SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30019
         (719 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF395258-1|AAL35207.1|  128|Homo sapiens dopamine receptor D4 pr...    38   0.048
AF395252-1|AAL35201.1|  112|Homo sapiens dopamine receptor D4 pr...    36   0.11 
AY151037-1|AAN73263.1|  128|Homo sapiens dopamine receptor D4 pr...    36   0.19 
AY151035-1|AAN73261.1|  112|Homo sapiens dopamine receptor D4 pr...    36   0.19 
AF395236-1|AAL35185.1|   80|Homo sapiens dopamine receptor D4 pr...    35   0.25 
AF395231-1|AAL35180.1|   80|Homo sapiens dopamine receptor D4 pr...    35   0.25 
AY151038-1|AAN73264.1|  144|Homo sapiens dopamine receptor D4 pr...    35   0.34 
AY151036-1|AAN73262.1|  112|Homo sapiens dopamine receptor D4 pr...    35   0.34 
AF395250-1|AAL35199.1|  112|Homo sapiens dopamine receptor D4 pr...    35   0.34 
Y10141-1|CAA71229.1|  106|Homo sapiens DAT1 protein.                   34   0.45 
AF395253-1|AAL35202.1|  112|Homo sapiens dopamine receptor D4 pr...    34   0.45 
AB040880-1|BAA95971.1| 1721|Homo sapiens KIAA1447 protein protein.     34   0.45 
AF395238-1|AAL35187.1|   96|Homo sapiens dopamine receptor D4 pr...    34   0.59 
AY960854-1|AAX59055.1|  579|Homo sapiens keratinocyte proline-ri...    33   0.78 
AL353779-4|CAI20978.1|  579|Homo sapiens keratinocyte proline-ri...    33   0.78 
AF395264-1|AAL35213.1|  176|Homo sapiens dopamine receptor D4 pr...    33   0.78 
AF395249-1|AAL35198.1|  112|Homo sapiens dopamine receptor D4 pr...    33   0.78 
AF395215-1|AAL35164.1|   48|Homo sapiens dopamine receptor D4 pr...    33   0.78 
X74614-1|CAA52685.1|  250|Homo sapiens outer dense fiber protein...    33   1.0  
BC104457-1|AAI04458.1|  250|Homo sapiens outer dense fiber of sp...    33   1.0  
BC104456-1|AAI04457.1|  250|Homo sapiens outer dense fiber of sp...    33   1.0  
AF395256-1|AAL35205.1|  112|Homo sapiens dopamine receptor D4 pr...    33   1.0  
AF395241-1|AAL35190.1|   96|Homo sapiens dopamine receptor D4 pr...    33   1.0  
BC127016-1|AAI27017.1|  259|Homo sapiens KRTAP10-8 protein protein.    33   1.4  
AF395255-1|AAL35204.1|  112|Homo sapiens dopamine receptor D4 pr...    33   1.4  
AF395254-1|AAL35203.2|  112|Homo sapiens dopamine receptor D4 pr...    33   1.4  
AF395251-1|AAL35200.1|  112|Homo sapiens dopamine receptor D4 pr...    33   1.4  
AF395247-1|AAL35196.1|  112|Homo sapiens dopamine receptor D4 pr...    33   1.4  
AF395239-1|AAL35188.1|   96|Homo sapiens dopamine receptor D4 pr...    33   1.4  
AB076355-1|BAD01542.1|  259|Homo sapiens keratin associated prot...    33   1.4  
M88338-1|AAA36606.1|  391|Homo sapiens serum protein protein.          32   1.8  
CR456524-1|CAG30410.1|  391|Homo sapiens MSE55 protein.                32   1.8  
AY151033-1|AAN73259.1|  112|Homo sapiens dopamine receptor D4 pr...    32   1.8  
AL022315-2|CAB42833.1|  391|Homo sapiens CDC42 effector protein ...    32   1.8  
AK074268-1|BAB85034.1|  274|Homo sapiens protein ( Homo sapiens ...    32   1.8  
AF395257-1|AAL35206.1|  128|Homo sapiens dopamine receptor D4 pr...    32   1.8  
AF395233-1|AAL35182.1|   80|Homo sapiens dopamine receptor D4 pr...    32   1.8  
L12398-1|AAB59386.1|  467|Homo sapiens dopamine receptor D4 prot...    32   2.4  
EF489032-1|ABO48379.1|  112|Homo sapiens dopamine D4 receptor pr...    32   2.4  
EF489031-1|ABO48378.1|  112|Homo sapiens dopamine D4 receptor pr...    32   2.4  
EF489030-1|ABO48377.1|  112|Homo sapiens dopamine D4 receptor pr...    32   2.4  
DQ846850-1|ABI15202.1|  131|Homo sapiens dopamine D4 receptor pr...    32   2.4  
AY151034-1|AAN73260.1|  112|Homo sapiens dopamine receptor D4 pr...    32   2.4  
AF395263-1|AAL35212.1|  160|Homo sapiens dopamine receptor D4 pr...    32   2.4  
AF395262-1|AAL35211.2|  112|Homo sapiens dopamine receptor D4 pr...    32   2.4  
AF395246-1|AAL35195.1|  112|Homo sapiens dopamine receptor D4 pr...    32   2.4  
AF395245-1|AAL35194.1|  112|Homo sapiens dopamine receptor D4 pr...    32   2.4  
AF395244-1|AAL35193.1|   96|Homo sapiens dopamine receptor D4 pr...    32   2.4  
AF395242-1|AAL35191.2|   96|Homo sapiens dopamine receptor D4 pr...    32   2.4  
AF395240-1|AAL35189.1|   96|Homo sapiens dopamine receptor D4 pr...    32   2.4  
AF395226-1|AAL35175.1|   64|Homo sapiens dopamine receptor D4 pr...    32   2.4  
EF489033-1|ABO48380.1|  112|Homo sapiens dopamine D4 receptor pr...    31   3.1  
AF395243-1|AAL35192.1|   96|Homo sapiens dopamine receptor D4 pr...    31   3.1  
AF395230-1|AAL35179.1|   80|Homo sapiens dopamine receptor D4 pr...    31   3.1  
AB065765-1|BAC05985.1|  419|Homo sapiens seven transmembrane hel...    31   3.1  
AK090647-1|BAC03496.1|  353|Homo sapiens   protein.                    31   5.5  
AK024477-1|BAB15767.1| 1382|Homo sapiens FLJ00070 protein protein.     31   5.5  
Y16787-1|CAA76383.1|  416|Homo sapiens type I hair keratin 1 pro...    30   7.3  
X86570-1|CAA60378.1|  416|Homo sapiens type I keratin protein.         30   7.3  
U79266-1|AAB50210.1|  285|Homo sapiens unknown protein.                30   7.3  
S75797-1|AAB32812.1|   85|Homo sapiens type I hair keratin protein.    30   7.3  
BC130605-1|AAI30606.1|  110|Homo sapiens late cornified envelope...    30   7.3  
BC130603-1|AAI30604.1|  110|Homo sapiens late cornified envelope...    30   7.3  
BC114468-1|AAI14469.1|  416|Homo sapiens keratin 31 protein.           30   7.3  
AY151032-1|AAN73258.1|   96|Homo sapiens dopamine receptor D4 pr...    30   7.3  
AL139247-4|CAI21682.1|  110|Homo sapiens late cornified envelope...    30   7.3  
AF395234-1|AAL35183.1|   80|Homo sapiens dopamine receptor D4 pr...    30   7.3  
AF395229-1|AAL35178.1|   80|Homo sapiens dopamine receptor D4 pr...    30   7.3  
DQ118293-1|AAZ99029.1| 2391|Homo sapiens filaggrin 2 protein.          30   9.6  
BC120941-1|AAI20942.1|  146|Homo sapiens keratin associated prot...    30   9.6  
AY827490-1|AAX12417.1| 2391|Homo sapiens ifapsoriasin protein.         30   9.6  
AY396741-1|AAR91619.1| 2850|Homo sapiens hornerin precursor prot...    30   9.6  
AL589986-3|CAH70026.1| 2850|Homo sapiens hornerin protein.             30   9.6  
AL356504-2|CAC13173.2| 2391|Homo sapiens filaggrin 2 protein.          30   9.6  
AL139247-6|CAI21684.1|  110|Homo sapiens late cornified envelope...    30   9.6  
AK090684-1|BAC03505.1|  294|Homo sapiens protein ( Homo sapiens ...    30   9.6  
AJ566389-1|CAD97469.1|  146|Homo sapiens keratin associated prot...    30   9.6  
AF005080-1|AAB83960.1|  110|Homo sapiens skin-specific protein p...    30   9.6  
AB076362-1|BAD01549.1|  146|Homo sapiens keratin associated prot...    30   9.6  

>AF395258-1|AAL35207.1|  128|Homo sapiens dopamine receptor D4
           protein.
          Length = 128

 Score = 37.5 bits (83), Expect = 0.048
 Identities = 23/53 (43%), Positives = 24/53 (45%), Gaps = 5/53 (9%)
 Frame = +3

Query: 123 CAP*PASAPR--CQARCCYPC-SLPRGPCSVPGRPSC--LPRGPCSVPGAPVA 266
           CAP     P+  C   C  P   LPRGPC     P    LPRGPC    AP A
Sbjct: 46  CAPPAPGLPQDPCGPDCAPPAPGLPRGPCGPDCAPPAPGLPRGPCGPDCAPPA 98



 Score = 31.9 bits (69), Expect = 2.4
 Identities = 21/53 (39%), Positives = 22/53 (41%), Gaps = 5/53 (9%)
 Frame = +3

Query: 123 CAP*PASAPR--CQARCCYPC-SLPRGPCSVPGRPSC--LPRGPCSVPGAPVA 266
           CAP     P   C   C  P   LP+ PC     P    LPRGPC    AP A
Sbjct: 30  CAPAAPGLPPDPCGPDCAPPAPGLPQDPCGPDCAPPAPGLPRGPCGPDCAPPA 82


>AF395252-1|AAL35201.1|  112|Homo sapiens dopamine receptor D4
           protein.
          Length = 112

 Score = 36.3 bits (80), Expect = 0.11
 Identities = 23/53 (43%), Positives = 23/53 (43%), Gaps = 5/53 (9%)
 Frame = +3

Query: 123 CAP*PASAPR--CQARCCYPC-SLPRGPCSVPGRPSC--LPRGPCSVPGAPVA 266
           CAP     P   C   C  P   LPRGPC     P    LPRGPC    AP A
Sbjct: 30  CAPAAPGLPPDPCGPDCAPPAPGLPRGPCGPDCAPPAPGLPRGPCGPDCAPPA 82



 Score = 30.3 bits (65), Expect = 7.3
 Identities = 21/53 (39%), Positives = 21/53 (39%), Gaps = 5/53 (9%)
 Frame = +3

Query: 123 CAP*PASAPR--CQARCCYPC-SLPRGPCSVPGRPSC--LPRGPCSVPGAPVA 266
           CAP     PR  C   C      LP  PC     P    LPRGPC    AP A
Sbjct: 14  CAPPAPGLPRGPCGPDCAPAAPGLPPDPCGPDCAPPAPGLPRGPCGPDCAPPA 66


>AY151037-1|AAN73263.1|  128|Homo sapiens dopamine receptor D4
           protein.
          Length = 128

 Score = 35.5 bits (78), Expect = 0.19
 Identities = 22/53 (41%), Positives = 23/53 (43%), Gaps = 5/53 (9%)
 Frame = +3

Query: 123 CAP*PASAPR--CQARCCYPC-SLPRGPCSVPGRPSC--LPRGPCSVPGAPVA 266
           CAP     PR  C   C  P   LP+ PC     P    LPRGPC    AP A
Sbjct: 46  CAPPAPGLPRVPCGPDCAPPAPGLPQDPCGPDCAPPAPGLPRGPCGPDCAPAA 98


>AY151035-1|AAN73261.1|  112|Homo sapiens dopamine receptor D4
           protein.
          Length = 112

 Score = 35.5 bits (78), Expect = 0.19
 Identities = 22/53 (41%), Positives = 23/53 (43%), Gaps = 5/53 (9%)
 Frame = +3

Query: 123 CAP*PASAPR--CQARCCYPC-SLPRGPCSVPGRPS--CLPRGPCSVPGAPVA 266
           CAP     P   C   C  P   LP+ PC     P   CLPRGPC    AP A
Sbjct: 30  CAPAAPGLPPDPCGPDCAPPAPGLPQDPCGPDCAPPAPCLPRGPCGPDCAPPA 82


>AF395236-1|AAL35185.1|   80|Homo sapiens dopamine receptor D4
           protein.
          Length = 80

 Score = 35.1 bits (77), Expect = 0.25
 Identities = 19/41 (46%), Positives = 19/41 (46%), Gaps = 3/41 (7%)
 Frame = +3

Query: 153 CQARCCYPC-SLPRGPCSVPGRPSC--LPRGPCSVPGAPVA 266
           C   C  P   LPRGPC     P    LPRGPC    AP A
Sbjct: 10  CGPDCAPPAPGLPRGPCGPDCAPPAPGLPRGPCGPDCAPAA 50


>AF395231-1|AAL35180.1|   80|Homo sapiens dopamine receptor D4
           protein.
          Length = 80

 Score = 35.1 bits (77), Expect = 0.25
 Identities = 19/41 (46%), Positives = 19/41 (46%), Gaps = 3/41 (7%)
 Frame = +3

Query: 153 CQARCCYPC-SLPRGPCSVPGRPSC--LPRGPCSVPGAPVA 266
           C   C  P   LPRGPC     P    LPRGPC    AP A
Sbjct: 10  CGPDCAPPAPGLPRGPCGPDCAPPAPGLPRGPCGPDCAPAA 50


>AY151038-1|AAN73264.1|  144|Homo sapiens dopamine receptor D4
           protein.
          Length = 144

 Score = 34.7 bits (76), Expect = 0.34
 Identities = 22/53 (41%), Positives = 23/53 (43%), Gaps = 5/53 (9%)
 Frame = +3

Query: 123 CAP*PASAPR--CQARCCYPC-SLPRGPCSVPGRPSC--LPRGPCSVPGAPVA 266
           CAP     PR  C   C  P   LP+ PC     P    LPRGPC    AP A
Sbjct: 62  CAPPAPGLPRGPCGPDCAPPAPGLPQDPCGPDCAPPAPGLPRGPCGPDCAPPA 114



 Score = 33.5 bits (73), Expect = 0.78
 Identities = 22/53 (41%), Positives = 23/53 (43%), Gaps = 5/53 (9%)
 Frame = +3

Query: 123 CAP*PASAPR--CQARCCYPC-SLPRGPCSVPGRPSC--LPRGPCSVPGAPVA 266
           CAP   S P   C   C  P   LP+ PC     P    LPRGPC    AP A
Sbjct: 30  CAPAAPSLPPDPCGPDCAPPAPGLPQDPCGPDCAPPAPGLPRGPCGPDCAPPA 82



 Score = 32.3 bits (70), Expect = 1.8
 Identities = 16/32 (50%), Positives = 16/32 (50%)
 Frame = +3

Query: 186 PRGPCSVPGRPSCLPRGPCSVPGAPVAYHTSP 281
           P GP   P  P CLPRGPC    AP A    P
Sbjct: 9   PCGPDCAPPAP-CLPRGPCGPDCAPAAPSLPP 39


>AY151036-1|AAN73262.1|  112|Homo sapiens dopamine receptor D4
           protein.
          Length = 112

 Score = 34.7 bits (76), Expect = 0.34
 Identities = 22/53 (41%), Positives = 24/53 (45%), Gaps = 5/53 (9%)
 Frame = +3

Query: 123 CAP*PASAPR--CQARCCYPC-SLPRGPCSVPGRPSC--LPRGPCSVPGAPVA 266
           CAP   S P+  C   C  P   LP+ PC     P    LPRGPC    AP A
Sbjct: 30  CAPAAPSLPQDPCGPDCAPPAPGLPQDPCGPDCAPPAPGLPRGPCGPDCAPPA 82


>AF395250-1|AAL35199.1|  112|Homo sapiens dopamine receptor D4
           protein.
          Length = 112

 Score = 34.7 bits (76), Expect = 0.34
 Identities = 22/53 (41%), Positives = 24/53 (45%), Gaps = 5/53 (9%)
 Frame = +3

Query: 123 CAP*PASAPR--CQARCCYPC-SLPRGPCSVPGRPSC--LPRGPCSVPGAPVA 266
           CAP   S P+  C   C  P   LP+ PC     P    LPRGPC    AP A
Sbjct: 30  CAPAAPSLPQDPCGPDCAPPAPGLPQDPCGPDCAPPAPGLPRGPCGPDCAPPA 82


>Y10141-1|CAA71229.1|  106|Homo sapiens DAT1 protein.
          Length = 106

 Score = 34.3 bits (75), Expect = 0.45
 Identities = 14/38 (36%), Positives = 18/38 (47%), Gaps = 1/38 (2%)
 Frame = +3

Query: 177 CSLPRGPCSVPGRPSC-LPRGPCSVPGAPVAYHTSPLR 287
           C  P G C +PG  +C  P G C+ PG     H   L+
Sbjct: 56  CRAPTGACPIPGPDACRAPTGACTTPGRMQGPHAGSLQ 93


>AF395253-1|AAL35202.1|  112|Homo sapiens dopamine receptor D4
           protein.
          Length = 112

 Score = 34.3 bits (75), Expect = 0.45
 Identities = 22/53 (41%), Positives = 23/53 (43%), Gaps = 5/53 (9%)
 Frame = +3

Query: 123 CAP*PASAPR--CQARCCYPC-SLPRGPCSVPGRPSC--LPRGPCSVPGAPVA 266
           CAP   S P   C   C  P   LP+ PC     P    LPRGPC    AP A
Sbjct: 30  CAPAAPSLPPDPCGPDCAPPAPGLPQDPCGPDCAPPAPGLPRGPCGPDCAPAA 82



 Score = 32.3 bits (70), Expect = 1.8
 Identities = 16/32 (50%), Positives = 16/32 (50%)
 Frame = +3

Query: 186 PRGPCSVPGRPSCLPRGPCSVPGAPVAYHTSP 281
           P GP   P  P CLPRGPC    AP A    P
Sbjct: 9   PCGPDCAPPAP-CLPRGPCGPDCAPAAPSLPP 39


>AB040880-1|BAA95971.1| 1721|Homo sapiens KIAA1447 protein protein.
          Length = 1721

 Score = 34.3 bits (75), Expect = 0.45
 Identities = 21/64 (32%), Positives = 29/64 (45%)
 Frame = +3

Query: 126 AP*PASAPRCQARCCYPCSLPRGPCSVPGRPSCLPRGPCSVPGAPVAYHTSPLRYSSAES 305
           AP PA+ P     CC+P   P+ P S P  P   P  PC++   P +      R  SAE 
Sbjct: 236 APSPAAGPTKLPPCCHPPD-PKPPASSP-TPPPRPSAPCTLNVCPASSPGPGSRVRSAEE 293

Query: 306 VSSQ 317
            + +
Sbjct: 294 KNGE 297


>AF395238-1|AAL35187.1|   96|Homo sapiens dopamine receptor D4
           protein.
          Length = 96

 Score = 33.9 bits (74), Expect = 0.59
 Identities = 22/53 (41%), Positives = 23/53 (43%), Gaps = 5/53 (9%)
 Frame = +3

Query: 123 CAP*PASAPR--CQARCCYPC-SLPRGPCSVPGRPSC--LPRGPCSVPGAPVA 266
           CAP     PR  C   C     SLP+ PC     P    LPRGPC    AP A
Sbjct: 14  CAPPAPGLPRGPCGPDCAPAAPSLPQDPCGPDCAPPAPGLPRGPCGPDCAPAA 66


>AY960854-1|AAX59055.1|  579|Homo sapiens keratinocyte proline-rich
           protein protein.
          Length = 579

 Score = 33.5 bits (73), Expect = 0.78
 Identities = 28/80 (35%), Positives = 32/80 (40%), Gaps = 6/80 (7%)
 Frame = +3

Query: 75  CSRALLS-R*SRFFPKHCAP*PASAP----RCQARCCYPCSLPRGP-CSVPGRPSCLPRG 236
           CS + L  R S  FP +C P   S P    RC  R    CS  RGP C +     C PR 
Sbjct: 278 CSSSYLPLRPSEGFPNYCTPPRRSEPIYNSRCPRRPISSCSQRRGPKCRIEISSPCCPR- 336

Query: 237 PCSVPGAPVAYHTSPLRYSS 296
              VP         P+R  S
Sbjct: 337 --QVPPQRCPVEIPPIRRRS 354


>AL353779-4|CAI20978.1|  579|Homo sapiens keratinocyte proline-rich
           protein protein.
          Length = 579

 Score = 33.5 bits (73), Expect = 0.78
 Identities = 28/80 (35%), Positives = 32/80 (40%), Gaps = 6/80 (7%)
 Frame = +3

Query: 75  CSRALLS-R*SRFFPKHCAP*PASAP----RCQARCCYPCSLPRGP-CSVPGRPSCLPRG 236
           CS + L  R S  FP +C P   S P    RC  R    CS  RGP C +     C PR 
Sbjct: 278 CSSSYLPLRPSEGFPNYCTPPRRSEPIYNSRCPRRPISSCSQRRGPKCRIEISSPCCPR- 336

Query: 237 PCSVPGAPVAYHTSPLRYSS 296
              VP         P+R  S
Sbjct: 337 --QVPPQRCPVEIPPIRRRS 354


>AF395264-1|AAL35213.1|  176|Homo sapiens dopamine receptor D4
           protein.
          Length = 176

 Score = 33.5 bits (73), Expect = 0.78
 Identities = 22/53 (41%), Positives = 23/53 (43%), Gaps = 5/53 (9%)
 Frame = +3

Query: 123 CAP*PASAPR--CQARCCYPC-SLPRGPCSVPGRPSC--LPRGPCSVPGAPVA 266
           CAP   S P   C   C  P   LP+ PC     P    LPRGPC    AP A
Sbjct: 94  CAPAAPSLPPDPCGPDCAPPAPGLPQDPCGPDCAPPAPGLPRGPCGPDCAPPA 146


>AF395249-1|AAL35198.1|  112|Homo sapiens dopamine receptor D4
           protein.
          Length = 112

 Score = 33.5 bits (73), Expect = 0.78
 Identities = 22/53 (41%), Positives = 23/53 (43%), Gaps = 5/53 (9%)
 Frame = +3

Query: 123 CAP*PASAPR--CQARCCYPC-SLPRGPCSVPGRPSC--LPRGPCSVPGAPVA 266
           CAP   S P   C   C  P   LP+ PC     P    LPRGPC    AP A
Sbjct: 30  CAPAAPSLPPDPCGPDCAPPAPGLPQDPCGPDCAPPAPGLPRGPCGPDCAPPA 82



 Score = 32.3 bits (70), Expect = 1.8
 Identities = 16/32 (50%), Positives = 16/32 (50%)
 Frame = +3

Query: 186 PRGPCSVPGRPSCLPRGPCSVPGAPVAYHTSP 281
           P GP   P  P CLPRGPC    AP A    P
Sbjct: 9   PCGPDCAPPAP-CLPRGPCGPDCAPAAPSLPP 39


>AF395215-1|AAL35164.1|   48|Homo sapiens dopamine receptor D4
           protein.
          Length = 48

 Score = 33.5 bits (73), Expect = 0.78
 Identities = 18/39 (46%), Positives = 18/39 (46%), Gaps = 3/39 (7%)
 Frame = +3

Query: 153 CQARCCYPC-SLPRGPCSVPGRPSC--LPRGPCSVPGAP 260
           C   C  P   LPRGPC     P    LPRGPC    AP
Sbjct: 10  CGPDCAPPAPGLPRGPCGPDCAPPAPGLPRGPCGPDCAP 48


>X74614-1|CAA52685.1|  250|Homo sapiens outer dense fiber protein
           protein.
          Length = 250

 Score = 33.1 bits (72), Expect = 1.0
 Identities = 15/28 (53%), Positives = 16/28 (57%), Gaps = 2/28 (7%)
 Frame = +3

Query: 168 CYPCSLPRGPCSVPGRP--SCLPRGPCS 245
           CYPC+ P  PCS P  P   C P  PCS
Sbjct: 202 CYPCTSPCSPCS-PCNPCNPCSPCNPCS 228


>BC104457-1|AAI04458.1|  250|Homo sapiens outer dense fiber of sperm
           tails 1 protein.
          Length = 250

 Score = 33.1 bits (72), Expect = 1.0
 Identities = 15/28 (53%), Positives = 16/28 (57%), Gaps = 2/28 (7%)
 Frame = +3

Query: 168 CYPCSLPRGPCSVPGRP--SCLPRGPCS 245
           CYPC+ P  PCS P  P   C P  PCS
Sbjct: 202 CYPCTSPCSPCS-PCNPCNPCSPCNPCS 228


>BC104456-1|AAI04457.1|  250|Homo sapiens outer dense fiber of sperm
           tails 1 protein.
          Length = 250

 Score = 33.1 bits (72), Expect = 1.0
 Identities = 15/28 (53%), Positives = 16/28 (57%), Gaps = 2/28 (7%)
 Frame = +3

Query: 168 CYPCSLPRGPCSVPGRP--SCLPRGPCS 245
           CYPC+ P  PCS P  P   C P  PCS
Sbjct: 202 CYPCTSPCSPCS-PCNPCNPCSPCNPCS 228


>AF395256-1|AAL35205.1|  112|Homo sapiens dopamine receptor D4
           protein.
          Length = 112

 Score = 33.1 bits (72), Expect = 1.0
 Identities = 22/53 (41%), Positives = 23/53 (43%), Gaps = 5/53 (9%)
 Frame = +3

Query: 123 CAP*PASAPR--CQARCCYPC-SLPRGPCSVPGRPSC--LPRGPCSVPGAPVA 266
           CAP   S P+  C   C  P   LP  PC     P    LPRGPC    AP A
Sbjct: 30  CAPAAPSLPQDPCGPDCAPPAPGLPPDPCGSNCAPPAPGLPRGPCGPDCAPPA 82


>AF395241-1|AAL35190.1|   96|Homo sapiens dopamine receptor D4
           protein.
          Length = 96

 Score = 33.1 bits (72), Expect = 1.0
 Identities = 22/53 (41%), Positives = 23/53 (43%), Gaps = 5/53 (9%)
 Frame = +3

Query: 123 CAP*PASAPR--CQARCCYPC-SLPRGPCSVPGRPSC--LPRGPCSVPGAPVA 266
           CAP   S P+  C   C  P   LP  PC     P    LPRGPC    AP A
Sbjct: 30  CAPAAPSLPQDPCGPDCAPPAPGLPPDPCGSNCAPPAPGLPRGPCGPDCAPPA 82


>BC127016-1|AAI27017.1|  259|Homo sapiens KRTAP10-8 protein protein.
          Length = 259

 Score = 32.7 bits (71), Expect = 1.4
 Identities = 20/65 (30%), Positives = 26/65 (40%), Gaps = 1/65 (1%)
 Frame = +3

Query: 114 PKHCAP*PASAPRCQARCCYPCSLPRGPCSVPGRPSCLPRGPC-SVPGAPVAYHTSPLRY 290
           P  C         CQ  CC P S     C+    PSC    PC ++  APV+   SP + 
Sbjct: 33  PSTCTGSSWQVDNCQESCCEPRSCASSCCT----PSCCAPAPCLALVCAPVSCEPSPCQS 88

Query: 291 SSAES 305
              +S
Sbjct: 89  GCTDS 93


>AF395255-1|AAL35204.1|  112|Homo sapiens dopamine receptor D4
           protein.
          Length = 112

 Score = 32.7 bits (71), Expect = 1.4
 Identities = 21/53 (39%), Positives = 22/53 (41%), Gaps = 5/53 (9%)
 Frame = +3

Query: 123 CAP*PASAPR--CQARCCYPC-SLPRGPCSVPGRPSC--LPRGPCSVPGAPVA 266
           CAP     P   C   C  P   LP+ PC     P    LPRGPC    AP A
Sbjct: 30  CAPAAPGLPPDPCGPDCAPPAPGLPQDPCGPDCAPPAPGLPRGPCGPDCAPAA 82


>AF395254-1|AAL35203.2|  112|Homo sapiens dopamine receptor D4
           protein.
          Length = 112

 Score = 32.7 bits (71), Expect = 1.4
 Identities = 21/53 (39%), Positives = 22/53 (41%), Gaps = 5/53 (9%)
 Frame = +3

Query: 123 CAP*PASAPR--CQARCCYPC-SLPRGPCSVPGRPSC--LPRGPCSVPGAPVA 266
           CAP     P   C   C  P   LP+ PC     P    LPRGPC    AP A
Sbjct: 30  CAPAAPGLPPDPCGPDCAPPAPGLPQDPCGPDCAPPAPGLPRGPCGPDCAPAA 82


>AF395251-1|AAL35200.1|  112|Homo sapiens dopamine receptor D4
           protein.
          Length = 112

 Score = 32.7 bits (71), Expect = 1.4
 Identities = 21/53 (39%), Positives = 22/53 (41%), Gaps = 5/53 (9%)
 Frame = +3

Query: 123 CAP*PASAPR--CQARCCYPC-SLPRGPCSVPGRPSC--LPRGPCSVPGAPVA 266
           CAP     P   C   C  P   LP+ PC     P    LPRGPC    AP A
Sbjct: 30  CAPAAPGLPPDPCGPDCAPPAPGLPQDPCGPDCAPPAPGLPRGPCGPDCAPAA 82


>AF395247-1|AAL35196.1|  112|Homo sapiens dopamine receptor D4
           protein.
          Length = 112

 Score = 32.7 bits (71), Expect = 1.4
 Identities = 21/53 (39%), Positives = 22/53 (41%), Gaps = 5/53 (9%)
 Frame = +3

Query: 123 CAP*PASAPR--CQARCCYPC-SLPRGPCSVPGRPSC--LPRGPCSVPGAPVA 266
           CAP     P   C   C  P   LP+ PC     P    LPRGPC    AP A
Sbjct: 30  CAPAAPGLPPDPCGPDCAPPAPGLPQDPCGPDCAPPAPGLPRGPCGPDCAPAA 82


>AF395239-1|AAL35188.1|   96|Homo sapiens dopamine receptor D4
           protein.
          Length = 96

 Score = 32.7 bits (71), Expect = 1.4
 Identities = 21/53 (39%), Positives = 22/53 (41%), Gaps = 5/53 (9%)
 Frame = +3

Query: 123 CAP*PASAPR--CQARCCYPC-SLPRGPCSVPGRPSC--LPRGPCSVPGAPVA 266
           CAP     P   C   C  P   LP+ PC     P    LPRGPC    AP A
Sbjct: 30  CAPAAPGLPPDPCGPDCAPPAPGLPQDPCGPDCAPPAPGLPRGPCGPDCAPAA 82


>AB076355-1|BAD01542.1|  259|Homo sapiens keratin associated protein
           protein.
          Length = 259

 Score = 32.7 bits (71), Expect = 1.4
 Identities = 20/65 (30%), Positives = 26/65 (40%), Gaps = 1/65 (1%)
 Frame = +3

Query: 114 PKHCAP*PASAPRCQARCCYPCSLPRGPCSVPGRPSCLPRGPC-SVPGAPVAYHTSPLRY 290
           P  C         CQ  CC P S     C+    PSC    PC ++  APV+   SP + 
Sbjct: 33  PSTCTGSSWQVDNCQESCCEPRSCASSCCT----PSCCAPAPCLALVCAPVSCEPSPCQS 88

Query: 291 SSAES 305
              +S
Sbjct: 89  GCTDS 93


>M88338-1|AAA36606.1|  391|Homo sapiens serum protein protein.
          Length = 391

 Score = 32.3 bits (70), Expect = 1.8
 Identities = 19/59 (32%), Positives = 24/59 (40%)
 Frame = +3

Query: 138 ASAPRCQARCCYPCSLPRGPCSVPGRPSCLPRGPCSVPGAPVAYHTSPLRYSSAESVSS 314
           A  P   A    P + P GP + P   +  P  P + P AP A  T P     A + SS
Sbjct: 222 AETPAPAANPPAPTANPTGPAANPPATTANPPAPAANPSAPAATPTGPAANPPAPAASS 280


>CR456524-1|CAG30410.1|  391|Homo sapiens MSE55 protein.
          Length = 391

 Score = 32.3 bits (70), Expect = 1.8
 Identities = 19/59 (32%), Positives = 24/59 (40%)
 Frame = +3

Query: 138 ASAPRCQARCCYPCSLPRGPCSVPGRPSCLPRGPCSVPGAPVAYHTSPLRYSSAESVSS 314
           A  P   A    P + P GP + P   +  P  P + P AP A  T P     A + SS
Sbjct: 222 AETPAPAANPPAPTANPTGPAANPPATTANPPAPAANPSAPAATPTGPAANPPAPAASS 280


>AY151033-1|AAN73259.1|  112|Homo sapiens dopamine receptor D4
           protein.
          Length = 112

 Score = 32.3 bits (70), Expect = 1.8
 Identities = 21/53 (39%), Positives = 22/53 (41%), Gaps = 5/53 (9%)
 Frame = +3

Query: 123 CAP*PASAPR--CQARCCYPCS-LPRGPCSVPGRPSC--LPRGPCSVPGAPVA 266
           CAP     P   C   C  P   LP+ PC     P    LPRGPC    AP A
Sbjct: 30  CAPAAPGLPPDPCGPDCAPPAPRLPQDPCGPDCAPPAPGLPRGPCGPDCAPAA 82


>AL022315-2|CAB42833.1|  391|Homo sapiens CDC42 effector protein
           (Rho GTPase binding) 1 protein.
          Length = 391

 Score = 32.3 bits (70), Expect = 1.8
 Identities = 19/59 (32%), Positives = 24/59 (40%)
 Frame = +3

Query: 138 ASAPRCQARCCYPCSLPRGPCSVPGRPSCLPRGPCSVPGAPVAYHTSPLRYSSAESVSS 314
           A  P   A    P + P GP + P   +  P  P + P AP A  T P     A + SS
Sbjct: 222 AETPAPAANPPAPTANPTGPAANPPATTANPPAPAANPSAPAATPTGPAANPPAPAASS 280


>AK074268-1|BAB85034.1|  274|Homo sapiens protein ( Homo sapiens
           cDNA FLJ23688 fis, clone HEP10127. ).
          Length = 274

 Score = 32.3 bits (70), Expect = 1.8
 Identities = 21/57 (36%), Positives = 27/57 (47%), Gaps = 2/57 (3%)
 Frame = +3

Query: 123 CAP*PASAPRCQ--ARCCYPCSLPRGPCSVPGRPSCLPRGPCSVPGAPVAYHTSPLR 287
           C P    A RC+  +RC  P S PR P S    P+  P    ++P  PVA   +P R
Sbjct: 214 CCPRRHRASRCRPRSRCPLPPSRPRSPASPAHSPT--PTSALALPHLPVASCPAPHR 268


>AF395257-1|AAL35206.1|  128|Homo sapiens dopamine receptor D4
           protein.
          Length = 128

 Score = 32.3 bits (70), Expect = 1.8
 Identities = 21/53 (39%), Positives = 22/53 (41%), Gaps = 5/53 (9%)
 Frame = +3

Query: 123 CAP*PASAPR--CQARCCYPC-SLPRGPCSVPGRPSC--LPRGPCSVPGAPVA 266
           CAP     P+  C   C  P   LP  PC     P    LPRGPC    AP A
Sbjct: 46  CAPPAPGLPQDPCGPDCAPPAPGLPPDPCGSNCAPPAPGLPRGPCGPDCAPAA 98


>AF395233-1|AAL35182.1|   80|Homo sapiens dopamine receptor D4
           protein.
          Length = 80

 Score = 32.3 bits (70), Expect = 1.8
 Identities = 18/41 (43%), Positives = 19/41 (46%), Gaps = 3/41 (7%)
 Frame = +3

Query: 153 CQARCCYPC-SLPRGPCSVPGRPSC--LPRGPCSVPGAPVA 266
           C   C  P  SLP+ PC     P    LPRGPC    AP A
Sbjct: 10  CGPDCAPPAPSLPQDPCGPDCAPPAPGLPRGPCGPDCAPAA 50


>L12398-1|AAB59386.1|  467|Homo sapiens dopamine receptor D4
           protein.
          Length = 467

 Score = 31.9 bits (69), Expect = 2.4
 Identities = 21/53 (39%), Positives = 22/53 (41%), Gaps = 5/53 (9%)
 Frame = +3

Query: 123 CAP*PASAPR--CQARCCYPC-SLPRGPCSVPGRPSC--LPRGPCSVPGAPVA 266
           CAP     P   C   C  P   LP+ PC     P    LPRGPC    AP A
Sbjct: 278 CAPAAPGLPPDPCGPDCAPPAPGLPQDPCGPDCAPPAPGLPRGPCGPDCAPPA 330


>EF489032-1|ABO48379.1|  112|Homo sapiens dopamine D4 receptor
           protein.
          Length = 112

 Score = 31.9 bits (69), Expect = 2.4
 Identities = 21/53 (39%), Positives = 22/53 (41%), Gaps = 5/53 (9%)
 Frame = +3

Query: 123 CAP*PASAPR--CQARCCYPC-SLPRGPCSVPGRPSC--LPRGPCSVPGAPVA 266
           CAP     P   C   C  P   LP+ PC     P    LPRGPC    AP A
Sbjct: 30  CAPAAPGLPPDPCGPDCAPPAPGLPQDPCGPDCAPPAPGLPRGPCGPDCAPPA 82


>EF489031-1|ABO48378.1|  112|Homo sapiens dopamine D4 receptor
           protein.
          Length = 112

 Score = 31.9 bits (69), Expect = 2.4
 Identities = 21/53 (39%), Positives = 22/53 (41%), Gaps = 5/53 (9%)
 Frame = +3

Query: 123 CAP*PASAPR--CQARCCYPC-SLPRGPCSVPGRPSC--LPRGPCSVPGAPVA 266
           CAP     P   C   C  P   LP+ PC     P    LPRGPC    AP A
Sbjct: 30  CAPAAPGLPPDPCGPDCAPPAPGLPQDPCGPDCAPPAPGLPRGPCGPDCAPPA 82


>EF489030-1|ABO48377.1|  112|Homo sapiens dopamine D4 receptor
           protein.
          Length = 112

 Score = 31.9 bits (69), Expect = 2.4
 Identities = 21/53 (39%), Positives = 22/53 (41%), Gaps = 5/53 (9%)
 Frame = +3

Query: 123 CAP*PASAPR--CQARCCYPC-SLPRGPCSVPGRPSC--LPRGPCSVPGAPVA 266
           CAP     P   C   C  P   LP+ PC     P    LPRGPC    AP A
Sbjct: 30  CAPAAPGLPPDPCGPDCAPPAPGLPQDPCGPDCAPPAPGLPRGPCGPDCAPPA 82


>DQ846850-1|ABI15202.1|  131|Homo sapiens dopamine D4 receptor
           protein.
          Length = 131

 Score = 31.9 bits (69), Expect = 2.4
 Identities = 21/53 (39%), Positives = 22/53 (41%), Gaps = 5/53 (9%)
 Frame = +3

Query: 123 CAP*PASAPR--CQARCCYPC-SLPRGPCSVPGRPSC--LPRGPCSVPGAPVA 266
           CAP     P   C   C  P   LP+ PC     P    LPRGPC    AP A
Sbjct: 49  CAPAAPGLPPDPCGPDCAPPAPGLPQDPCGPDCAPPAPGLPRGPCGPDCAPPA 101


>AY151034-1|AAN73260.1|  112|Homo sapiens dopamine receptor D4
           protein.
          Length = 112

 Score = 31.9 bits (69), Expect = 2.4
 Identities = 21/53 (39%), Positives = 22/53 (41%), Gaps = 5/53 (9%)
 Frame = +3

Query: 123 CAP*PASAPR--CQARCCYPC-SLPRGPCSVPGRPSC--LPRGPCSVPGAPVA 266
           CAP     P   C   C  P   LP+ PC     P    LPRGPC    AP A
Sbjct: 30  CAPAAPGLPPDPCGPDCAPPAPGLPQDPCGPDCAPPAPGLPRGPCGPDCAPPA 82


>AF395263-1|AAL35212.1|  160|Homo sapiens dopamine receptor D4
           protein.
          Length = 160

 Score = 31.9 bits (69), Expect = 2.4
 Identities = 21/53 (39%), Positives = 22/53 (41%), Gaps = 5/53 (9%)
 Frame = +3

Query: 123 CAP*PASAPR--CQARCCYPC-SLPRGPCSVPGRPSC--LPRGPCSVPGAPVA 266
           CAP     P   C   C  P   LP+ PC     P    LPRGPC    AP A
Sbjct: 78  CAPAAPGLPPDPCGPDCAPPAPGLPQDPCGPDCAPPAPGLPRGPCGPDCAPPA 130



 Score = 31.1 bits (67), Expect = 4.1
 Identities = 21/53 (39%), Positives = 21/53 (39%), Gaps = 5/53 (9%)
 Frame = +3

Query: 123 CAP*PASAPR--CQARCCYPC-SLPRGPCSVPGRPSC--LPRGPCSVPGAPVA 266
           CAP     PR  C   C      LP  PC     P    LPRGPC    AP A
Sbjct: 30  CAPAAPGLPRDPCGPDCAPAAPGLPPDPCGPDCAPPAPGLPRGPCGPDCAPAA 82


>AF395262-1|AAL35211.2|  112|Homo sapiens dopamine receptor D4
           protein.
          Length = 112

 Score = 31.9 bits (69), Expect = 2.4
 Identities = 22/53 (41%), Positives = 22/53 (41%), Gaps = 5/53 (9%)
 Frame = +3

Query: 123 CAP*PASAPR--CQARCCYPC-SLPRGPCSVPGRPSC--LPRGPCSVPGAPVA 266
           CAP   S P   C   C  P   LP  PC     P    LPRGPC    AP A
Sbjct: 30  CAPAAPSLPPDPCGPDCAPPAPGLPPDPCGSNCAPPAPGLPRGPCGPDCAPPA 82


>AF395246-1|AAL35195.1|  112|Homo sapiens dopamine receptor D4
           protein.
          Length = 112

 Score = 31.9 bits (69), Expect = 2.4
 Identities = 21/53 (39%), Positives = 22/53 (41%), Gaps = 5/53 (9%)
 Frame = +3

Query: 123 CAP*PASAPR--CQARCCYPC-SLPRGPCSVPGRPSC--LPRGPCSVPGAPVA 266
           CAP     P   C   C  P   LP+ PC     P    LPRGPC    AP A
Sbjct: 30  CAPAAPGLPPDPCGPDCAPPAPGLPQDPCGPDCAPPAPGLPRGPCGPDCAPPA 82


>AF395245-1|AAL35194.1|  112|Homo sapiens dopamine receptor D4
           protein.
          Length = 112

 Score = 31.9 bits (69), Expect = 2.4
 Identities = 21/53 (39%), Positives = 22/53 (41%), Gaps = 5/53 (9%)
 Frame = +3

Query: 123 CAP*PASAPR--CQARCCYPC-SLPRGPCSVPGRPSC--LPRGPCSVPGAPVA 266
           CAP     P   C   C  P   LP+ PC     P    LPRGPC    AP A
Sbjct: 30  CAPAAPGLPPDPCGPDCAPPAPGLPQDPCGPDCAPPAPGLPRGPCGPDCAPPA 82


>AF395244-1|AAL35193.1|   96|Homo sapiens dopamine receptor D4
           protein.
          Length = 96

 Score = 31.9 bits (69), Expect = 2.4
 Identities = 21/53 (39%), Positives = 22/53 (41%), Gaps = 5/53 (9%)
 Frame = +3

Query: 123 CAP*PASAPR--CQARCCYPC-SLPRGPCSVPGRPSC--LPRGPCSVPGAPVA 266
           CAP     P   C   C  P   LP+ PC     P    LPRGPC    AP A
Sbjct: 14  CAPAAPGLPPDPCGPDCAPPAPGLPQDPCGPDCAPPAPGLPRGPCGPDCAPPA 66


>AF395242-1|AAL35191.2|   96|Homo sapiens dopamine receptor D4
           protein.
          Length = 96

 Score = 31.9 bits (69), Expect = 2.4
 Identities = 21/53 (39%), Positives = 22/53 (41%), Gaps = 5/53 (9%)
 Frame = +3

Query: 123 CAP*PASAPR--CQARCCYPC-SLPRGPCSVPGRPSC--LPRGPCSVPGAPVA 266
           CAP     P   C   C  P   LP+ PC     P    LPRGPC    AP A
Sbjct: 14  CAPAAPGLPPDPCGPDCAPPAPGLPQDPCGPDCAPPAPGLPRGPCGPDCAPPA 66


>AF395240-1|AAL35189.1|   96|Homo sapiens dopamine receptor D4
           protein.
          Length = 96

 Score = 31.9 bits (69), Expect = 2.4
 Identities = 21/53 (39%), Positives = 22/53 (41%), Gaps = 5/53 (9%)
 Frame = +3

Query: 123 CAP*PASAPR--CQARCCYPC-SLPRGPCSVPGRPSC--LPRGPCSVPGAPVA 266
           CAP     P   C   C  P   LP+ PC     P    LPRGPC    AP A
Sbjct: 30  CAPAAPGLPPDPCGPDCAPPAPGLPQDPCGPDCAPPAPGLPRGPCGPDCAPPA 82


>AF395226-1|AAL35175.1|   64|Homo sapiens dopamine receptor D4
           protein.
          Length = 64

 Score = 31.9 bits (69), Expect = 2.4
 Identities = 15/27 (55%), Positives = 15/27 (55%)
 Frame = +3

Query: 186 PRGPCSVPGRPSCLPRGPCSVPGAPVA 266
           P GP   P  P CLPRGPC    AP A
Sbjct: 9   PCGPDCAPPAP-CLPRGPCGPDCAPAA 34


>EF489033-1|ABO48380.1|  112|Homo sapiens dopamine D4 receptor
           protein.
          Length = 112

 Score = 31.5 bits (68), Expect = 3.1
 Identities = 21/53 (39%), Positives = 22/53 (41%), Gaps = 5/53 (9%)
 Frame = +3

Query: 123 CAP*PASAPR--CQARCCYPC-SLPRGPCSVPGRPSC--LPRGPCSVPGAPVA 266
           CAP     P   C   C  P   LP+ PC     P    LPRGPC    AP A
Sbjct: 30  CAPAAPGLPPDPCGPDCAPPAPGLPQDPCGPNCAPPAPGLPRGPCGPDCAPPA 82


>AF395243-1|AAL35192.1|   96|Homo sapiens dopamine receptor D4
           protein.
          Length = 96

 Score = 31.5 bits (68), Expect = 3.1
 Identities = 21/53 (39%), Positives = 22/53 (41%), Gaps = 5/53 (9%)
 Frame = +3

Query: 123 CAP*PASAPR--CQARCCYPC-SLPRGPCSVPGRPSC--LPRGPCSVPGAPVA 266
           CAP     PR  C   C      LP+ PC     P    LPRGPC    AP A
Sbjct: 14  CAPPAPGLPRGPCGPDCAPAAPGLPQDPCGPDCAPPAPGLPRGPCGPDCAPPA 66


>AF395230-1|AAL35179.1|   80|Homo sapiens dopamine receptor D4
           protein.
          Length = 80

 Score = 31.5 bits (68), Expect = 3.1
 Identities = 21/53 (39%), Positives = 22/53 (41%), Gaps = 5/53 (9%)
 Frame = +3

Query: 123 CAP*PASAPR--CQARCCYPC-SLPRGPCSVPGRPSC--LPRGPCSVPGAPVA 266
           CAP     PR  C   C      LP+ PC     P    LPRGPC    AP A
Sbjct: 14  CAPPAPGLPRGPCGPDCAPAAPGLPQDPCGPDCAPPAPGLPRGPCGPDCAPPA 66


>AB065765-1|BAC05985.1|  419|Homo sapiens seven transmembrane helix
           receptor protein.
          Length = 419

 Score = 31.5 bits (68), Expect = 3.1
 Identities = 26/73 (35%), Positives = 29/73 (39%)
 Frame = +3

Query: 48  RGVESWTSGCSRALLSR*SRFFPKHCAP*PASAPRCQARCCYPCSLPRGPCSVPGRPSCL 227
           RG++ W       L  R  RF P    P P+  P        PC    GP   P  P  L
Sbjct: 217 RGLQRWEVARRAKLHGRAPRF-PSGPGP-PSPTPPAPRLPQDPC----GPDCAPPAPG-L 269

Query: 228 PRGPCSVPGAPVA 266
           PRGPC    AP A
Sbjct: 270 PRGPCGPDCAPAA 282


>AK090647-1|BAC03496.1|  353|Homo sapiens   protein.
          Length = 353

 Score = 30.7 bits (66), Expect = 5.5
 Identities = 25/73 (34%), Positives = 32/73 (43%), Gaps = 4/73 (5%)
 Frame = +3

Query: 75  CSRALLSR*SRFFPKHCAP*PA--SAPRCQARCCYPCSLPRGP-CSVPGRPSCLPRGPCS 245
           CS     R S     HC+P  +   +P C  RC   CSL   P CS+     C P   CS
Sbjct: 78  CSPCCSLRCSPCCSLHCSPCCSLRCSPCCSLRCSPCCSLHCSPCCSLQCSLHCSPH--CS 135

Query: 246 VPGAPVAY-HTSP 281
           +  +P  + H SP
Sbjct: 136 LHCSPCCFLHYSP 148


>AK024477-1|BAB15767.1| 1382|Homo sapiens FLJ00070 protein protein.
          Length = 1382

 Score = 30.7 bits (66), Expect = 5.5
 Identities = 14/25 (56%), Positives = 15/25 (60%)
 Frame = +3

Query: 186 PRGPCSVPGRPSCLPRGPCSVPGAP 260
           PRGP   P  P+ LPR P   PGAP
Sbjct: 31  PRGPLP-PASPAALPRCPLPSPGAP 54


>Y16787-1|CAA76383.1|  416|Homo sapiens type I hair keratin 1
           protein.
          Length = 416

 Score = 30.3 bits (65), Expect = 7.3
 Identities = 14/28 (50%), Positives = 16/28 (57%)
 Frame = +3

Query: 177 CSLPRGPCSVPGRPSCLPRGPCSVPGAP 260
           CS P GPC      SC+P  PC+ P AP
Sbjct: 378 CSKPIGPCLSNPCTSCVPPAPCT-PCAP 404


>X86570-1|CAA60378.1|  416|Homo sapiens type I keratin protein.
          Length = 416

 Score = 30.3 bits (65), Expect = 7.3
 Identities = 14/28 (50%), Positives = 16/28 (57%)
 Frame = +3

Query: 177 CSLPRGPCSVPGRPSCLPRGPCSVPGAP 260
           CS P GPC      SC+P  PC+ P AP
Sbjct: 378 CSKPIGPCLSNPCTSCVPPAPCT-PCAP 404


>U79266-1|AAB50210.1|  285|Homo sapiens unknown protein.
          Length = 285

 Score = 30.3 bits (65), Expect = 7.3
 Identities = 15/34 (44%), Positives = 16/34 (47%), Gaps = 1/34 (2%)
 Frame = +3

Query: 102 SRFFPKHCAP*PASAPRCQARCCYP-CSLPRGPC 200
           SR FP+HC P  A  P        P C LP G C
Sbjct: 24  SRAFPQHCRPRDAERPPSPRSPLMPGCELPVGTC 57


>S75797-1|AAB32812.1|   85|Homo sapiens type I hair keratin protein.
          Length = 85

 Score = 30.3 bits (65), Expect = 7.3
 Identities = 14/28 (50%), Positives = 16/28 (57%)
 Frame = +3

Query: 177 CSLPRGPCSVPGRPSCLPRGPCSVPGAP 260
           CS P GPC      SC+P  PC+ P AP
Sbjct: 47  CSKPIGPCLSNPCTSCVPPAPCT-PCAP 73


>BC130605-1|AAI30606.1|  110|Homo sapiens late cornified envelope 2D
           protein.
          Length = 110

 Score = 30.3 bits (65), Expect = 7.3
 Identities = 17/46 (36%), Positives = 19/46 (41%), Gaps = 2/46 (4%)
 Frame = +3

Query: 114 PKHCAP*--PASAPRCQARCCYPCSLPRGPCSVPGRPSCLPRGPCS 245
           P  C P   P   P+C  +C  PCS     C  P   SC   GP S
Sbjct: 17  PPKCTPKCPPKCPPKCPPQCPAPCSPAVSSCCGPSSGSCC--GPSS 60


>BC130603-1|AAI30604.1|  110|Homo sapiens late cornified envelope 2D
           protein.
          Length = 110

 Score = 30.3 bits (65), Expect = 7.3
 Identities = 17/46 (36%), Positives = 19/46 (41%), Gaps = 2/46 (4%)
 Frame = +3

Query: 114 PKHCAP*--PASAPRCQARCCYPCSLPRGPCSVPGRPSCLPRGPCS 245
           P  C P   P   P+C  +C  PCS     C  P   SC   GP S
Sbjct: 17  PPKCTPKCPPKCPPKCPPQCPAPCSPAVSSCCGPSSGSCC--GPSS 60


>BC114468-1|AAI14469.1|  416|Homo sapiens keratin 31 protein.
          Length = 416

 Score = 30.3 bits (65), Expect = 7.3
 Identities = 14/28 (50%), Positives = 16/28 (57%)
 Frame = +3

Query: 177 CSLPRGPCSVPGRPSCLPRGPCSVPGAP 260
           CS P GPC      SC+P  PC+ P AP
Sbjct: 378 CSKPIGPCLSNPCTSCVPPAPCT-PCAP 404


>AY151032-1|AAN73258.1|   96|Homo sapiens dopamine receptor D4
           protein.
          Length = 96

 Score = 30.3 bits (65), Expect = 7.3
 Identities = 21/53 (39%), Positives = 21/53 (39%), Gaps = 5/53 (9%)
 Frame = +3

Query: 123 CAP*PASAPR--CQARCCYPC-SLPRGPCSVPGRPSC--LPRGPCSVPGAPVA 266
           CAP     PR  C   C      LP  PC     P    LPRGPC    AP A
Sbjct: 14  CAPPAPGLPRGPCGPDCAPAAPGLPPDPCGPDCAPPAPGLPRGPCGPDCAPPA 66


>AL139247-4|CAI21682.1|  110|Homo sapiens late cornified envelope 2D
           protein.
          Length = 110

 Score = 30.3 bits (65), Expect = 7.3
 Identities = 17/46 (36%), Positives = 19/46 (41%), Gaps = 2/46 (4%)
 Frame = +3

Query: 114 PKHCAP*--PASAPRCQARCCYPCSLPRGPCSVPGRPSCLPRGPCS 245
           P  C P   P   P+C  +C  PCS     C  P   SC   GP S
Sbjct: 17  PPKCTPKCPPKCPPKCPPQCPAPCSPAVSSCCGPSSGSCC--GPSS 60


>AF395234-1|AAL35183.1|   80|Homo sapiens dopamine receptor D4
           protein.
          Length = 80

 Score = 30.3 bits (65), Expect = 7.3
 Identities = 17/37 (45%), Positives = 18/37 (48%), Gaps = 4/37 (10%)
 Frame = +3

Query: 168 CYPC--SLPRGPCSVPGRPSC--LPRGPCSVPGAPVA 266
           C P   SLP+ PC     P    LPRGPC    AP A
Sbjct: 14  CAPAAPSLPQDPCGPDCAPPAPGLPRGPCGPDCAPAA 50


>AF395229-1|AAL35178.1|   80|Homo sapiens dopamine receptor D4
           protein.
          Length = 80

 Score = 30.3 bits (65), Expect = 7.3
 Identities = 17/37 (45%), Positives = 18/37 (48%), Gaps = 4/37 (10%)
 Frame = +3

Query: 168 CYPC--SLPRGPCSVPGRPSC--LPRGPCSVPGAPVA 266
           C P   SLP+ PC     P    LPRGPC    AP A
Sbjct: 14  CAPAAPSLPQDPCGPDCAPPAPGLPRGPCGPDCAPAA 50


>DQ118293-1|AAZ99029.1| 2391|Homo sapiens filaggrin 2 protein.
          Length = 2391

 Score = 29.9 bits (64), Expect = 9.6
 Identities = 18/37 (48%), Positives = 21/37 (56%), Gaps = 3/37 (8%)
 Frame = -3

Query: 114 GRNGFSGRVVHGSS--QKSSF-RHRDQSTQYYDFGEH 13
           G +  SG   HGSS  Q S F +HR  S QY  FG+H
Sbjct: 851 GSSQSSGYGQHGSSSGQTSGFGQHRSSSGQYSGFGQH 887


>BC120941-1|AAI20942.1|  146|Homo sapiens keratin associated protein
           12-2 protein.
          Length = 146

 Score = 29.9 bits (64), Expect = 9.6
 Identities = 22/60 (36%), Positives = 26/60 (43%), Gaps = 5/60 (8%)
 Frame = +3

Query: 114 PKHCAP*PASAPRCQARCCYPCSLPRGPCSVPGRPSCLPRGPC-----SVPGAPVAYHTS 278
           P  C P   +AP CQ+  C P S    P  V   PSC   G C     SV   P++Y  S
Sbjct: 87  PVSCRPIVCAAPSCQSSLCVPVSC--RPV-VYAAPSCQSSGCCQPSCTSVLCRPISYSIS 143


>AY827490-1|AAX12417.1| 2391|Homo sapiens ifapsoriasin protein.
          Length = 2391

 Score = 29.9 bits (64), Expect = 9.6
 Identities = 18/37 (48%), Positives = 21/37 (56%), Gaps = 3/37 (8%)
 Frame = -3

Query: 114 GRNGFSGRVVHGSS--QKSSF-RHRDQSTQYYDFGEH 13
           G +  SG   HGSS  Q S F +HR  S QY  FG+H
Sbjct: 851 GSSQSSGYGQHGSSSGQTSGFGQHRSSSGQYSGFGQH 887


>AY396741-1|AAR91619.1| 2850|Homo sapiens hornerin precursor protein.
          Length = 2850

 Score = 29.9 bits (64), Expect = 9.6
 Identities = 14/34 (41%), Positives = 18/34 (52%)
 Frame = -3

Query: 114  GRNGFSGRVVHGSSQKSSFRHRDQSTQYYDFGEH 13
            GR+  SGR   GS Q S F H+  S Q   + +H
Sbjct: 914  GRSSSSGRHGSGSGQSSGFGHKSSSGQSSGYTQH 947


>AL589986-3|CAH70026.1| 2850|Homo sapiens hornerin protein.
          Length = 2850

 Score = 29.9 bits (64), Expect = 9.6
 Identities = 14/34 (41%), Positives = 18/34 (52%)
 Frame = -3

Query: 114  GRNGFSGRVVHGSSQKSSFRHRDQSTQYYDFGEH 13
            GR+  SGR   GS Q S F H+  S Q   + +H
Sbjct: 914  GRSSSSGRHGSGSGQSSGFGHKSSSGQSSGYTQH 947


>AL356504-2|CAC13173.2| 2391|Homo sapiens filaggrin 2 protein.
          Length = 2391

 Score = 29.9 bits (64), Expect = 9.6
 Identities = 18/37 (48%), Positives = 21/37 (56%), Gaps = 3/37 (8%)
 Frame = -3

Query: 114 GRNGFSGRVVHGSS--QKSSF-RHRDQSTQYYDFGEH 13
           G +  SG   HGSS  Q S F +HR  S QY  FG+H
Sbjct: 851 GSSQSSGYGQHGSSSGQTSGFGQHRSSSGQYSGFGQH 887


>AL139247-6|CAI21684.1|  110|Homo sapiens late cornified envelope 2B
           protein.
          Length = 110

 Score = 29.9 bits (64), Expect = 9.6
 Identities = 18/53 (33%), Positives = 23/53 (43%), Gaps = 6/53 (11%)
 Frame = +3

Query: 117 KHCAP*PASAPRCQARC---CYPCSLPR--GPCSVPGRPSCLP-RGPCSVPGA 257
           + C P P   P+C  +C   C P  LP+   PCS      C P  G C  P +
Sbjct: 8   QQCQPPPKCPPKCTPKCPPKCPPKCLPQCPAPCSPAVSSCCGPISGGCCGPSS 60


>AK090684-1|BAC03505.1|  294|Homo sapiens protein ( Homo sapiens
           cDNA FLJ33365 fis, clone BRACE2005460, moderately
           similar to Xenopus laevis mRNA for Kielin. ).
          Length = 294

 Score = 29.9 bits (64), Expect = 9.6
 Identities = 18/46 (39%), Positives = 21/46 (45%), Gaps = 5/46 (10%)
 Frame = +3

Query: 138 ASAPRCQARCCYP--CSLPRGPCSVPGR--PSCLPR-GPCSVPGAP 260
           A   RCQ++ C P  C   + P   PG   P CLPR   C   G P
Sbjct: 2   AGTVRCQSQRCSPLSCGPDKAPALSPGSCCPRCLPRPASCMAFGDP 47


>AJ566389-1|CAD97469.1|  146|Homo sapiens keratin associated protein
           KAP12.2 protein.
          Length = 146

 Score = 29.9 bits (64), Expect = 9.6
 Identities = 22/60 (36%), Positives = 26/60 (43%), Gaps = 5/60 (8%)
 Frame = +3

Query: 114 PKHCAP*PASAPRCQARCCYPCSLPRGPCSVPGRPSCLPRGPC-----SVPGAPVAYHTS 278
           P  C P   +AP CQ+  C P S    P  V   PSC   G C     SV   P++Y  S
Sbjct: 87  PVSCRPIVCAAPSCQSSLCVPVSC--RPV-VYAAPSCQSSGCCQPSCTSVLCRPISYSIS 143


>AF005080-1|AAB83960.1|  110|Homo sapiens skin-specific protein
           protein.
          Length = 110

 Score = 29.9 bits (64), Expect = 9.6
 Identities = 18/53 (33%), Positives = 23/53 (43%), Gaps = 6/53 (11%)
 Frame = +3

Query: 117 KHCAP*PASAPRCQARC---CYPCSLPR--GPCSVPGRPSCLP-RGPCSVPGA 257
           + C P P   P+C  +C   C P  LP+   PCS      C P  G C  P +
Sbjct: 8   QQCQPPPKCPPKCTPKCPPKCPPKCLPQCPAPCSPAVSSCCGPISGGCCGPSS 60


>AB076362-1|BAD01549.1|  146|Homo sapiens keratin associated protein
           protein.
          Length = 146

 Score = 29.9 bits (64), Expect = 9.6
 Identities = 22/60 (36%), Positives = 26/60 (43%), Gaps = 5/60 (8%)
 Frame = +3

Query: 114 PKHCAP*PASAPRCQARCCYPCSLPRGPCSVPGRPSCLPRGPC-----SVPGAPVAYHTS 278
           P  C P   +AP CQ+  C P S    P  V   PSC   G C     SV   P++Y  S
Sbjct: 87  PVSCRPIVCAAPSCQSSLCVPVSC--RPV-VYAAPSCQSSGCCQPSCTSVLCRPISYSIS 143


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 91,823,290
Number of Sequences: 237096
Number of extensions: 1625293
Number of successful extensions: 5840
Number of sequences better than 10.0: 79
Number of HSP's better than 10.0 without gapping: 4859
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5751
length of database: 76,859,062
effective HSP length: 88
effective length of database: 55,994,614
effective search space used: 8455186714
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).