Identities = 51/73 (69%), Positives = 60/73 (82%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGA 180
           ++SYPFDTVRRRMMMQSGR  +DI+Y  T+ CW  I + EG   FFKGA+SNVLRG GGA
Sbjct: 226 VVSYPFDTVRRRMMMQSGRKGADIMYTGTVDCWRKIFRDEGGKAFFKGAWSNVLRGMGGA 285

Query: 181 FVLVLYDEIKKVL 219
           FVLVLYDE+KKV+
Sbjct: 286 FVLVLYDELKKVI 298



 Score = 31.9 bits (69), Expect = 2.6
 Identities = 16/53 (30%), Positives = 28/53 (52%), Gaps = 2/53 (3%)
 Frame = +1

Query: 13  PFDTVRRRMMMQ--SGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR 165
           P + V+  + +Q  S +  +D  YK  + C   I K +G   F++G  +NV+R
Sbjct: 28  PIERVKLLLQVQHASKQIAADKQYKGIVDCIVRIPKEQGVLSFWRGNLANVIR 80


>BC007295-1|AAH07295.1|  298|Homo sapiens solute carrier family 25
           (mitochondrial carrier; adenine nucleotide translocato
           protein.
          Length = 298

 Score =  115 bits (277), Expect = 2e-25
 Identities = 51/73 (69%), Positives = 60/73 (82%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGA 180
           ++SYPFDTVRRRMMMQSGR  +DI+Y  T+ CW  I + EG   FFKGA+SNVLRG GGA
Sbjct: 226 VVSYPFDTVRRRMMMQSGRKGADIMYTGTVDCWRKIFRDEGGKAFFKGAWSNVLRGMGGA 285

Query: 181 FVLVLYDEIKKVL 219
           FVLVLYDE+KKV+
Sbjct: 286 FVLVLYDELKKVI 298



 Score = 31.9 bits (69), Expect = 2.6
 Identities = 16/53 (30%), Positives = 28/53 (52%), Gaps = 2/53 (3%)
 Frame = +1

Query: 13  PFDTVRRRMMMQ--SGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR 165
           P + V+  + +Q  S +  +D  YK  + C   I K +G   F++G  +NV+R
Sbjct: 28  PIERVKLLLQVQHASKQIAADKQYKGIVDCIVRIPKEQGVLSFWRGNLANVIR 80


>AY007135-1|AAG01998.1|  298|Homo sapiens protein ( Homo sapiens
           clone CDABP0051 mRNA sequence. ).
          Length = 298

 Score =  115 bits (277), Expect = 2e-25
 Identities = 51/73 (69%), Positives = 60/73 (82%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGA 180
           ++SYPFDTVRRRMMMQSGR  +DI+Y  T+ CW  I + EG   FFKGA+SNVLRG GGA
Sbjct: 226 VVSYPFDTVRRRMMMQSGRKGADIMYTGTVDCWRKIFRDEGGKAFFKGAWSNVLRGMGGA 285

Query: 181 FVLVLYDEIKKVL 219
           FVLVLYDE+KKV+
Sbjct: 286 FVLVLYDELKKVI 298



 Score = 31.9 bits (69), Expect = 2.6
 Identities = 16/53 (30%), Positives = 28/53 (52%), Gaps = 2/53 (3%)
 Frame = +1

Query: 13  PFDTVRRRMMMQ--SGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR 165
           P + V+  + +Q  S +  +D  YK  + C   I K +G   F++G  +NV+R
Sbjct: 28  PIERVKLLLQVQHASKQIAADKQYKGIVDCIVRIPKEQGVLSFWRGNLANVIR 80


>AL683870-1|CAI39843.1|  298|Homo sapiens solute carrier family 25
           (mitochondrial carrier; adenine nucleotide translocato
           protein.
          Length = 298

 Score =  115 bits (277), Expect = 2e-25
 Identities = 51/73 (69%), Positives = 60/73 (82%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGA 180
           ++SYPFDTVRRRMMMQSGR  +DI+Y  T+ CW  I + EG   FFKGA+SNVLRG GGA
Sbjct: 226 VVSYPFDTVRRRMMMQSGRKGADIMYTGTVDCWRKIFRDEGGKAFFKGAWSNVLRGMGGA 285

Query: 181 FVLVLYDEIKKVL 219
           FVLVLYDE+KKV+
Sbjct: 286 FVLVLYDELKKVI 298



 Score = 31.9 bits (69), Expect = 2.6
 Identities = 16/53 (30%), Positives = 28/53 (52%), Gaps = 2/53 (3%)
 Frame = +1

Query: 13  PFDTVRRRMMMQ--SGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR 165
           P + V+  + +Q  S +  +D  YK  + C   I K +G   F++G  +NV+R
Sbjct: 28  PIERVKLLLQVQHASKQIAADKQYKGIVDCIVRIPKEQGVLSFWRGNLANVIR 80


>AB209822-1|BAD93059.1|  323|Homo sapiens ADP,ATP carrier protein,
           liver isoform T2 variant protein.
          Length = 323

 Score =  115 bits (277), Expect = 2e-25
 Identities = 51/73 (69%), Positives = 60/73 (82%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGA 180
           ++SYPFDTVRRRMMMQSGR  +DI+Y  T+ CW  I + EG   FFKGA+SNVLRG GGA
Sbjct: 251 VVSYPFDTVRRRMMMQSGRKGADIMYTGTVDCWRKIFRDEGGKAFFKGAWSNVLRGMGGA 310

Query: 181 FVLVLYDEIKKVL 219
           FVLVLYDE+KKV+
Sbjct: 311 FVLVLYDELKKVI 323



 Score = 31.9 bits (69), Expect = 2.6
 Identities = 16/53 (30%), Positives = 28/53 (52%), Gaps = 2/53 (3%)
 Frame = +1

Query: 13  PFDTVRRRMMMQ--SGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR 165
           P + V+  + +Q  S +  +D  YK  + C   I K +G   F++G  +NV+R
Sbjct: 53  PIERVKLLLQVQHASKQIAADKQYKGIVDCIVRIPKEQGVLSFWRGNLANVIR 105


>M57424-1|AAA51737.1|  298|Homo sapiens adenine nucleotide
           translocator-2 protein.
          Length = 298

 Score =  113 bits (273), Expect = 5e-25
 Identities = 52/71 (73%), Positives = 58/71 (81%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGA 180
           + SYPFDTVRRRMMMQSGR  +DI+Y  T+ CW  IA+ EG   FFKGA+SNVLRG GGA
Sbjct: 226 LTSYPFDTVRRRMMMQSGRKGTDIMYTGTLDCWRKIARDEGGKAFFKGAWSNVLRGMGGA 285

Query: 181 FVLVLYDEIKK 213
           FVLVLYDEIKK
Sbjct: 286 FVLVLYDEIKK 296



 Score = 32.3 bits (70), Expect = 2.0
 Identities = 17/53 (32%), Positives = 28/53 (52%), Gaps = 2/53 (3%)
 Frame = +1

Query: 13  PFDTVRRRMMMQ--SGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR 165
           P + V+  + +Q  S +  +D  YK  I C   I K +G   F++G  +NV+R
Sbjct: 28  PIERVKLLLQVQHASKQITADKQYKGIIDCVVRIPKEQGVLSFWRGNLANVIR 80


>L78810-1|AAB39266.1|  298|Homo sapiens ANT-2 protein.
          Length = 298

 Score =  113 bits (273), Expect = 5e-25
 Identities = 52/71 (73%), Positives = 58/71 (81%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGA 180
           + SYPFDTVRRRMMMQSGR  +DI+Y  T+ CW  IA+ EG   FFKGA+SNVLRG GGA
Sbjct: 226 LTSYPFDTVRRRMMMQSGRKGTDIMYTGTLDCWRKIARDEGGKAFFKGAWSNVLRGMGGA 285

Query: 181 FVLVLYDEIKK 213
           FVLVLYDEIKK
Sbjct: 286 FVLVLYDEIKK 296



 Score = 32.3 bits (70), Expect = 2.0
 Identities = 17/53 (32%), Positives = 28/53 (52%), Gaps = 2/53 (3%)
 Frame = +1

Query: 13  PFDTVRRRMMMQ--SGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR 165
           P + V+  + +Q  S +  +D  YK  I C   I K +G   F++G  +NV+R
Sbjct: 28  PIERVKLLLQVQHASKQITADKQYKGIIDCVVRIPKEQGVLSFWRGNLANVIR 80


>J03591-1|AAA36749.1|  252|Homo sapiens protein ( Human ADP/ATP
           translocase mRNA, 3' end, clone pHAT3. ).
          Length = 252

 Score =  113 bits (273), Expect = 5e-25
 Identities = 52/71 (73%), Positives = 58/71 (81%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGA 180
           + SYPFDTVRRRMMMQSGR  +DI+Y  T+ CW  IA+ EG   FFKGA+SNVLRG GGA
Sbjct: 180 LTSYPFDTVRRRMMMQSGRKGTDIMYTGTLDCWRKIARDEGGKAFFKGAWSNVLRGMGGA 239

Query: 181 FVLVLYDEIKK 213
           FVLVLYDEIKK
Sbjct: 240 FVLVLYDEIKK 250


>J02683-1|AAA35579.1|  298|Homo sapiens protein ( Human ADP/ATP
           carrier protein mRNA, complete cds. ).
          Length = 298

 Score =  113 bits (273), Expect = 5e-25
 Identities = 52/71 (73%), Positives = 58/71 (81%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGA 180
           + SYPFDTVRRRMMMQSGR  +DI+Y  T+ CW  IA+ EG   FFKGA+SNVLRG GGA
Sbjct: 226 LTSYPFDTVRRRMMMQSGRKGTDIMYTGTLDCWRKIARDEGGKAFFKGAWSNVLRGMGGA 285

Query: 181 FVLVLYDEIKK 213
           FVLVLYDEIKK
Sbjct: 286 FVLVLYDEIKK 296


>BC068199-1|AAH68199.1|  323|Homo sapiens SLC25A5 protein protein.
          Length = 323

 Score =  113 bits (273), Expect = 5e-25
 Identities = 52/71 (73%), Positives = 58/71 (81%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGA 180
           + SYPFDTVRRRMMMQSGR  +DI+Y  T+ CW  IA+ EG   FFKGA+SNVLRG GGA
Sbjct: 251 LTSYPFDTVRRRMMMQSGRKGTDIMYTGTLDCWRKIARDEGGKAFFKGAWSNVLRGMGGA 310

Query: 181 FVLVLYDEIKK 213
           FVLVLYDEIKK
Sbjct: 311 FVLVLYDEIKK 321



 Score = 32.3 bits (70), Expect = 2.0
 Identities = 17/53 (32%), Positives = 28/53 (52%), Gaps = 2/53 (3%)
 Frame = +1

Query: 13  PFDTVRRRMMMQ--SGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR 165
           P + V+  + +Q  S +  +D  YK  I C   I K +G   F++G  +NV+R
Sbjct: 53  PIERVKLLLQVQHASKQITADKQYKGIIDCVVRIPKEQGVLSFWRGNLANVIR 105


>BC056160-1|AAH56160.1|  298|Homo sapiens solute carrier family 25
           (mitochondrial carrier; adenine nucleotide translocato
           protein.
          Length = 298

 Score =  113 bits (273), Expect = 5e-25
 Identities = 52/71 (73%), Positives = 58/71 (81%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGA 180
           + SYPFDTVRRRMMMQSGR  +DI+Y  T+ CW  IA+ EG   FFKGA+SNVLRG GGA
Sbjct: 226 LTSYPFDTVRRRMMMQSGRKGTDIMYTGTLDCWRKIARDEGGKAFFKGAWSNVLRGMGGA 285

Query: 181 FVLVLYDEIKK 213
           FVLVLYDEIKK
Sbjct: 286 FVLVLYDEIKK 296



 Score = 32.3 bits (70), Expect = 2.0
 Identities = 17/53 (32%), Positives = 28/53 (52%), Gaps = 2/53 (3%)
 Frame = +1

Query: 13  PFDTVRRRMMMQ--SGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR 165
           P + V+  + +Q  S +  +D  YK  I C   I K +G   F++G  +NV+R
Sbjct: 28  PIERVKLLLQVQHASKQITADKQYKGIIDCVVRIPKEQGVLSFWRGNLANVIR 80


>AC004000-1|AAB96347.1|  298|Homo sapiens ADP/ATP carrier protein
           (adenine nucleotide translocator 2) protein.
          Length = 298

 Score =  113 bits (273), Expect = 5e-25
 Identities = 52/71 (73%), Positives = 58/71 (81%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGA 180
           + SYPFDTVRRRMMMQSGR  +DI+Y  T+ CW  IA+ EG   FFKGA+SNVLRG GGA
Sbjct: 226 LTSYPFDTVRRRMMMQSGRKGTDIMYTGTLDCWRKIARDEGGKAFFKGAWSNVLRGMGGA 285

Query: 181 FVLVLYDEIKK 213
           FVLVLYDEIKK
Sbjct: 286 FVLVLYDEIKK 296



 Score = 32.3 bits (70), Expect = 2.0
 Identities = 17/53 (32%), Positives = 28/53 (52%), Gaps = 2/53 (3%)
 Frame = +1

Query: 13  PFDTVRRRMMMQ--SGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR 165
           P + V+  + +Q  S +  +D  YK  I C   I K +G   F++G  +NV+R
Sbjct: 28  PIERVKLLLQVQHASKQITADKQYKGIIDCVVRIPKEQGVLSFWRGNLANVIR 80


>BC014775-1|AAH14775.1|  298|Homo sapiens solute carrier family 25
           (mitochondrial carrier; adenine nucleotide translocato
           protein.
          Length = 298

 Score =  113 bits (271), Expect = 9e-25
 Identities = 50/73 (68%), Positives = 59/73 (80%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGA 180
           ++SYPFDTVRRRMMMQ GR  +DI+Y  T+ CW  I + EG   FFKGA+SNVLRG GGA
Sbjct: 226 VVSYPFDTVRRRMMMQFGRKGADIMYTGTVDCWRKIFRDEGGKAFFKGAWSNVLRGMGGA 285

Query: 181 FVLVLYDEIKKVL 219
           FVLVLYDE+KKV+
Sbjct: 286 FVLVLYDELKKVI 298



 Score = 31.9 bits (69), Expect = 2.6
 Identities = 16/53 (30%), Positives = 28/53 (52%), Gaps = 2/53 (3%)
 Frame = +1

Query: 13  PFDTVRRRMMMQ--SGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR 165
           P + V+  + +Q  S +  +D  YK  + C   I K +G   F++G  +NV+R
Sbjct: 28  PIERVKLLLQVQHASKQIAADKQYKGIVDCIVRIPKEQGVLSFWRGNLANVIR 80


>BC022032-1|AAH22032.1|  315|Homo sapiens solute carrier family 25
           (mitochondrial carrier; adenine nucleotide translocato
           protein.
          Length = 315

 Score =  103 bits (246), Expect = 9e-22
 Identities = 50/71 (70%), Positives = 57/71 (80%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGA 180
           I+SYPFDTVRRRMMMQSG AK    YK T+ C+  I + EG S FF+GAFSNVLRGTGGA
Sbjct: 238 ILSYPFDTVRRRMMMQSGEAKRQ--YKGTLDCFVKIYQHEGISSFFRGAFSNVLRGTGGA 295

Query: 181 FVLVLYDEIKK 213
            VLVLYD+IK+
Sbjct: 296 LVLVLYDKIKE 306



 Score = 30.7 bits (66), Expect = 6.0
 Identities = 13/47 (27%), Positives = 24/47 (51%)
 Frame = +1

Query: 4   ISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKG 144
           + YP D  R R+ +  G+   +  +K    C   IAK++G +  ++G
Sbjct: 142 VVYPLDFARTRLGVDIGKGPEERQFKGLGDCIMKIAKSDGIAGLYQG 188


>AY550240-1|AAT42263.1|  315|Homo sapiens sperm flagellar energy
           carrier protein protein.
          Length = 315

 Score =  103 bits (246), Expect = 9e-22
 Identities = 50/71 (70%), Positives = 57/71 (80%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGA 180
           I+SYPFDTVRRRMMMQSG AK    YK T+ C+  I + EG S FF+GAFSNVLRGTGGA
Sbjct: 238 ILSYPFDTVRRRMMMQSGEAKRQ--YKGTLDCFVKIYQHEGISSFFRGAFSNVLRGTGGA 295

Query: 181 FVLVLYDEIKK 213
            VLVLYD+IK+
Sbjct: 296 LVLVLYDKIKE 306



 Score = 30.7 bits (66), Expect = 6.0
 Identities = 13/47 (27%), Positives = 24/47 (51%)
 Frame = +1

Query: 4   ISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKG 144
           + YP D  R R+ +  G+   +  +K    C   IAK++G +  ++G
Sbjct: 142 VVYPLDFARTRLGVDIGKGPEERQFKGLGDCIMKIAKSDGIAGLYQG 188


>AJ863129-1|CAI05952.1|  315|Homo sapiens ADP/ATP carrier isoform 4
           protein.
          Length = 315

 Score =  103 bits (246), Expect = 9e-22
 Identities = 50/71 (70%), Positives = 57/71 (80%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGA 180
           I+SYPFDTVRRRMMMQSG AK    YK T+ C+  I + EG S FF+GAFSNVLRGTGGA
Sbjct: 238 ILSYPFDTVRRRMMMQSGEAKRQ--YKGTLDCFVKIYQHEGISSFFRGAFSNVLRGTGGA 295

Query: 181 FVLVLYDEIKK 213
            VLVLYD+IK+
Sbjct: 296 LVLVLYDKIKE 306



 Score = 30.7 bits (66), Expect = 6.0
 Identities = 13/47 (27%), Positives = 24/47 (51%)
 Frame = +1

Query: 4   ISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKG 144
           + YP D  R R+ +  G+   +  +K    C   IAK++G +  ++G
Sbjct: 142 VVYPLDFARTRLGVDIGKGPEERQFKGLGDCIMKIAKSDGIAGLYQG 188


>AC093591-1|AAY40974.1|  315|Homo sapiens unknown protein.
          Length = 315

 Score =  103 bits (246), Expect = 9e-22
 Identities = 50/71 (70%), Positives = 57/71 (80%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGA 180
           I+SYPFDTVRRRMMMQSG AK    YK T+ C+  I + EG S FF+GAFSNVLRGTGGA
Sbjct: 238 ILSYPFDTVRRRMMMQSGEAKRQ--YKGTLDCFVKIYQHEGISSFFRGAFSNVLRGTGGA 295

Query: 181 FVLVLYDEIKK 213
            VLVLYD+IK+
Sbjct: 296 LVLVLYDKIKE 306



 Score = 30.7 bits (66), Expect = 6.0
 Identities = 13/47 (27%), Positives = 24/47 (51%)
 Frame = +1

Query: 4   ISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKG 144
           + YP D  R R+ +  G+   +  +K    C   IAK++G +  ++G
Sbjct: 142 VVYPLDFARTRLGVDIGKGPEERQFKGLGDCIMKIAKSDGIAGLYQG 188


>U94592-1|AAB53091.1|  309|Homo sapiens uncoupling protein homolog
           protein.
          Length = 309

 Score = 40.3 bits (90), Expect = 0.007
 Identities = 26/73 (35%), Positives = 37/73 (50%), Gaps = 1/73 (1%)
 Frame = +1

Query: 4   ISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGT-GGA 180
           ++ P D V+ R   Q+ RA     Y++T++ + TIA+ EG    +KG   NV R      
Sbjct: 133 VAQPTDVVKVRFQAQA-RAGGGRRYQSTVNAYKTIAREEGFRGLWKGTSPNVARNAIVNC 191

Query: 181 FVLVLYDEIKKVL 219
             LV YD IK  L
Sbjct: 192 AELVTYDLIKDAL 204



 Score = 37.9 bits (84), Expect = 0.040
 Identities = 23/74 (31%), Positives = 38/74 (51%), Gaps = 1/74 (1%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR-GTGG 177
           +I+ P D V+ R M  S   +    Y +  HC  T+ + EG   F+KG   + LR G+  
Sbjct: 230 VIASPVDVVKTRYM-NSALGQ----YSSAGHCALTMLQKEGPRAFYKGFMPSFLRLGSWN 284

Query: 178 AFVLVLYDEIKKVL 219
             + V Y+++K+ L
Sbjct: 285 VVMFVTYEQLKRAL 298


>U82819-1|AAC51336.1|  309|Homo sapiens UCP2 protein.
          Length = 309

 Score = 40.3 bits (90), Expect = 0.007
 Identities = 26/73 (35%), Positives = 37/73 (50%), Gaps = 1/73 (1%)
 Frame = +1

Query: 4   ISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGT-GGA 180
           ++ P D V+ R   Q+ RA     Y++T++ + TIA+ EG    +KG   NV R      
Sbjct: 133 VAQPTDVVKVRFQAQA-RAGGGRRYQSTVNAYKTIAREEGFRGLWKGTSPNVARNAIVNC 191

Query: 181 FVLVLYDEIKKVL 219
             LV YD IK  L
Sbjct: 192 AELVTYDLIKDAL 204



 Score = 37.9 bits (84), Expect = 0.040
 Identities = 23/74 (31%), Positives = 38/74 (51%), Gaps = 1/74 (1%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR-GTGG 177
           +I+ P D V+ R M  S   +    Y +  HC  T+ + EG   F+KG   + LR G+  
Sbjct: 230 VIASPVDVVKTRYM-NSALGQ----YSSAGHCALTMLQKEGPRAFYKGFMPSFLRLGSWN 284

Query: 178 AFVLVLYDEIKKVL 219
             + V Y+++K+ L
Sbjct: 285 VVMFVTYEQLKRAL 298


>U76367-1|AAB48411.1|  309|Homo sapiens uncoupling protein-2
           protein.
          Length = 309

 Score = 40.3 bits (90), Expect = 0.007
 Identities = 26/73 (35%), Positives = 37/73 (50%), Gaps = 1/73 (1%)
 Frame = +1

Query: 4   ISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGT-GGA 180
           ++ P D V+ R   Q+ RA     Y++T++ + TIA+ EG    +KG   NV R      
Sbjct: 133 VAQPTDVVKVRFQAQA-RAGGGRRYQSTVNAYKTIAREEGFRGLWKGTSPNVARNAIVNC 191

Query: 181 FVLVLYDEIKKVL 219
             LV YD IK  L
Sbjct: 192 AELVTYDLIKDAL 204



 Score = 37.9 bits (84), Expect = 0.040
 Identities = 23/74 (31%), Positives = 38/74 (51%), Gaps = 1/74 (1%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR-GTGG 177
           +I+ P D V+ R M  S   +    Y +  HC  T+ + EG   F+KG   + LR G+  
Sbjct: 230 VIASPVDVVKTRYM-NSALGQ----YSSAGHCALTMLQKEGPRAFYKGFMPSFLRLGSWN 284

Query: 178 AFVLVLYDEIKKVL 219
             + V Y+++K+ L
Sbjct: 285 VVMFVTYEQLKRAL 298


>DQ087219-1|AAY68217.1|  309|Homo sapiens uncoupling protein 2
           (mitochondrial, proton carrier) protein.
          Length = 309

 Score = 40.3 bits (90), Expect = 0.007
 Identities = 26/73 (35%), Positives = 37/73 (50%), Gaps = 1/73 (1%)
 Frame = +1

Query: 4   ISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGT-GGA 180
           ++ P D V+ R   Q+ RA     Y++T++ + TIA+ EG    +KG   NV R      
Sbjct: 133 VAQPTDVVKVRFQAQA-RAGGGRRYQSTVNAYKTIAREEGFRGLWKGTSPNVARNAIVNC 191

Query: 181 FVLVLYDEIKKVL 219
             LV YD IK  L
Sbjct: 192 AELVTYDLIKDAL 204



 Score = 37.9 bits (84), Expect = 0.040
 Identities = 23/74 (31%), Positives = 38/74 (51%), Gaps = 1/74 (1%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR-GTGG 177
           +I+ P D V+ R M  S   +    Y +  HC  T+ + EG   F+KG   + LR G+  
Sbjct: 230 VIASPVDVVKTRYM-NSALGQ----YSSAGHCALTMLQKEGPRAFYKGFMPSFLRLGSWN 284

Query: 178 AFVLVLYDEIKKVL 219
             + V Y+++K+ L
Sbjct: 285 VVMFVTYEQLKRAL 298


>BC011737-1|AAH11737.1|  309|Homo sapiens uncoupling protein 2
           (mitochondrial, proton carrier) protein.
          Length = 309

 Score = 40.3 bits (90), Expect = 0.007
 Identities = 26/73 (35%), Positives = 37/73 (50%), Gaps = 1/73 (1%)
 Frame = +1

Query: 4   ISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGT-GGA 180
           ++ P D V+ R   Q+ RA     Y++T++ + TIA+ EG    +KG   NV R      
Sbjct: 133 VAQPTDVVKVRFQAQA-RAGGGRRYQSTVNAYKTIAREEGFRGLWKGTSPNVARNAIVNC 191

Query: 181 FVLVLYDEIKKVL 219
             LV YD IK  L
Sbjct: 192 AELVTYDLIKDAL 204



 Score = 37.9 bits (84), Expect = 0.040
 Identities = 23/74 (31%), Positives = 38/74 (51%), Gaps = 1/74 (1%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR-GTGG 177
           +I+ P D V+ R M  S   +    Y +  HC  T+ + EG   F+KG   + LR G+  
Sbjct: 230 VIASPVDVVKTRYM-NSALGQ----YSSAGHCALTMLQKEGPRAFYKGFMPSFLRLGSWN 284

Query: 178 AFVLVLYDEIKKVL 219
             + V Y+++K+ L
Sbjct: 285 VVMFVTYEQLKRAL 298


>AK222557-1|BAD96277.1|  309|Homo sapiens uncoupling protein 2
           variant protein.
          Length = 309

 Score = 40.3 bits (90), Expect = 0.007
 Identities = 26/73 (35%), Positives = 37/73 (50%), Gaps = 1/73 (1%)
 Frame = +1

Query: 4   ISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGT-GGA 180
           ++ P D V+ R   Q+ RA     Y++T++ + TIA+ EG    +KG   NV R      
Sbjct: 133 VAQPTDVVKVRFQAQA-RAGGGRRYQSTVNAYKTIAREEGFRGLWKGTSPNVARNAIVNC 191

Query: 181 FVLVLYDEIKKVL 219
             LV YD IK  L
Sbjct: 192 AELVTYDLIKDAL 204



 Score = 37.9 bits (84), Expect = 0.040
 Identities = 23/74 (31%), Positives = 38/74 (51%), Gaps = 1/74 (1%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR-GTGG 177
           +I+ P D V+ R M  S   +    Y +  HC  T+ + EG   F+KG   + LR G+  
Sbjct: 230 VIASPVDVVKTRYM-NSALGQ----YSSAGHCALTMLQKEGPRAFYKGFMPSFLRLGSWN 284

Query: 178 AFVLVLYDEIKKVL 219
             + V Y+++K+ L
Sbjct: 285 VVMFVTYEQLKRAL 298


>AK222540-1|BAD96260.1|  309|Homo sapiens uncoupling protein 2
           variant protein.
          Length = 309

 Score = 40.3 bits (90), Expect = 0.007
 Identities = 26/73 (35%), Positives = 37/73 (50%), Gaps = 1/73 (1%)
 Frame = +1

Query: 4   ISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGT-GGA 180
           ++ P D V+ R   Q+ RA     Y++T++ + TIA+ EG    +KG   NV R      
Sbjct: 133 VAQPTDVVKVRFQAQA-RAGGGRRYQSTVNAYKTIAREEGFRGLWKGTSPNVARNAIVNC 191

Query: 181 FVLVLYDEIKKVL 219
             LV YD IK  L
Sbjct: 192 AELVTYDLIKDAL 204



 Score = 37.9 bits (84), Expect = 0.040
 Identities = 23/74 (31%), Positives = 38/74 (51%), Gaps = 1/74 (1%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR-GTGG 177
           +I+ P D V+ R M  S   +    Y +  HC  T+ + EG   F+KG   + LR G+  
Sbjct: 230 VIASPVDVVKTRYM-NSALGQ----YSSAGHCALTMLQKEGPRAFYKGFMPSFLRLGSWN 284

Query: 178 AFVLVLYDEIKKVL 219
             + V Y+++K+ L
Sbjct: 285 VVMFVTYEQLKRAL 298


>AJ223477-1|CAA11402.1|  309|Homo sapiens uncoupling protein 2
           protein.
          Length = 309

 Score = 40.3 bits (90), Expect = 0.007
 Identities = 26/73 (35%), Positives = 37/73 (50%), Gaps = 1/73 (1%)
 Frame = +1

Query: 4   ISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGT-GGA 180
           ++ P D V+ R   Q+ RA     Y++T++ + TIA+ EG    +KG   NV R      
Sbjct: 133 VAQPTDVVKVRFQAQA-RAGGGRRYQSTVNAYKTIAREEGFRGLWKGTSPNVARNAIVNC 191

Query: 181 FVLVLYDEIKKVL 219
             LV YD IK  L
Sbjct: 192 AELVTYDLIKDAL 204



 Score = 37.9 bits (84), Expect = 0.040
 Identities = 23/74 (31%), Positives = 38/74 (51%), Gaps = 1/74 (1%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR-GTGG 177
           +I+ P D V+ R M  S   +    Y +  HC  T+ + EG   F+KG   + LR G+  
Sbjct: 230 VIASPVDVVKTRYM-NSALGQ----YSSAGHCALTMLQKEGPRAFYKGFMPSFLRLGSWN 284

Query: 178 AFVLVLYDEIKKVL 219
             + V Y+++K+ L
Sbjct: 285 VVMFVTYEQLKRAL 298


>AF096289-1|AAD21151.1|  309|Homo sapiens uncoupling protein-2
           protein.
          Length = 309

 Score = 40.3 bits (90), Expect = 0.007
 Identities = 26/73 (35%), Positives = 37/73 (50%), Gaps = 1/73 (1%)
 Frame = +1

Query: 4   ISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGT-GGA 180
           ++ P D V+ R   Q+ RA     Y++T++ + TIA+ EG    +KG   NV R      
Sbjct: 133 VAQPTDVVKVRFQAQA-RAGGGRRYQSTVNAYKTIAREEGFRGLWKGTSPNVARNAIVNC 191

Query: 181 FVLVLYDEIKKVL 219
             LV YD IK  L
Sbjct: 192 AELVTYDLIKDAL 204



 Score = 37.9 bits (84), Expect = 0.040
 Identities = 23/74 (31%), Positives = 38/74 (51%), Gaps = 1/74 (1%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR-GTGG 177
           +I+ P D V+ R M  S   +    Y +  HC  T+ + EG   F+KG   + LR G+  
Sbjct: 230 VIASPVDVVKTRYM-NSALGQ----YSSAGHCALTMLQKEGPRAFYKGFMPSFLRLGSWN 284

Query: 178 AFVLVLYDEIKKVL 219
             + V Y+++K+ L
Sbjct: 285 VVMFVTYEQLKRAL 298


>AF019409-1|AAC39690.1|  309|Homo sapiens uncoupling protein 2
           protein.
          Length = 309

 Score = 40.3 bits (90), Expect = 0.007
 Identities = 26/73 (35%), Positives = 37/73 (50%), Gaps = 1/73 (1%)
 Frame = +1

Query: 4   ISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGT-GGA 180
           ++ P D V+ R   Q+ RA     Y++T++ + TIA+ EG    +KG   NV R      
Sbjct: 133 VAQPTDVVKVRFQAQA-RAGGGRRYQSTVNAYKTIAREEGFRGLWKGTSPNVARNAIVNC 191

Query: 181 FVLVLYDEIKKVL 219
             LV YD IK  L
Sbjct: 192 AELVTYDLIKDAL 204



 Score = 37.9 bits (84), Expect = 0.040
 Identities = 23/74 (31%), Positives = 38/74 (51%), Gaps = 1/74 (1%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR-GTGG 177
           +I+ P D V+ R M  S   +    Y +  HC  T+ + EG   F+KG   + LR G+  
Sbjct: 230 VIASPVDVVKTRYM-NSALGQ----YSSAGHCALTMLQKEGPRAFYKGFMPSFLRLGSWN 284

Query: 178 AFVLVLYDEIKKVL 219
             + V Y+++K+ L
Sbjct: 285 VVMFVTYEQLKRAL 298


>BC113365-1|AAI13366.1|  299|Homo sapiens solute carrier family 25
           (mitochondrial oxodicarboxylate carrier), member 21
           protein.
          Length = 299

 Score = 39.5 bits (88), Expect = 0.013
 Identities = 20/68 (29%), Positives = 35/68 (51%), Gaps = 1/68 (1%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR-GTGG 177
           +I+ PFD  + R+         +I Y+      AT+ + EG    +KG    ++R G GG
Sbjct: 223 VINIPFDVAKSRIQGPQP-VPGEIKYRTCFKTMATVYQEEGILALYKGLLPKIMRLGPGG 281

Query: 178 AFVLVLYD 201
           A +L++Y+
Sbjct: 282 AVMLLVYE 289


>BC101521-1|AAI01522.1|  299|Homo sapiens solute carrier family 25
           (mitochondrial oxodicarboxylate carrier), member 21
           protein.
          Length = 299

 Score = 39.5 bits (88), Expect = 0.013
 Identities = 20/68 (29%), Positives = 35/68 (51%), Gaps = 1/68 (1%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR-GTGG 177
           +I+ PFD  + R+         +I Y+      AT+ + EG    +KG    ++R G GG
Sbjct: 223 VINIPFDVAKSRIQGPQP-VPGEIKYRTCFKTMATVYQEEGILALYKGLLPKIMRLGPGG 281

Query: 178 AFVLVLYD 201
           A +L++Y+
Sbjct: 282 AVMLLVYE 289


>AK172788-1|BAD18767.1|  303|Homo sapiens protein ( Homo sapiens
           cDNA FLJ23949 fis, clone HEP08438. ).
          Length = 303

 Score = 39.5 bits (88), Expect = 0.013
 Identities = 18/54 (33%), Positives = 31/54 (57%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVL 162
           ++ +PFDTV+ R+ +QS        Y+ T+HC+ +I K E     +KG  S ++
Sbjct: 17  LVGHPFDTVKVRLQVQSVEKPQ---YRGTLHCFKSIIKQESVLGLYKGLGSPLM 67


>AJ278148-1|CAC27562.1|  299|Homo sapiens oxodicarboxylate carrier
           protein.
          Length = 299

 Score = 39.5 bits (88), Expect = 0.013
 Identities = 20/68 (29%), Positives = 35/68 (51%), Gaps = 1/68 (1%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR-GTGG 177
           +I+ PFD  + R+         +I Y+      AT+ + EG    +KG    ++R G GG
Sbjct: 223 VINIPFDVAKSRIQGPQP-VPGEIKYRTCFKTMATVYQEEGILALYKGLLPKIMRLGPGG 281

Query: 178 AFVLVLYD 201
           A +L++Y+
Sbjct: 282 AVMLLVYE 289


>BC119667-1|AAI19668.1|  325|Homo sapiens solute carrier family 25
           (mitochondrial carrier, brain), member 14 protein.
          Length = 325

 Score = 39.1 bits (87), Expect = 0.017
 Identities = 24/73 (32%), Positives = 35/73 (47%), Gaps = 1/73 (1%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR-GTGG 177
           + S P D VR RMM Q        LYK T+     + K EG    +KG + N LR G   
Sbjct: 251 LASNPVDVVRTRMMNQRAIVGHVDLYKGTVDGILKMWKHEGFFALYKGFWPNWLRLGPWN 310

Query: 178 AFVLVLYDEIKKV 216
               + Y+++K++
Sbjct: 311 IIFFITYEQLKRL 323


>BC119666-1|AAI19667.1|  325|Homo sapiens solute carrier family 25
           (mitochondrial carrier, brain), member 14 protein.
          Length = 325

 Score = 39.1 bits (87), Expect = 0.017
 Identities = 24/73 (32%), Positives = 35/73 (47%), Gaps = 1/73 (1%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR-GTGG 177
           + S P D VR RMM Q        LYK T+     + K EG    +KG + N LR G   
Sbjct: 251 LASNPVDVVRTRMMNQRAIVGHVDLYKGTVDGILKMWKHEGFFALYKGFWPNWLRLGPWN 310

Query: 178 AFVLVLYDEIKKV 216
               + Y+++K++
Sbjct: 311 IIFFITYEQLKRL 323


>AY358099-1|AAQ88466.1|  325|Homo sapiens UCP5 protein.
          Length = 325

 Score = 39.1 bits (87), Expect = 0.017
 Identities = 24/73 (32%), Positives = 35/73 (47%), Gaps = 1/73 (1%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR-GTGG 177
           + S P D VR RMM Q        LYK T+     + K EG    +KG + N LR G   
Sbjct: 251 LASNPVDVVRTRMMNQRAIVGHVDLYKGTVDGILKMWKHEGFFALYKGFWPNWLRLGPWN 310

Query: 178 AFVLVLYDEIKKV 216
               + Y+++K++
Sbjct: 311 IIFFITYEQLKRL 323


>AL035423-5|CAI42440.1|  353|Homo sapiens solute carrier family 25
           (mitochondrial carrier, brain), member 14 protein.
          Length = 353

 Score = 39.1 bits (87), Expect = 0.017
 Identities = 24/73 (32%), Positives = 35/73 (47%), Gaps = 1/73 (1%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR-GTGG 177
           + S P D VR RMM Q        LYK T+     + K EG    +KG + N LR G   
Sbjct: 279 LASNPVDVVRTRMMNQRAIVGHVDLYKGTVDGILKMWKHEGFFALYKGFWPNWLRLGPWN 338

Query: 178 AFVLVLYDEIKKV 216
               + Y+++K++
Sbjct: 339 IIFFITYEQLKRL 351


>AL035423-4|CAI42441.1|  322|Homo sapiens solute carrier family 25
           (mitochondrial carrier, brain), member 14 protein.
          Length = 322

 Score = 39.1 bits (87), Expect = 0.017
 Identities = 24/73 (32%), Positives = 35/73 (47%), Gaps = 1/73 (1%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR-GTGG 177
           + S P D VR RMM Q        LYK T+     + K EG    +KG + N LR G   
Sbjct: 248 LASNPVDVVRTRMMNQRAIVGHVDLYKGTVDGILKMWKHEGFFALYKGFWPNWLRLGPWN 307

Query: 178 AFVLVLYDEIKKV 216
               + Y+++K++
Sbjct: 308 IIFFITYEQLKRL 320


>AL035423-3|CAB41251.1|  325|Homo sapiens solute carrier family 25
           (mitochondrial carrier, brain), member 14 protein.
          Length = 325

 Score = 39.1 bits (87), Expect = 0.017
 Identities = 24/73 (32%), Positives = 35/73 (47%), Gaps = 1/73 (1%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR-GTGG 177
           + S P D VR RMM Q        LYK T+     + K EG    +KG + N LR G   
Sbjct: 251 LASNPVDVVRTRMMNQRAIVGHVDLYKGTVDGILKMWKHEGFFALYKGFWPNWLRLGPWN 310

Query: 178 AFVLVLYDEIKKV 216
               + Y+++K++
Sbjct: 311 IIFFITYEQLKRL 323


>AF155811-1|AAG29584.1|  322|Homo sapiens mitochondrial uncoupling
           protein 5 short form protein.
          Length = 322

 Score = 39.1 bits (87), Expect = 0.017
 Identities = 24/73 (32%), Positives = 35/73 (47%), Gaps = 1/73 (1%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR-GTGG 177
           + S P D VR RMM Q        LYK T+     + K EG    +KG + N LR G   
Sbjct: 248 LASNPVDVVRTRMMNQRAIVGHVDLYKGTVDGILKMWKHEGFFALYKGFWPNWLRLGPWN 307

Query: 178 AFVLVLYDEIKKV 216
               + Y+++K++
Sbjct: 308 IIFFITYEQLKRL 320


>AF155810-1|AAG29583.1|  353|Homo sapiens mitochondrial uncoupling
           protein 5 short form with insertion protein.
          Length = 353

 Score = 39.1 bits (87), Expect = 0.017
 Identities = 24/73 (32%), Positives = 35/73 (47%), Gaps = 1/73 (1%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR-GTGG 177
           + S P D VR RMM Q        LYK T+     + K EG    +KG + N LR G   
Sbjct: 279 LASNPVDVVRTRMMNQRAIVGHVDLYKGTVDGILKMWKHEGFFALYKGFWPNWLRLGPWN 338

Query: 178 AFVLVLYDEIKKV 216
               + Y+++K++
Sbjct: 339 IIFFITYEQLKRL 351


>AF155809-1|AAG29582.1|  325|Homo sapiens mitochondrial uncoupling
           protein 5 long form protein.
          Length = 325

 Score = 39.1 bits (87), Expect = 0.017
 Identities = 24/73 (32%), Positives = 35/73 (47%), Gaps = 1/73 (1%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR-GTGG 177
           + S P D VR RMM Q        LYK T+     + K EG    +KG + N LR G   
Sbjct: 251 LASNPVDVVRTRMMNQRAIVGHVDLYKGTVDGILKMWKHEGFFALYKGFWPNWLRLGPWN 310

Query: 178 AFVLVLYDEIKKV 216
               + Y+++K++
Sbjct: 311 IIFFITYEQLKRL 323


>AF078544-1|AAD04346.1|  325|Homo sapiens brain mitochondrial
           carrier protein-1 protein.
          Length = 325

 Score = 39.1 bits (87), Expect = 0.017
 Identities = 24/73 (32%), Positives = 35/73 (47%), Gaps = 1/73 (1%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR-GTGG 177
           + S P D VR RMM Q        LYK T+     + K EG    +KG + N LR G   
Sbjct: 251 LASNPVDVVRTRMMNQRAIVGHVDLYKGTVDGILKMWKHEGFFALYKGFWPNWLRLGPWN 310

Query: 178 AFVLVLYDEIKKV 216
               + Y+++K++
Sbjct: 311 IIFFITYEQLKRL 323


>U84763-1|AAC51367.1|  312|Homo sapiens UCP3 protein.
          Length = 312

 Score = 38.3 bits (85), Expect = 0.030
 Identities = 23/72 (31%), Positives = 36/72 (50%), Gaps = 3/72 (4%)
 Frame = +1

Query: 13  PFDTVRRRMM--MQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGT-GGAF 183
           P D V+ R    +  G ++SD  Y  T+  + TIA+ EG    +KG   N++R       
Sbjct: 136 PTDVVKVRFQASIHLGPSRSDRKYSGTMDAYRTIAREEGVRGLWKGTLPNIMRNAIVNCA 195

Query: 184 VLVLYDEIKKVL 219
            +V YD +K+ L
Sbjct: 196 EVVTYDILKEKL 207


>U82818-1|AAC51356.1|  275|Homo sapiens UCP3S protein.
          Length = 275

 Score = 38.3 bits (85), Expect = 0.030
 Identities = 23/72 (31%), Positives = 36/72 (50%), Gaps = 3/72 (4%)
 Frame = +1

Query: 13  PFDTVRRRMM--MQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGT-GGAF 183
           P D V+ R    +  G ++SD  Y  T+  + TIA+ EG    +KG   N++R       
Sbjct: 136 PTDVVKVRFQASIHLGPSRSDRKYSGTMDAYRTIAREEGVRGLWKGTLPNIMRNAIVNCA 195

Query: 184 VLVLYDEIKKVL 219
            +V YD +K+ L
Sbjct: 196 EVVTYDILKEKL 207


>BC132739-1|AAI32740.1|  291|Homo sapiens solute carrier family 25,
           member 30 protein.
          Length = 291

 Score = 38.3 bits (85), Expect = 0.030
 Identities = 26/77 (33%), Positives = 36/77 (46%), Gaps = 5/77 (6%)
 Frame = +1

Query: 1   IISYPFDTVRRRMM----MQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR- 165
           + S P D VR RMM    ++ GR      Y  T+ C     K EG    +KG + N LR 
Sbjct: 216 LASNPVDVVRTRMMNQRVLRDGRCSG---YTGTLDCLLQTWKNEGFFALYKGFWPNWLRL 272

Query: 166 GTGGAFVLVLYDEIKKV 216
           G       V Y+++KK+
Sbjct: 273 GPWNIIFFVTYEQLKKL 289


>AL627107-4|CAI23613.1|  291|Homo sapiens protein ( udogene, a novel
           gene (possible).).
          Length = 291

 Score = 38.3 bits (85), Expect = 0.030
 Identities = 26/77 (33%), Positives = 36/77 (46%), Gaps = 5/77 (6%)
 Frame = +1

Query: 1   IISYPFDTVRRRMM----MQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR- 165
           + S P D VR RMM    ++ GR      Y  T+ C     K EG    +KG + N LR 
Sbjct: 216 LASNPVDVVRTRMMNQRVLRDGRCSG---YTGTLDCLLQTWKNEGFFALYKGFWPNWLRL 272

Query: 166 GTGGAFVLVLYDEIKKV 216
           G       V Y+++KK+
Sbjct: 273 GPWNIIFFVTYEQLKKL 289


>AF050113-1|AAG02284.1|  312|Homo sapiens uncoupling protein-3
           protein.
          Length = 312

 Score = 38.3 bits (85), Expect = 0.030
 Identities = 23/72 (31%), Positives = 36/72 (50%), Gaps = 3/72 (4%)
 Frame = +1

Query: 13  PFDTVRRRMM--MQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGT-GGAF 183
           P D V+ R    +  G ++SD  Y  T+  + TIA+ EG    +KG   N++R       
Sbjct: 136 PTDVVKVRFQASIHLGPSRSDRKYSGTMDAYRTIAREEGVRGLWKGTLPNIMRNAIVNCA 195

Query: 184 VLVLYDEIKKVL 219
            +V YD +K+ L
Sbjct: 196 EVVTYDILKEKL 207


>AF012202-1|AAC51785.1|  300|Homo sapiens uncoupling protein 3
           protein.
          Length = 300

 Score = 38.3 bits (85), Expect = 0.030
 Identities = 23/72 (31%), Positives = 36/72 (50%), Gaps = 3/72 (4%)
 Frame = +1

Query: 13  PFDTVRRRMM--MQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGT-GGAF 183
           P D V+ R    +  G ++SD  Y  T+  + TIA+ EG    +KG   N++R       
Sbjct: 124 PTDVVKVRFQASIHLGPSRSDRKYSGTMDAYRTIAREEGVRGLWKGTLPNIMRNAIVNCA 183

Query: 184 VLVLYDEIKKVL 219
            +V YD +K+ L
Sbjct: 184 EVVTYDILKEKL 195


>AF011449-1|AAC51767.1|  312|Homo sapiens uncoupling protein-3
           protein.
          Length = 312

 Score = 38.3 bits (85), Expect = 0.030
 Identities = 23/72 (31%), Positives = 36/72 (50%), Gaps = 3/72 (4%)
 Frame = +1

Query: 13  PFDTVRRRMM--MQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGT-GGAF 183
           P D V+ R    +  G ++SD  Y  T+  + TIA+ EG    +KG   N++R       
Sbjct: 136 PTDVVKVRFQASIHLGPSRSDRKYSGTMDAYRTIAREEGVRGLWKGTLPNIMRNAIVNCA 195

Query: 184 VLVLYDEIKKVL 219
            +V YD +K+ L
Sbjct: 196 EVVTYDILKEKL 207


>AF001787-1|AAC51369.1|  312|Homo sapiens uncoupling protein 3
           protein.
          Length = 312

 Score = 38.3 bits (85), Expect = 0.030
 Identities = 23/72 (31%), Positives = 36/72 (50%), Gaps = 3/72 (4%)
 Frame = +1

Query: 13  PFDTVRRRMM--MQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGT-GGAF 183
           P D V+ R    +  G ++SD  Y  T+  + TIA+ EG    +KG   N++R       
Sbjct: 136 PTDVVKVRFQASIHLGPSRSDRKYSGTMDAYRTIAREEGVRGLWKGTLPNIMRNAIVNCA 195

Query: 184 VLVLYDEIKKVL 219
            +V YD +K+ L
Sbjct: 196 EVVTYDILKEKL 207


>X96924-1|CAA65633.1|  318|Homo sapiens mitochondrial citrate
           transport protein protein.
          Length = 318

 Score = 37.9 bits (84), Expect = 0.040
 Identities = 26/70 (37%), Positives = 34/70 (48%), Gaps = 1/70 (1%)
 Frame = +1

Query: 13  PFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR-GTGGAFVL 189
           P D ++ RM  Q   A     Y+NT  C   I K EG   F+KG    + R     A V 
Sbjct: 247 PLDVIKTRM--QGLEAHK---YRNTWDCGLQILKKEGLKAFYKGTVPRLGRVCLDVAIVF 301

Query: 190 VLYDEIKKVL 219
           V+YDE+ K+L
Sbjct: 302 VIYDEVVKLL 311


>X51952-1|CAA36214.1|  307|Homo sapiens uncoupling protein protein.
          Length = 307

 Score = 37.9 bits (84), Expect = 0.040
 Identities = 20/75 (26%), Positives = 38/75 (50%), Gaps = 2/75 (2%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDIL-YKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGG 177
           +I++P DT + R+ +Q     S ++ YK  +     + KTEG    + G  + + R    
Sbjct: 29  VITFPLDTAKVRLQVQGECPTSSVIRYKGVLGTITAVVKTEGRMKLYSGLPAGLQRQISS 88

Query: 178 AFVLV-LYDEIKKVL 219
           A + + LYD +++ L
Sbjct: 89  ASLRIGLYDTVQEFL 103



 Score = 33.1 bits (72), Expect = 1.1
 Identities = 22/71 (30%), Positives = 33/71 (46%), Gaps = 1/71 (1%)
 Frame = +1

Query: 4   ISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGT-GGA 180
           I  P + V+ R+  QS        Y  T + +  IA TEG +  +KG   N++R      
Sbjct: 130 IGQPTEVVKVRLQAQSHLHGIKPRYTGTYNAYRIIATTEGLTGLWKGTTPNLMRSVIINC 189

Query: 181 FVLVLYDEIKK 213
             LV YD +K+
Sbjct: 190 TELVTYDLMKE 200



 Score = 32.3 bits (70), Expect = 2.0
 Identities = 15/49 (30%), Positives = 27/49 (55%), Gaps = 1/49 (2%)
 Frame = +1

Query: 76  YKNTIHCWATIAKTEGTSPFFKGAFSNVLR-GTGGAFVLVLYDEIKKVL 219
           YK+  +C   +   EG + FFKG   + LR G+    + V ++++K+ L
Sbjct: 248 YKSVPNCAMKVFTNEGPTAFFKGLVPSFLRLGSWNVIMFVCFEQLKREL 296


>U28480-1|AAA85271.1|  307|Homo sapiens uncoupling protein protein.
          Length = 307

 Score = 37.9 bits (84), Expect = 0.040
 Identities = 20/75 (26%), Positives = 38/75 (50%), Gaps = 2/75 (2%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDIL-YKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGG 177
           +I++P DT + R+ +Q     S ++ YK  +     + KTEG    + G  + + R    
Sbjct: 29  VITFPLDTAKVRLQVQGECPTSSVIRYKGVLGTITAVVKTEGRMKLYSGLPAGLQRQISS 88

Query: 178 AFVLV-LYDEIKKVL 219
           A + + LYD +++ L
Sbjct: 89  ASLRIGLYDTVQEFL 103



 Score = 33.1 bits (72), Expect = 1.1
 Identities = 22/71 (30%), Positives = 33/71 (46%), Gaps = 1/71 (1%)
 Frame = +1

Query: 4   ISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGT-GGA 180
           I  P + V+ R+  QS        Y  T + +  IA TEG +  +KG   N++R      
Sbjct: 130 IGQPTEVVKVRLQAQSHLHGIKPRYTGTYNAYRIIATTEGLTGLWKGTTPNLMRSVIINC 189

Query: 181 FVLVLYDEIKK 213
             LV YD +K+
Sbjct: 190 TELVTYDLMKE 200



 Score = 32.3 bits (70), Expect = 2.0
 Identities = 15/49 (30%), Positives = 27/49 (55%), Gaps = 1/49 (2%)
 Frame = +1

Query: 76  YKNTIHCWATIAKTEGTSPFFKGAFSNVLR-GTGGAFVLVLYDEIKKVL 219
           YK+  +C   +   EG + FFKG   + LR G+    + V ++++K+ L
Sbjct: 248 YKSVPNCAMKVFTNEGPTAFFKGLVPSFLRLGSWNVIMFVCFEQLKREL 296


>U25147-1|AAB08515.1|  311|Homo sapiens citrate transporter protein
           protein.
          Length = 311

 Score = 37.9 bits (84), Expect = 0.040
 Identities = 26/70 (37%), Positives = 34/70 (48%), Gaps = 1/70 (1%)
 Frame = +1

Query: 13  PFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR-GTGGAFVL 189
           P D ++ RM  Q   A     Y+NT  C   I K EG   F+KG    + R     A V 
Sbjct: 240 PLDVIKTRM--QGLEAHK---YRNTWDCGLQILKKEGLKAFYKGTVPRLGRVCLDVAIVF 294

Query: 190 VLYDEIKKVL 219
           V+YDE+ K+L
Sbjct: 295 VIYDEVVKLL 304


>L76134-1|AAL40091.1|  311|Homo sapiens citrate transport protein
           protein.
          Length = 311

 Score = 37.9 bits (84), Expect = 0.040
 Identities = 26/70 (37%), Positives = 34/70 (48%), Gaps = 1/70 (1%)
 Frame = +1

Query: 13  PFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR-GTGGAFVL 189
           P D ++ RM  Q   A     Y+NT  C   I K EG   F+KG    + R     A V 
Sbjct: 240 PLDVIKTRM--QGLEAHK---YRNTWDCGLQILKKEGLKAFYKGTVPRLGRVCLDVAIVF 294

Query: 190 VLYDEIKKVL 219
           V+YDE+ K+L
Sbjct: 295 VIYDEVVKLL 304


>L75823-1|AAL40090.1|  311|Homo sapiens citrate transport protein
           protein.
          Length = 311

 Score = 37.9 bits (84), Expect = 0.040
 Identities = 26/70 (37%), Positives = 34/70 (48%), Gaps = 1/70 (1%)
 Frame = +1

Query: 13  PFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR-GTGGAFVL 189
           P D ++ RM  Q   A     Y+NT  C   I K EG   F+KG    + R     A V 
Sbjct: 240 PLDVIKTRM--QGLEAHK---YRNTWDCGLQILKKEGLKAFYKGTVPRLGRVCLDVAIVF 294

Query: 190 VLYDEIKKVL 219
           V+YDE+ K+L
Sbjct: 295 VIYDEVVKLL 304


>BC098352-1|AAH98352.1|  306|Homo sapiens uncoupling protein 1
           (mitochondrial, proton carrier) protein.
          Length = 306

 Score = 37.9 bits (84), Expect = 0.040
 Identities = 20/75 (26%), Positives = 38/75 (50%), Gaps = 2/75 (2%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDIL-YKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGG 177
           +I++P DT + R+ +Q     S ++ YK  +     + KTEG    + G  + + R    
Sbjct: 29  VITFPLDTAKVRLQVQGECPTSSVIRYKGVLGTITAVVKTEGRMKLYSGLPAGLQRQISS 88

Query: 178 AFVLV-LYDEIKKVL 219
           A + + LYD +++ L
Sbjct: 89  ASLRIGLYDTVQEFL 103



 Score = 33.1 bits (72), Expect = 1.1
 Identities = 22/71 (30%), Positives = 33/71 (46%), Gaps = 1/71 (1%)
 Frame = +1

Query: 4   ISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGT-GGA 180
           I  P + V+ R+  QS        Y  T + +  IA TEG +  +KG   N++R      
Sbjct: 129 IGQPTEVVKVRLQAQSHLHGIKPRYTGTYNAYRIIATTEGLTGLWKGTTPNLMRSVIINC 188

Query: 181 FVLVLYDEIKK 213
             LV YD +K+
Sbjct: 189 TELVTYDLMKE 199



 Score = 32.3 bits (70), Expect = 2.0
 Identities = 15/49 (30%), Positives = 27/49 (55%), Gaps = 1/49 (2%)
 Frame = +1

Query: 76  YKNTIHCWATIAKTEGTSPFFKGAFSNVLR-GTGGAFVLVLYDEIKKVL 219
           YK+  +C   +   EG + FFKG   + LR G+    + V ++++K+ L
Sbjct: 247 YKSVPNCAMKVFTNEGPTAFFKGLVPSFLRLGSWNVIMFVCFEQLKREL 295


>BC098258-1|AAH98258.1|  307|Homo sapiens uncoupling protein 1
           (mitochondrial, proton carrier) protein.
          Length = 307

 Score = 37.9 bits (84), Expect = 0.040
 Identities = 20/75 (26%), Positives = 38/75 (50%), Gaps = 2/75 (2%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDIL-YKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGG 177
           +I++P DT + R+ +Q     S ++ YK  +     + KTEG    + G  + + R    
Sbjct: 29  VITFPLDTAKVRLQVQGECPTSSVIRYKGVLGTITAVVKTEGRMKLYSGLPAGLQRQISS 88

Query: 178 AFVLV-LYDEIKKVL 219
           A + + LYD +++ L
Sbjct: 89  ASLRIGLYDTVQEFL 103



 Score = 33.1 bits (72), Expect = 1.1
 Identities = 22/71 (30%), Positives = 33/71 (46%), Gaps = 1/71 (1%)
 Frame = +1

Query: 4   ISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGT-GGA 180
           I  P + V+ R+  QS        Y  T + +  IA TEG +  +KG   N++R      
Sbjct: 130 IGQPTEVVKVRLQAQSHLHGIKPRYTGTYNAYRIIATTEGLTGLWKGTTPNLMRSVIINC 189

Query: 181 FVLVLYDEIKK 213
             LV YD +K+
Sbjct: 190 TELVTYDLMKE 200



 Score = 32.3 bits (70), Expect = 2.0
 Identities = 15/49 (30%), Positives = 27/49 (55%), Gaps = 1/49 (2%)
 Frame = +1

Query: 76  YKNTIHCWATIAKTEGTSPFFKGAFSNVLR-GTGGAFVLVLYDEIKKVL 219
           YK+  +C   +   EG + FFKG   + LR G+    + V ++++K+ L
Sbjct: 248 YKSVPNCAMKVFTNEGPTAFFKGLVPSFLRLGSWNVIMFVCFEQLKREL 296


>BC098168-1|AAH98168.1|  307|Homo sapiens uncoupling protein 1
           (mitochondrial, proton carrier) protein.
          Length = 307

 Score = 37.9 bits (84), Expect = 0.040
 Identities = 20/75 (26%), Positives = 38/75 (50%), Gaps = 2/75 (2%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDIL-YKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGG 177
           +I++P DT + R+ +Q     S ++ YK  +     + KTEG    + G  + + R    
Sbjct: 29  VITFPLDTAKVRLQVQGECPTSSVIRYKGVLGTITAVVKTEGRMKLYSGLPAGLQRQISS 88

Query: 178 AFVLV-LYDEIKKVL 219
           A + + LYD +++ L
Sbjct: 89  ASLRIGLYDTVQEFL 103



 Score = 33.1 bits (72), Expect = 1.1
 Identities = 22/71 (30%), Positives = 33/71 (46%), Gaps = 1/71 (1%)
 Frame = +1

Query: 4   ISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGT-GGA 180
           I  P + V+ R+  QS        Y  T + +  IA TEG +  +KG   N++R      
Sbjct: 130 IGQPTEVVKVRLQAQSHLHGIKPRYTGTYNAYRIIATTEGLTGLWKGTTPNLMRSVIINC 189

Query: 181 FVLVLYDEIKK 213
             LV YD +K+
Sbjct: 190 TELVTYDLMKE 200



 Score = 32.3 bits (70), Expect = 2.0
 Identities = 15/49 (30%), Positives = 27/49 (55%), Gaps = 1/49 (2%)
 Frame = +1

Query: 76  YKNTIHCWATIAKTEGTSPFFKGAFSNVLR-GTGGAFVLVLYDEIKKVL 219
           YK+  +C   +   EG + FFKG   + LR G+    + V ++++K+ L
Sbjct: 248 YKSVPNCAMKVFTNEGPTAFFKGLVPSFLRLGSWNVIMFVCFEQLKREL 296


>BC096736-1|AAH96736.1|  306|Homo sapiens uncoupling protein 1
           (mitochondrial, proton carrier) protein.
          Length = 306

 Score = 37.9 bits (84), Expect = 0.040
 Identities = 20/75 (26%), Positives = 38/75 (50%), Gaps = 2/75 (2%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDIL-YKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGG 177
           +I++P DT + R+ +Q     S ++ YK  +     + KTEG    + G  + + R    
Sbjct: 29  VITFPLDTAKVRLQVQGECPTSSVIRYKGVLGTITAVVKTEGRMKLYSGLPAGLQRQISS 88

Query: 178 AFVLV-LYDEIKKVL 219
           A + + LYD +++ L
Sbjct: 89  ASLRIGLYDTVQEFL 103



 Score = 33.1 bits (72), Expect = 1.1
 Identities = 22/71 (30%), Positives = 33/71 (46%), Gaps = 1/71 (1%)
 Frame = +1

Query: 4   ISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGT-GGA 180
           I  P + V+ R+  QS        Y  T + +  IA TEG +  +KG   N++R      
Sbjct: 129 IGQPTEVVKVRLQAQSHLHGIKPRYTGTYNAYRIIATTEGLTGLWKGTTPNLMRSVIINC 188

Query: 181 FVLVLYDEIKK 213
             LV YD +K+
Sbjct: 189 TELVTYDLMKE 199



 Score = 32.3 bits (70), Expect = 2.0
 Identities = 15/49 (30%), Positives = 27/49 (55%), Gaps = 1/49 (2%)
 Frame = +1

Query: 76  YKNTIHCWATIAKTEGTSPFFKGAFSNVLR-GTGGAFVLVLYDEIKKVL 219
           YK+  +C   +   EG + FFKG   + LR G+    + V ++++K+ L
Sbjct: 247 YKSVPNCAMKVFTNEGPTAFFKGLVPSFLRLGSWNVIMFVCFEQLKREL 295


>BC069556-1|AAH69556.1|  307|Homo sapiens UCP1 protein protein.
          Length = 307

 Score = 37.9 bits (84), Expect = 0.040
 Identities = 20/75 (26%), Positives = 38/75 (50%), Gaps = 2/75 (2%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDIL-YKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGG 177
           +I++P DT + R+ +Q     S ++ YK  +     + KTEG    + G  + + R    
Sbjct: 29  VITFPLDTAKVRLQVQGECPTSSVIRYKGVLGTITAVVKTEGRMKLYSGLPAGLQRQISS 88

Query: 178 AFVLV-LYDEIKKVL 219
           A + + LYD +++ L
Sbjct: 89  ASLRIGLYDTVQEFL 103



 Score = 33.1 bits (72), Expect = 1.1
 Identities = 22/71 (30%), Positives = 33/71 (46%), Gaps = 1/71 (1%)
 Frame = +1

Query: 4   ISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGT-GGA 180
           I  P + V+ R+  QS        Y  T + +  IA TEG +  +KG   N++R      
Sbjct: 130 IGQPTEVVKVRLQAQSHLHGIKPRYTGTYNAYRIIATTEGLTGLWKGTTPNLMRSVIINC 189

Query: 181 FVLVLYDEIKK 213
             LV YD +K+
Sbjct: 190 TELVTYDLMKE 200



 Score = 32.3 bits (70), Expect = 2.0
 Identities = 15/49 (30%), Positives = 27/49 (55%), Gaps = 1/49 (2%)
 Frame = +1

Query: 76  YKNTIHCWATIAKTEGTSPFFKGAFSNVLR-GTGGAFVLVLYDEIKKVL 219
           YK+  +C   +   EG + FFKG   + LR G+    + V ++++K+ L
Sbjct: 248 YKSVPNCAMKVFTNEGPTAFFKGLVPSFLRLGSWNVIMFVCFEQLKREL 296


>BC008061-1|AAH08061.1|  311|Homo sapiens solute carrier family 25
           (mitochondrial carrier; citrate transporter), member 1
           protein.
          Length = 311

 Score = 37.9 bits (84), Expect = 0.040
 Identities = 26/70 (37%), Positives = 34/70 (48%), Gaps = 1/70 (1%)
 Frame = +1

Query: 13  PFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR-GTGGAFVL 189
           P D ++ RM  Q   A     Y+NT  C   I K EG   F+KG    + R     A V 
Sbjct: 240 PLDVIKTRM--QGLEAHK---YRNTWDCGLQILKKEGLKAFYKGTVPRLGRVCLDVAIVF 294

Query: 190 VLYDEIKKVL 219
           V+YDE+ K+L
Sbjct: 295 VIYDEVVKLL 304


>BC004980-1|AAH04980.1|  311|Homo sapiens solute carrier family 25
           (mitochondrial carrier; citrate transporter), member 1
           protein.
          Length = 311

 Score = 37.9 bits (84), Expect = 0.040
 Identities = 26/70 (37%), Positives = 34/70 (48%), Gaps = 1/70 (1%)
 Frame = +1

Query: 13  PFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR-GTGGAFVL 189
           P D ++ RM  Q   A     Y+NT  C   I K EG   F+KG    + R     A V 
Sbjct: 240 PLDVIKTRM--QGLEAHK---YRNTWDCGLQILKKEGLKAFYKGTVPRLGRVCLDVAIVF 294

Query: 190 VLYDEIKKVL 219
           V+YDE+ K+L
Sbjct: 295 VIYDEVVKLL 304


>AF026958-1|AAC18822.1|  312|Homo sapiens uncoupling protein 3
           protein.
          Length = 312

 Score = 37.9 bits (84), Expect = 0.040
 Identities = 23/72 (31%), Positives = 37/72 (51%), Gaps = 3/72 (4%)
 Frame = +1

Query: 13  PFDTVRRRMM--MQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGT-GGAF 183
           P D V+ R    +  G ++SD  Y  T+  + TIA+ EG    +KG   N++R     + 
Sbjct: 136 PTDVVKVRFQASIHLGPSRSDRKYSGTMDAYRTIAREEGVRGLWKGTLPNIMRNAIVKSA 195

Query: 184 VLVLYDEIKKVL 219
            +V YD +K+ L
Sbjct: 196 EVVTYDILKEKL 207


>AC108019-1|AAY41026.1|  307|Homo sapiens unknown protein.
          Length = 307

 Score = 37.9 bits (84), Expect = 0.040
 Identities = 20/75 (26%), Positives = 38/75 (50%), Gaps = 2/75 (2%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDIL-YKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGG 177
           +I++P DT + R+ +Q     S ++ YK  +     + KTEG    + G  + + R    
Sbjct: 29  VITFPLDTAKVRLQVQGECPTSSVIRYKGVLGTITAVVKTEGRMKLYSGLPAGLQRQISS 88

Query: 178 AFVLV-LYDEIKKVL 219
           A + + LYD +++ L
Sbjct: 89  ASLRIGLYDTVQEFL 103



 Score = 33.1 bits (72), Expect = 1.1
 Identities = 22/71 (30%), Positives = 33/71 (46%), Gaps = 1/71 (1%)
 Frame = +1

Query: 4   ISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGT-GGA 180
           I  P + V+ R+  QS        Y  T + +  IA TEG +  +KG   N++R      
Sbjct: 130 IGQPTEVVKVRLQAQSHLHGIKPRYTGTYNAYRIIATTEGLTGLWKGTTPNLMRSVIINC 189

Query: 181 FVLVLYDEIKK 213
             LV YD +K+
Sbjct: 190 TELVTYDLMKE 200



 Score = 32.3 bits (70), Expect = 2.0
 Identities = 15/49 (30%), Positives = 27/49 (55%), Gaps = 1/49 (2%)
 Frame = +1

Query: 76  YKNTIHCWATIAKTEGTSPFFKGAFSNVLR-GTGGAFVLVLYDEIKKVL 219
           YK+  +C   +   EG + FFKG   + LR G+    + V ++++K+ L
Sbjct: 248 YKSVPNCAMKVFTNEGPTAFFKGLVPSFLRLGSWNVIMFVCFEQLKREL 296


>BC071871-1|AAH71871.1|  341|Homo sapiens solute carrier family 25,
           member 43 protein.
          Length = 341

 Score = 36.7 bits (81), Expect = 0.092
 Identities = 17/58 (29%), Positives = 31/58 (53%), Gaps = 4/58 (6%)
 Frame = +1

Query: 4   ISYPFDTVRRRMMMQS----GRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR 165
           +S+PF+TV+R+M  QS         D+ +   + C+  I K +G    + G  +N+L+
Sbjct: 218 LSFPFETVKRKMQAQSPYLPHSGGVDVHFSGAVDCFRQIVKAQGVLGLWNGLTANLLK 275


>BC019584-1|AAH19584.1|  341|Homo sapiens solute carrier family 25,
           member 43 protein.
          Length = 341

 Score = 36.7 bits (81), Expect = 0.092
 Identities = 17/58 (29%), Positives = 31/58 (53%), Gaps = 4/58 (6%)
 Frame = +1

Query: 4   ISYPFDTVRRRMMMQS----GRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR 165
           +S+PF+TV+R+M  QS         D+ +   + C+  I K +G    + G  +N+L+
Sbjct: 218 LSFPFETVKRKMQAQSPYLPHSGGVDVHFSGAVDCFRQIVKAQGVLGLWNGLTANLLK 275


>AK094254-1|BAC04318.1|  289|Homo sapiens protein ( Homo sapiens
           cDNA FLJ36935 fis, clone BRACE2005363, weakly similar to
           BRITTLE-1 PROTEIN PRECURSOR. ).
          Length = 289

 Score = 36.7 bits (81), Expect = 0.092
 Identities = 17/58 (29%), Positives = 31/58 (53%), Gaps = 4/58 (6%)
 Frame = +1

Query: 4   ISYPFDTVRRRMMMQS----GRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR 165
           +S+PF+TV+R+M  QS         D+ +   + C+  I K +G    + G  +N+L+
Sbjct: 166 LSFPFETVKRKMQAQSPYLPHSGGVDVHFSGAVDCFRQIVKAQGVLGLWNGLTANLLK 223


>BC041100-1|AAH41100.1|  335|Homo sapiens SLC25A45 protein protein.
          Length = 335

 Score = 34.7 bits (76), Expect = 0.37
 Identities = 20/57 (35%), Positives = 32/57 (56%), Gaps = 4/57 (7%)
 Frame = +1

Query: 13  PFDTVRRRMMMQSG-RAKSDI---LYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGT 171
           PFD ++ R+  Q+  RA+       Y+  +HC A+I + EG    F+GA++  LR T
Sbjct: 95  PFDLIKVRLQNQTEPRAQPGSPPPRYQGPVHCAASIFREEGPRGLFRGAWALTLRDT 151


>BC036869-1|AAH36869.1|  246|Homo sapiens solute carrier family 25,
           member 45 protein.
          Length = 246

 Score = 34.7 bits (76), Expect = 0.37
 Identities = 20/57 (35%), Positives = 32/57 (56%), Gaps = 4/57 (7%)
 Frame = +1

Query: 13  PFDTVRRRMMMQSG-RAKSDI---LYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGT 171
           PFD ++ R+  Q+  RA+       Y+  +HC A+I + EG    F+GA++  LR T
Sbjct: 77  PFDLIKVRLQNQTEPRAQPGSPPPRYQGPVHCAASIFREEGPRGLFRGAWALTLRDT 133


>AK090434-1|BAC03415.1|  194|Homo sapiens FLJ00351 protein protein.
          Length = 194

 Score = 34.7 bits (76), Expect = 0.37
 Identities = 20/57 (35%), Positives = 32/57 (56%), Gaps = 4/57 (7%)
 Frame = +1

Query: 13  PFDTVRRRMMMQSG-RAKSDI---LYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGT 171
           PFD ++ R+  Q+  RA+       Y+  +HC A+I + EG    F+GA++  LR T
Sbjct: 25  PFDLIKVRLQNQTEPRAQPGSPPPRYQGPVHCAASIFREEGPRGLFRGAWALTLRDT 81


>AY597807-1|AAT09000.1|  184|Homo sapiens hypothetical protein
           protein.
          Length = 184

 Score = 33.9 bits (74), Expect = 0.65
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)
 Frame = +1

Query: 13  PFDTVRRRMMMQSG-RAKSDI---LYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGT 171
           PFD ++ R+  Q+  RA+       Y+  +HC A I + EG    F+GA++  LR T
Sbjct: 15  PFDLIKVRLQNQTEPRAQPGSPPPRYQGPVHCAAPIFREEGPRGLFRGAWALTLRDT 71


>AY358711-1|AAQ89951.1|  323|Homo sapiens UCP4 protein.
          Length = 323

 Score = 33.9 bits (74), Expect = 0.65
 Identities = 21/74 (28%), Positives = 38/74 (51%), Gaps = 2/74 (2%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQS-GRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGG 177
           I+  P D ++ R+M Q   +    +LYK++  C     + EG    +KG   + LR T  
Sbjct: 244 ILGTPADVIKSRIMNQPRDKQGRGLLYKSSTDCLIQAVQGEGFMSLYKGFLPSWLRMTPW 303

Query: 178 AFVLVL-YDEIKKV 216
           + V  L Y++I+++
Sbjct: 304 SMVFWLTYEKIREM 317


>AL591242-2|CAH73900.1|  323|Homo sapiens RP11-446F17.2 protein.
          Length = 323

 Score = 33.9 bits (74), Expect = 0.65
 Identities = 21/74 (28%), Positives = 38/74 (51%), Gaps = 2/74 (2%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQS-GRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGG 177
           I+  P D ++ R+M Q   +    +LYK++  C     + EG    +KG   + LR T  
Sbjct: 244 ILGTPADVIKSRIMNQPRDKQGRGLLYKSSTDCLIQAVQGEGFMSLYKGFLPSWLRMTPW 303

Query: 178 AFVLVL-YDEIKKV 216
           + V  L Y++I+++
Sbjct: 304 SMVFWLTYEKIREM 317


>AF110532-1|AAD16995.1|  323|Homo sapiens uncoupling protein UCP-4
           protein.
          Length = 323

 Score = 33.9 bits (74), Expect = 0.65
 Identities = 21/74 (28%), Positives = 38/74 (51%), Gaps = 2/74 (2%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQS-GRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGG 177
           I+  P D ++ R+M Q   +    +LYK++  C     + EG    +KG   + LR T  
Sbjct: 244 ILGTPADVIKSRIMNQPRDKQGRGLLYKSSTDCLIQAVQGEGFMSLYKGFLPSWLRMTPW 303

Query: 178 AFVLVL-YDEIKKV 216
           + V  L Y++I+++
Sbjct: 304 SMVFWLTYEKIREM 317


>BC016932-1|AAH16932.1|  678|Homo sapiens solute carrier family 25
           (mitochondrial carrier, Aralar), member 12 protein.
          Length = 678

 Score = 33.5 bits (73), Expect = 0.86
 Identities = 20/68 (29%), Positives = 34/68 (50%), Gaps = 1/68 (1%)
 Frame = +1

Query: 13  PFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGG-AFVL 189
           P D ++ R+ + + RA     Y   I C+  I + EG S F+KG  + V R +      L
Sbjct: 538 PADVIKTRLQV-AARA-GQTTYSGVIDCFRKILREEGPSAFWKGTAARVFRSSPQFGVTL 595

Query: 190 VLYDEIKK 213
           V Y+ +++
Sbjct: 596 VTYELLQR 603


>AY569438-1|AAS80155.1|  308|Homo sapiens hepatocellular
           carcinoma-downregulated mitochondrial carrier protein
           protein.
          Length = 308

 Score = 33.5 bits (73), Expect = 0.86
 Identities = 13/30 (43%), Positives = 20/30 (66%)
 Frame = +1

Query: 76  YKNTIHCWATIAKTEGTSPFFKGAFSNVLR 165
           Y+  +HC AT+A+ EG    +KG+ + VLR
Sbjct: 159 YRGPLHCLATVAREEGLCGLYKGSSALVLR 188



 Score = 31.1 bits (67), Expect = 4.6
 Identities = 17/72 (23%), Positives = 30/72 (41%), Gaps = 1/72 (1%)
 Frame = +1

Query: 4   ISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRG-TGGA 180
           ++ P D ++ R+       +    Y+  +HC  T  + EG    FKG   N  R      
Sbjct: 234 VATPMDVIKSRLQADGQGQRR---YRGLLHCMVTSVREEGPRVLFKGLVLNCCRAFPVNM 290

Query: 181 FVLVLYDEIKKV 216
            V V Y+ + ++
Sbjct: 291 VVFVAYEAVLRL 302


>AJ496568-1|CAD43090.1|  678|Homo sapiens mitochondrial
           aspartate-glutamate carrier protein protein.
          Length = 678

 Score = 33.5 bits (73), Expect = 0.86
 Identities = 20/68 (29%), Positives = 34/68 (50%), Gaps = 1/68 (1%)
 Frame = +1

Query: 13  PFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGG-AFVL 189
           P D ++ R+ + + RA     Y   I C+  I + EG S F+KG  + V R +      L
Sbjct: 538 PADVIKTRLQV-AARA-GQTTYSGVIDCFRKILREEGPSAFWKGTAARVFRSSPQFGVTL 595

Query: 190 VLYDEIKK 213
           V Y+ +++
Sbjct: 596 VTYELLQR 603


>AC068039-2|AAY24134.1|  678|Homo sapiens unknown protein.
          Length = 678

 Score = 33.5 bits (73), Expect = 0.86
 Identities = 20/68 (29%), Positives = 34/68 (50%), Gaps = 1/68 (1%)
 Frame = +1

Query: 13  PFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGG-AFVL 189
           P D ++ R+ + + RA     Y   I C+  I + EG S F+KG  + V R +      L
Sbjct: 538 PADVIKTRLQV-AARA-GQTTYSGVIDCFRKILREEGPSAFWKGTAARVFRSSPQFGVTL 595

Query: 190 VLYDEIKK 213
           V Y+ +++
Sbjct: 596 VTYELLQR 603


>Y14494-1|CAA74834.1|  678|Homo sapiens aralar1 protein.
          Length = 678

 Score = 33.1 bits (72), Expect = 1.1
 Identities = 19/65 (29%), Positives = 32/65 (49%)
 Frame = +1

Query: 13  PFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGAFVLV 192
           P D ++ R+ + + RA     Y   I C+  I + EG S F+KG  + V R +    V +
Sbjct: 538 PADVIKTRLQV-AARA-GQTTYSGVIDCFRKILREEGPSAFWKGTAARVFRSSPQFGVTL 595

Query: 193 LYDEI 207
            + E+
Sbjct: 596 AHYEV 600


>Z98048-2|CAI20491.1|  307|Homo sapiens solute carrier family 25
           (mitochondrial carrier; peroxisomal membrane protein,
           protein.
          Length = 307

 Score = 31.9 bits (69), Expect = 2.6
 Identities = 20/77 (25%), Positives = 38/77 (49%), Gaps = 4/77 (5%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKS-DIL---YKNTIHCWATIAKTEGTSPFFKGAFSNVLRG 168
           +++ P   V  R+ +Q  + ++ DI+   YK  I  +  I + EG S  + G F ++L  
Sbjct: 117 LLTTPLWVVNTRLKLQGAKFRNEDIVPTNYKGIIDAFHQIIRDEGISALWNGTFPSLLLV 176

Query: 169 TGGAFVLVLYDEIKKVL 219
              A   + Y+ +K+ L
Sbjct: 177 FNPAIQFMFYEGLKRQL 193


>Y12860-1|CAA73367.1|  307|Homo sapiens peroxisomal integral
           membrane protein protein.
          Length = 307

 Score = 31.9 bits (69), Expect = 2.6
 Identities = 20/77 (25%), Positives = 38/77 (49%), Gaps = 4/77 (5%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKS-DIL---YKNTIHCWATIAKTEGTSPFFKGAFSNVLRG 168
           +++ P   V  R+ +Q  + ++ DI+   YK  I  +  I + EG S  + G F ++L  
Sbjct: 117 LLTTPLWVVNTRLKLQGAKFRNEDIVPTNYKGIIDAFHQIIRDEGISALWNGTFPSLLLV 176

Query: 169 TGGAFVLVLYDEIKKVL 219
              A   + Y+ +K+ L
Sbjct: 177 FNPAIQFMFYEGLKRQL 193


>CR456578-1|CAG30464.1|  315|Homo sapiens SLC25A18 protein.
          Length = 315

 Score = 31.9 bits (69), Expect = 2.6
 Identities = 16/50 (32%), Positives = 25/50 (50%)
 Frame = +1

Query: 10  YPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNV 159
           +P D  + R+  Q G+A    +YK  I C    A+ EG    ++GA  N+
Sbjct: 27  FPIDLAKTRLQNQHGKA----MYKGMIDCLMKTARAEGFFGMYRGAAVNL 72


>CR456577-1|CAG30463.1|  307|Homo sapiens SLC25A17 protein.
          Length = 307

 Score = 31.9 bits (69), Expect = 2.6
 Identities = 20/77 (25%), Positives = 38/77 (49%), Gaps = 4/77 (5%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKS-DIL---YKNTIHCWATIAKTEGTSPFFKGAFSNVLRG 168
           +++ P   V  R+ +Q  + ++ DI+   YK  I  +  I + EG S  + G F ++L  
Sbjct: 117 LLTTPLWVVNTRLKLQGAKFRNEDIVPTNYKGIIDAFHQIIRDEGISALWNGTFPSLLLV 176

Query: 169 TGGAFVLVLYDEIKKVL 219
              A   + Y+ +K+ L
Sbjct: 177 FNPAIQFMFYEGLKRQL 193


>BC031644-1|AAH31644.1|  315|Homo sapiens SLC25A18 protein protein.
          Length = 315

 Score = 31.9 bits (69), Expect = 2.6
 Identities = 16/50 (32%), Positives = 25/50 (50%)
 Frame = +1

Query: 10  YPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNV 159
           +P D  + R+  Q G+A    +YK  I C    A+ EG    ++GA  N+
Sbjct: 27  FPIDLAKTRLQNQHGKA----MYKGMIDCLMKTARAEGFFGMYRGAAVNL 72


>BC012998-1|AAH12998.1|  307|Homo sapiens solute carrier family 25
           (mitochondrial carrier; peroxisomal membrane protein,
           protein.
          Length = 307

 Score = 31.9 bits (69), Expect = 2.6
 Identities = 20/77 (25%), Positives = 38/77 (49%), Gaps = 4/77 (5%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKS-DIL---YKNTIHCWATIAKTEGTSPFFKGAFSNVLRG 168
           +++ P   V  R+ +Q  + ++ DI+   YK  I  +  I + EG S  + G F ++L  
Sbjct: 117 LLTTPLWVVNTRLKLQGAKFRNEDIVPTNYKGIIDAFHQIIRDEGISALWNGTFPSLLLV 176

Query: 169 TGGAFVLVLYDEIKKVL 219
              A   + Y+ +K+ L
Sbjct: 177 FNPAIQFMFYEGLKRQL 193


>BC005957-1|AAH05957.1|  307|Homo sapiens solute carrier family 25
           (mitochondrial carrier; peroxisomal membrane protein,
           protein.
          Length = 307

 Score = 31.9 bits (69), Expect = 2.6
 Identities = 20/77 (25%), Positives = 38/77 (49%), Gaps = 4/77 (5%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKS-DIL---YKNTIHCWATIAKTEGTSPFFKGAFSNVLRG 168
           +++ P   V  R+ +Q  + ++ DI+   YK  I  +  I + EG S  + G F ++L  
Sbjct: 117 LLTTPLWVVNTRLKLQGAKFRNEDIVPTNYKGIIDAFHQIIRDEGISALWNGTFPSLLLV 176

Query: 169 TGGAFVLVLYDEIKKVL 219
              A   + Y+ +K+ L
Sbjct: 177 FNPAIQFMFYEGLKRQL 193


>AY008285-1|AAG22855.1|  315|Homo sapiens solute carrier protein.
          Length = 315

 Score = 31.9 bits (69), Expect = 2.6
 Identities = 16/50 (32%), Positives = 25/50 (50%)
 Frame = +1

Query: 10  YPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNV 159
           +P D  + R+  Q G+A    +YK  I C    A+ EG    ++GA  N+
Sbjct: 27  FPIDLAKTRLQNQHGKA----MYKGMIDCLMKTARAEGFFGMYRGAAVNL 72


>AL683870-2|CAI39844.1|  158|Homo sapiens solute carrier family 25
           (mitochondrial carrier; adenine nucleotide translocato
           protein.
          Length = 158

 Score = 31.9 bits (69), Expect = 2.6
 Identities = 16/53 (30%), Positives = 28/53 (52%), Gaps = 2/53 (3%)
 Frame = +1

Query: 13  PFDTVRRRMMMQ--SGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR 165
           P + V+  + +Q  S +  +D  YK  + C   I K +G   F++G  +NV+R
Sbjct: 28  PIERVKLLLQVQHASKQIAADKQYKGIVDCIVRIPKEQGVLSFWRGNLANVIR 80


>AL049764-1|CAI20333.1|  307|Homo sapiens solute carrier family 25
           (mitochondrial carrier; peroxisomal membrane protein,
           protein.
          Length = 307

 Score = 31.9 bits (69), Expect = 2.6
 Identities = 20/77 (25%), Positives = 38/77 (49%), Gaps = 4/77 (5%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKS-DIL---YKNTIHCWATIAKTEGTSPFFKGAFSNVLRG 168
           +++ P   V  R+ +Q  + ++ DI+   YK  I  +  I + EG S  + G F ++L  
Sbjct: 117 LLTTPLWVVNTRLKLQGAKFRNEDIVPTNYKGIIDAFHQIIRDEGISALWNGTFPSLLLV 176

Query: 169 TGGAFVLVLYDEIKKVL 219
              A   + Y+ +K+ L
Sbjct: 177 FNPAIQFMFYEGLKRQL 193


>AK126812-1|BAC86705.1|  291|Homo sapiens protein ( Homo sapiens
           cDNA FLJ44862 fis, clone BRALZ2010842. ).
          Length = 291

 Score = 31.9 bits (69), Expect = 2.6
 Identities = 12/34 (35%), Positives = 20/34 (58%)
 Frame = +1

Query: 76  YKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGG 177
           Y+  +HC  TI + EG +  ++GA + +LR   G
Sbjct: 158 YQGPVHCITTIVRNEGLAGLYRGASAMLLRDVPG 191



 Score = 30.3 bits (65), Expect = 8.0
 Identities = 17/48 (35%), Positives = 26/48 (54%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKG 144
           I+ +P DTV+ R+  Q+G     + Y NT+ C   + + E    FFKG
Sbjct: 21  IVGHPLDTVKTRL--QAG-----VGYGNTLSCIRVVYRRESMFGFFKG 61


>AJ428203-1|CAD21008.1|  315|Homo sapiens glutamate carrier protein.
          Length = 315

 Score = 31.9 bits (69), Expect = 2.6
 Identities = 16/50 (32%), Positives = 25/50 (50%)
 Frame = +1

Query: 10  YPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNV 159
           +P D  + R+  Q G+A    +YK  I C    A+ EG    ++GA  N+
Sbjct: 27  FPIDLAKTRLQNQHGKA----MYKGMIDCLMKTARAEGFFGMYRGAAVNL 72


>Y17571-1|CAB62206.1|  675|Homo sapiens aralar2 protein.
          Length = 675

 Score = 30.3 bits (65), Expect = 8.0
 Identities = 19/65 (29%), Positives = 31/65 (47%)
 Frame = +1

Query: 13  PFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGAFVLV 192
           P D ++ R+ + + RA     Y   I C+  I + EG    +KGA + V R +    V +
Sbjct: 540 PADVIKTRLQV-AARA-GQTTYSGVIDCFRKILREEGPKALWKGAGARVFRSSPQFGVTL 597

Query: 193 LYDEI 207
           L  E+
Sbjct: 598 LTYEL 602


>BC025747-1|AAH25747.1|  157|Homo sapiens LOC153328 protein protein.
          Length = 157

 Score = 30.3 bits (65), Expect = 8.0
 Identities = 17/48 (35%), Positives = 26/48 (54%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKG 144
           I+ +P DTV+ R+  Q+G     + Y NT+ C   + + E    FFKG
Sbjct: 21  IVGHPLDTVKTRL--QAG-----VGYGNTLSCIRVVYRRESMFGFFKG 61


>BC006566-1|AAH06566.1|  675|Homo sapiens solute carrier family 25,
           member 13 (citrin) protein.
          Length = 675

 Score = 30.3 bits (65), Expect = 8.0
 Identities = 19/65 (29%), Positives = 31/65 (47%)
 Frame = +1

Query: 13  PFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGAFVLV 192
           P D ++ R+ + + RA     Y   I C+  I + EG    +KGA + V R +    V +
Sbjct: 540 PADVIKTRLQV-AARA-GQTTYSGVIDCFRKILREEGPKALWKGAGARVFRSSPQFGVTL 597

Query: 193 LYDEI 207
           L  E+
Sbjct: 598 LTYEL 602


>AK222864-1|BAD96584.1|  675|Homo sapiens solute carrier family 25,
           member 13 (citrin) variant protein.
          Length = 675

 Score = 30.3 bits (65), Expect = 8.0
 Identities = 19/65 (29%), Positives = 31/65 (47%)
 Frame = +1

Query: 13  PFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGAFVLV 192
           P D ++ R+ + + RA     Y   I C+  I + EG    +KGA + V R +    V +
Sbjct: 540 PADVIKTRLQV-AARA-GQTTYSGVIDCFRKILREEGPKALWKGAGARVFRSSPQFGVTL 597

Query: 193 LYDEI 207
           L  E+
Sbjct: 598 LTYEL 602


>AJ496569-1|CAD43091.1|  676|Homo sapiens mitochondrial
           aspartate-glutamate carrier protein protein.
          Length = 676

 Score = 30.3 bits (65), Expect = 8.0
 Identities = 19/65 (29%), Positives = 31/65 (47%)
 Frame = +1

Query: 13  PFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGAFVLV 192
           P D ++ R+ + + RA     Y   I C+  I + EG    +KGA + V R +    V +
Sbjct: 541 PADVIKTRLQV-AARA-GQTTYSGVIDCFRKILREEGPKALWKGAGARVFRSSPQFGVTL 598

Query: 193 LYDEI 207
           L  E+
Sbjct: 599 LTYEL 603


>AF118838-1|AAD38501.1|  675|Homo sapiens citrin protein.
          Length = 675

 Score = 30.3 bits (65), Expect = 8.0
 Identities = 19/65 (29%), Positives = 31/65 (47%)
 Frame = +1

Query: 13  PFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGAFVLV 192
           P D ++ R+ + + RA     Y   I C+  I + EG    +KGA + V R +    V +
Sbjct: 540 PADVIKTRLQV-AARA-GQTTYSGVIDCFRKILREEGPKALWKGAGARVFRSSPQFGVTL 597

Query: 193 LYDEI 207
           L  E+
Sbjct: 598 LTYEL 602


>AC002540-1|AAB70112.1|  238|Homo sapiens unknown protein.
          Length = 238

 Score = 30.3 bits (65), Expect = 8.0
 Identities = 19/65 (29%), Positives = 31/65 (47%)
 Frame = +1

Query: 13  PFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGAFVLV 192
           P D ++ R+ + + RA     Y   I C+  I + EG    +KGA + V R +    V +
Sbjct: 103 PADVIKTRLQV-AARA-GQTTYSGVIDCFRKILREEGPKALWKGAGARVFRSSPQFGVTL 160

Query: 193 LYDEI 207
           L  E+
Sbjct: 161 LTYEL 165


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 101,048,832
Number of Sequences: 237096
Number of extensions: 1887859
Number of successful extensions: 6822
Number of sequences better than 10.0: 108
Number of HSP's better than 10.0 without gapping: 6642
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6811
length of database: 76,859,062
effective HSP length: 89
effective length of database: 55,757,518
effective search space used: 9311505506
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).