SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30015
         (660 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

X56932-1|CAA40254.1|  203|Homo sapiens 23 kD highly basic protei...   158   2e-38
BC071929-1|AAH71929.1|  203|Homo sapiens ribosomal protein L13a ...   158   2e-38
BC070223-1|AAH70223.1|  203|Homo sapiens ribosomal protein L13a ...   158   2e-38
BC065236-1|AAH65236.1|  203|Homo sapiens ribosomal protein L13a ...   158   2e-38
BC062537-1|AAH62537.1|  203|Homo sapiens ribosomal protein L13a ...   158   2e-38
BC004900-1|AAH04900.2|  201|Homo sapiens RPL13A protein protein.      158   2e-38
BC001836-1|AAH01836.1|  203|Homo sapiens ribosomal protein L13a ...   158   2e-38
BC001675-1|AAH01675.1|  203|Homo sapiens ribosomal protein L13a ...   158   2e-38
BC000514-1|AAH00514.1|  203|Homo sapiens ribosomal protein L13a ...   158   2e-38
AK222747-1|BAD96467.1|  203|Homo sapiens ribosomal protein L13a ...   158   2e-38
AB028893-1|BAA88214.1|  203|Homo sapiens ribosomal protein L13a ...   158   2e-38
AL356120-1|CAH73036.1|  203|Homo sapiens protein ( Human DNA seq...   150   5e-36
BC105605-1|AAI05606.1|  142|Homo sapiens RPL13A protein protein.       71   3e-12
AB082924-1|BAC16800.1|  142|Homo sapiens ribosomal protein L13a ...    70   8e-12
BC067891-1|AAH67891.1|  102|Homo sapiens Unknown (protein for MG...    41   0.003

>X56932-1|CAA40254.1|  203|Homo sapiens 23 kD highly basic protein
           protein.
          Length = 203

 Score =  158 bits (383), Expect = 2e-38
 Identities = 79/160 (49%), Positives = 99/160 (61%)
 Frame = +3

Query: 15  KAIVIDGRGHLLGRLAAVIAKVLLEGNKVVVVRCEQINISGNFFRNKLKLMSFLRKRCNV 194
           + +V+DGRGHLLGRLAA++AK +L G KVVVVRCE INISGNF+RNKLK ++FLRKR N 
Sbjct: 5   QVLVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNT 64

Query: 195 NPARGPFHFRAPSKILWKTVEA*SHTKQSVARMLLGGYVHMMGALLPLITXXXXXXXXXX 374
           NP+RGP+HFRAPS+I W+TV      K    +  L       G   P             
Sbjct: 65  NPSRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAAL 124

Query: 375 XXXXXXXXXXXCHVGRLSHEIGWKYRDVVRKLEDKRKGKA 494
                       ++GRL+HE+GWKY+ V   LE+KRK KA
Sbjct: 125 KVVRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKA 164



 Score = 53.6 bits (123), Expect = 6e-07
 Identities = 24/50 (48%), Positives = 30/50 (60%)
 Frame = +2

Query: 254 RGMIPHKTERGKNALRRLRTYDGCPPPFDNXXXXXXXXXXXXFCLKPGRK 403
           RGM+PHKT+RG+ AL RL+ +DG PPP+D               LKP RK
Sbjct: 85  RGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKVVRLKPTRK 134


>BC071929-1|AAH71929.1|  203|Homo sapiens ribosomal protein L13a
           protein.
          Length = 203

 Score =  158 bits (383), Expect = 2e-38
 Identities = 79/160 (49%), Positives = 99/160 (61%)
 Frame = +3

Query: 15  KAIVIDGRGHLLGRLAAVIAKVLLEGNKVVVVRCEQINISGNFFRNKLKLMSFLRKRCNV 194
           + +V+DGRGHLLGRLAA++AK +L G KVVVVRCE INISGNF+RNKLK ++FLRKR N 
Sbjct: 5   QVLVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNT 64

Query: 195 NPARGPFHFRAPSKILWKTVEA*SHTKQSVARMLLGGYVHMMGALLPLITXXXXXXXXXX 374
           NP+RGP+HFRAPS+I W+TV      K    +  L       G   P             
Sbjct: 65  NPSRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAAL 124

Query: 375 XXXXXXXXXXXCHVGRLSHEIGWKYRDVVRKLEDKRKGKA 494
                       ++GRL+HE+GWKY+ V   LE+KRK KA
Sbjct: 125 KVVRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKA 164



 Score = 53.6 bits (123), Expect = 6e-07
 Identities = 24/50 (48%), Positives = 30/50 (60%)
 Frame = +2

Query: 254 RGMIPHKTERGKNALRRLRTYDGCPPPFDNXXXXXXXXXXXXFCLKPGRK 403
           RGM+PHKT+RG+ AL RL+ +DG PPP+D               LKP RK
Sbjct: 85  RGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKVVRLKPTRK 134


>BC070223-1|AAH70223.1|  203|Homo sapiens ribosomal protein L13a
           protein.
          Length = 203

 Score =  158 bits (383), Expect = 2e-38
 Identities = 79/160 (49%), Positives = 99/160 (61%)
 Frame = +3

Query: 15  KAIVIDGRGHLLGRLAAVIAKVLLEGNKVVVVRCEQINISGNFFRNKLKLMSFLRKRCNV 194
           + +V+DGRGHLLGRLAA++AK +L G KVVVVRCE INISGNF+RNKLK ++FLRKR N 
Sbjct: 5   QVLVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNT 64

Query: 195 NPARGPFHFRAPSKILWKTVEA*SHTKQSVARMLLGGYVHMMGALLPLITXXXXXXXXXX 374
           NP+RGP+HFRAPS+I W+TV      K    +  L       G   P             
Sbjct: 65  NPSRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAAL 124

Query: 375 XXXXXXXXXXXCHVGRLSHEIGWKYRDVVRKLEDKRKGKA 494
                       ++GRL+HE+GWKY+ V   LE+KRK KA
Sbjct: 125 KVVRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKA 164



 Score = 53.6 bits (123), Expect = 6e-07
 Identities = 24/50 (48%), Positives = 30/50 (60%)
 Frame = +2

Query: 254 RGMIPHKTERGKNALRRLRTYDGCPPPFDNXXXXXXXXXXXXFCLKPGRK 403
           RGM+PHKT+RG+ AL RL+ +DG PPP+D               LKP RK
Sbjct: 85  RGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKVVRLKPTRK 134


>BC065236-1|AAH65236.1|  203|Homo sapiens ribosomal protein L13a
           protein.
          Length = 203

 Score =  158 bits (383), Expect = 2e-38
 Identities = 79/160 (49%), Positives = 99/160 (61%)
 Frame = +3

Query: 15  KAIVIDGRGHLLGRLAAVIAKVLLEGNKVVVVRCEQINISGNFFRNKLKLMSFLRKRCNV 194
           + +V+DGRGHLLGRLAA++AK +L G KVVVVRCE INISGNF+RNKLK ++FLRKR N 
Sbjct: 5   QVLVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNT 64

Query: 195 NPARGPFHFRAPSKILWKTVEA*SHTKQSVARMLLGGYVHMMGALLPLITXXXXXXXXXX 374
           NP+RGP+HFRAPS+I W+TV      K    +  L       G   P             
Sbjct: 65  NPSRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAAL 124

Query: 375 XXXXXXXXXXXCHVGRLSHEIGWKYRDVVRKLEDKRKGKA 494
                       ++GRL+HE+GWKY+ V   LE+KRK KA
Sbjct: 125 KVVRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKA 164



 Score = 53.6 bits (123), Expect = 6e-07
 Identities = 24/50 (48%), Positives = 30/50 (60%)
 Frame = +2

Query: 254 RGMIPHKTERGKNALRRLRTYDGCPPPFDNXXXXXXXXXXXXFCLKPGRK 403
           RGM+PHKT+RG+ AL RL+ +DG PPP+D               LKP RK
Sbjct: 85  RGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKVVRLKPTRK 134


>BC062537-1|AAH62537.1|  203|Homo sapiens ribosomal protein L13a
           protein.
          Length = 203

 Score =  158 bits (383), Expect = 2e-38
 Identities = 79/160 (49%), Positives = 99/160 (61%)
 Frame = +3

Query: 15  KAIVIDGRGHLLGRLAAVIAKVLLEGNKVVVVRCEQINISGNFFRNKLKLMSFLRKRCNV 194
           + +V+DGRGHLLGRLAA++AK +L G KVVVVRCE INISGNF+RNKLK ++FLRKR N 
Sbjct: 5   QVLVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNT 64

Query: 195 NPARGPFHFRAPSKILWKTVEA*SHTKQSVARMLLGGYVHMMGALLPLITXXXXXXXXXX 374
           NP+RGP+HFRAPS+I W+TV      K    +  L       G   P             
Sbjct: 65  NPSRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAAL 124

Query: 375 XXXXXXXXXXXCHVGRLSHEIGWKYRDVVRKLEDKRKGKA 494
                       ++GRL+HE+GWKY+ V   LE+KRK KA
Sbjct: 125 KVVRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKA 164



 Score = 53.6 bits (123), Expect = 6e-07
 Identities = 24/50 (48%), Positives = 30/50 (60%)
 Frame = +2

Query: 254 RGMIPHKTERGKNALRRLRTYDGCPPPFDNXXXXXXXXXXXXFCLKPGRK 403
           RGM+PHKT+RG+ AL RL+ +DG PPP+D               LKP RK
Sbjct: 85  RGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKVVRLKPTRK 134


>BC004900-1|AAH04900.2|  201|Homo sapiens RPL13A protein protein.
          Length = 201

 Score =  158 bits (383), Expect = 2e-38
 Identities = 79/160 (49%), Positives = 99/160 (61%)
 Frame = +3

Query: 15  KAIVIDGRGHLLGRLAAVIAKVLLEGNKVVVVRCEQINISGNFFRNKLKLMSFLRKRCNV 194
           + +V+DGRGHLLGRLAA++AK +L G KVVVVRCE INISGNF+RNKLK ++FLRKR N 
Sbjct: 3   QVLVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNT 62

Query: 195 NPARGPFHFRAPSKILWKTVEA*SHTKQSVARMLLGGYVHMMGALLPLITXXXXXXXXXX 374
           NP+RGP+HFRAPS+I W+TV      K    +  L       G   P             
Sbjct: 63  NPSRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAAL 122

Query: 375 XXXXXXXXXXXCHVGRLSHEIGWKYRDVVRKLEDKRKGKA 494
                       ++GRL+HE+GWKY+ V   LE+KRK KA
Sbjct: 123 KVVRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKA 162



 Score = 53.6 bits (123), Expect = 6e-07
 Identities = 24/50 (48%), Positives = 30/50 (60%)
 Frame = +2

Query: 254 RGMIPHKTERGKNALRRLRTYDGCPPPFDNXXXXXXXXXXXXFCLKPGRK 403
           RGM+PHKT+RG+ AL RL+ +DG PPP+D               LKP RK
Sbjct: 83  RGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKVVRLKPTRK 132


>BC001836-1|AAH01836.1|  203|Homo sapiens ribosomal protein L13a
           protein.
          Length = 203

 Score =  158 bits (383), Expect = 2e-38
 Identities = 79/160 (49%), Positives = 99/160 (61%)
 Frame = +3

Query: 15  KAIVIDGRGHLLGRLAAVIAKVLLEGNKVVVVRCEQINISGNFFRNKLKLMSFLRKRCNV 194
           + +V+DGRGHLLGRLAA++AK +L G KVVVVRCE INISGNF+RNKLK ++FLRKR N 
Sbjct: 5   QVLVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNT 64

Query: 195 NPARGPFHFRAPSKILWKTVEA*SHTKQSVARMLLGGYVHMMGALLPLITXXXXXXXXXX 374
           NP+RGP+HFRAPS+I W+TV      K    +  L       G   P             
Sbjct: 65  NPSRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAAL 124

Query: 375 XXXXXXXXXXXCHVGRLSHEIGWKYRDVVRKLEDKRKGKA 494
                       ++GRL+HE+GWKY+ V   LE+KRK KA
Sbjct: 125 KVVRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKA 164



 Score = 53.6 bits (123), Expect = 6e-07
 Identities = 24/50 (48%), Positives = 30/50 (60%)
 Frame = +2

Query: 254 RGMIPHKTERGKNALRRLRTYDGCPPPFDNXXXXXXXXXXXXFCLKPGRK 403
           RGM+PHKT+RG+ AL RL+ +DG PPP+D               LKP RK
Sbjct: 85  RGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKVVRLKPTRK 134


>BC001675-1|AAH01675.1|  203|Homo sapiens ribosomal protein L13a
           protein.
          Length = 203

 Score =  158 bits (383), Expect = 2e-38
 Identities = 79/160 (49%), Positives = 99/160 (61%)
 Frame = +3

Query: 15  KAIVIDGRGHLLGRLAAVIAKVLLEGNKVVVVRCEQINISGNFFRNKLKLMSFLRKRCNV 194
           + +V+DGRGHLLGRLAA++AK +L G KVVVVRCE INISGNF+RNKLK ++FLRKR N 
Sbjct: 5   QVLVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNT 64

Query: 195 NPARGPFHFRAPSKILWKTVEA*SHTKQSVARMLLGGYVHMMGALLPLITXXXXXXXXXX 374
           NP+RGP+HFRAPS+I W+TV      K    +  L       G   P             
Sbjct: 65  NPSRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAAL 124

Query: 375 XXXXXXXXXXXCHVGRLSHEIGWKYRDVVRKLEDKRKGKA 494
                       ++GRL+HE+GWKY+ V   LE+KRK KA
Sbjct: 125 KVVRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKA 164



 Score = 53.6 bits (123), Expect = 6e-07
 Identities = 24/50 (48%), Positives = 30/50 (60%)
 Frame = +2

Query: 254 RGMIPHKTERGKNALRRLRTYDGCPPPFDNXXXXXXXXXXXXFCLKPGRK 403
           RGM+PHKT+RG+ AL RL+ +DG PPP+D               LKP RK
Sbjct: 85  RGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKVVRLKPTRK 134


>BC000514-1|AAH00514.1|  203|Homo sapiens ribosomal protein L13a
           protein.
          Length = 203

 Score =  158 bits (383), Expect = 2e-38
 Identities = 79/160 (49%), Positives = 99/160 (61%)
 Frame = +3

Query: 15  KAIVIDGRGHLLGRLAAVIAKVLLEGNKVVVVRCEQINISGNFFRNKLKLMSFLRKRCNV 194
           + +V+DGRGHLLGRLAA++AK +L G KVVVVRCE INISGNF+RNKLK ++FLRKR N 
Sbjct: 5   QVLVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNT 64

Query: 195 NPARGPFHFRAPSKILWKTVEA*SHTKQSVARMLLGGYVHMMGALLPLITXXXXXXXXXX 374
           NP+RGP+HFRAPS+I W+TV      K    +  L       G   P             
Sbjct: 65  NPSRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAAL 124

Query: 375 XXXXXXXXXXXCHVGRLSHEIGWKYRDVVRKLEDKRKGKA 494
                       ++GRL+HE+GWKY+ V   LE+KRK KA
Sbjct: 125 KVVRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKA 164



 Score = 53.6 bits (123), Expect = 6e-07
 Identities = 24/50 (48%), Positives = 30/50 (60%)
 Frame = +2

Query: 254 RGMIPHKTERGKNALRRLRTYDGCPPPFDNXXXXXXXXXXXXFCLKPGRK 403
           RGM+PHKT+RG+ AL RL+ +DG PPP+D               LKP RK
Sbjct: 85  RGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKVVRLKPTRK 134


>AK222747-1|BAD96467.1|  203|Homo sapiens ribosomal protein L13a
           variant protein.
          Length = 203

 Score =  158 bits (383), Expect = 2e-38
 Identities = 79/160 (49%), Positives = 99/160 (61%)
 Frame = +3

Query: 15  KAIVIDGRGHLLGRLAAVIAKVLLEGNKVVVVRCEQINISGNFFRNKLKLMSFLRKRCNV 194
           + +V+DGRGHLLGRLAA++AK +L G KVVVVRCE INISGNF+RNKLK ++FLRKR N 
Sbjct: 5   QVLVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNT 64

Query: 195 NPARGPFHFRAPSKILWKTVEA*SHTKQSVARMLLGGYVHMMGALLPLITXXXXXXXXXX 374
           NP+RGP+HFRAPS+I W+TV      K    +  L       G   P             
Sbjct: 65  NPSRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALDHLKVFDGIPPPYDKKKRMVVPAAL 124

Query: 375 XXXXXXXXXXXCHVGRLSHEIGWKYRDVVRKLEDKRKGKA 494
                       ++GRL+HE+GWKY+ V   LE+KRK KA
Sbjct: 125 KVVRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKA 164



 Score = 51.6 bits (118), Expect = 2e-06
 Identities = 23/50 (46%), Positives = 29/50 (58%)
 Frame = +2

Query: 254 RGMIPHKTERGKNALRRLRTYDGCPPPFDNXXXXXXXXXXXXFCLKPGRK 403
           RGM+PHKT+RG+ AL  L+ +DG PPP+D               LKP RK
Sbjct: 85  RGMLPHKTKRGQAALDHLKVFDGIPPPYDKKKRMVVPAALKVVRLKPTRK 134


>AB028893-1|BAA88214.1|  203|Homo sapiens ribosomal protein L13a
           protein.
          Length = 203

 Score =  158 bits (383), Expect = 2e-38
 Identities = 79/160 (49%), Positives = 99/160 (61%)
 Frame = +3

Query: 15  KAIVIDGRGHLLGRLAAVIAKVLLEGNKVVVVRCEQINISGNFFRNKLKLMSFLRKRCNV 194
           + +V+DGRGHLLGRLAA++AK +L G KVVVVRCE INISGNF+RNKLK ++FLRKR N 
Sbjct: 5   QVLVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNT 64

Query: 195 NPARGPFHFRAPSKILWKTVEA*SHTKQSVARMLLGGYVHMMGALLPLITXXXXXXXXXX 374
           NP+RGP+HFRAPS+I W+TV      K    +  L       G   P             
Sbjct: 65  NPSRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAAL 124

Query: 375 XXXXXXXXXXXCHVGRLSHEIGWKYRDVVRKLEDKRKGKA 494
                       ++GRL+HE+GWKY+ V   LE+KRK KA
Sbjct: 125 KVVRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKA 164



 Score = 53.6 bits (123), Expect = 6e-07
 Identities = 24/50 (48%), Positives = 30/50 (60%)
 Frame = +2

Query: 254 RGMIPHKTERGKNALRRLRTYDGCPPPFDNXXXXXXXXXXXXFCLKPGRK 403
           RGM+PHKT+RG+ AL RL+ +DG PPP+D               LKP RK
Sbjct: 85  RGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKVVRLKPTRK 134


>AL356120-1|CAH73036.1|  203|Homo sapiens protein ( Human DNA
           sequence from clone RP11-365K22 on chromosome 13
           Contains a novel gene similar to ribosomal protein L13a
           (RPL13A).  ).
          Length = 203

 Score =  150 bits (363), Expect = 5e-36
 Identities = 75/160 (46%), Positives = 97/160 (60%)
 Frame = +3

Query: 15  KAIVIDGRGHLLGRLAAVIAKVLLEGNKVVVVRCEQINISGNFFRNKLKLMSFLRKRCNV 194
           + +V+DGRGHLLGRLAA++AK +L G KVVVV CE INISGNF+RNKL  ++FLRKR N 
Sbjct: 5   QVLVLDGRGHLLGRLAAIVAKQVLLGRKVVVVCCEGINISGNFYRNKLNYLAFLRKRMNT 64

Query: 195 NPARGPFHFRAPSKILWKTVEA*SHTKQSVARMLLGGYVHMMGALLPLITXXXXXXXXXX 374
           +P+RGP+HFRAPS++ W+TV      K    +  L       G   P             
Sbjct: 65  SPSRGPYHFRAPSRVFWRTVRGMLPHKTKRGQAALDRLKVSDGIPPPYDKKKRMVVPAAL 124

Query: 375 XXXXXXXXXXXCHVGRLSHEIGWKYRDVVRKLEDKRKGKA 494
                       ++GRL+HE+GWKY+ V   LE+KRK KA
Sbjct: 125 KVVRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKA 164



 Score = 51.6 bits (118), Expect = 2e-06
 Identities = 24/50 (48%), Positives = 29/50 (58%)
 Frame = +2

Query: 254 RGMIPHKTERGKNALRRLRTYDGCPPPFDNXXXXXXXXXXXXFCLKPGRK 403
           RGM+PHKT+RG+ AL RL+  DG PPP+D               LKP RK
Sbjct: 85  RGMLPHKTKRGQAALDRLKVSDGIPPPYDKKKRMVVPAALKVVRLKPTRK 134


>BC105605-1|AAI05606.1|  142|Homo sapiens RPL13A protein protein.
          Length = 142

 Score = 71.3 bits (167), Expect = 3e-12
 Identities = 38/102 (37%), Positives = 48/102 (47%)
 Frame = +3

Query: 189 NVNPARGPFHFRAPSKILWKTVEA*SHTKQSVARMLLGGYVHMMGALLPLITXXXXXXXX 368
           N NP+RGP+HFRAPS+I W+TV      K    +  L       G   P           
Sbjct: 2   NTNPSRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPA 61

Query: 369 XXXXXXXXXXXXXCHVGRLSHEIGWKYRDVVRKLEDKRKGKA 494
                         ++GRL+HE+GWKY+ V   LEDKRK KA
Sbjct: 62  ALKVVRLKPTRKFAYLGRLAHEVGWKYQAVTATLEDKRKEKA 103



 Score = 53.6 bits (123), Expect = 6e-07
 Identities = 24/50 (48%), Positives = 30/50 (60%)
 Frame = +2

Query: 254 RGMIPHKTERGKNALRRLRTYDGCPPPFDNXXXXXXXXXXXXFCLKPGRK 403
           RGM+PHKT+RG+ AL RL+ +DG PPP+D               LKP RK
Sbjct: 24  RGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKVVRLKPTRK 73


>AB082924-1|BAC16800.1|  142|Homo sapiens ribosomal protein L13a
           protein.
          Length = 142

 Score = 69.7 bits (163), Expect = 8e-12
 Identities = 37/102 (36%), Positives = 48/102 (47%)
 Frame = +3

Query: 189 NVNPARGPFHFRAPSKILWKTVEA*SHTKQSVARMLLGGYVHMMGALLPLITXXXXXXXX 368
           N NP+RGP+HFRAPS+I W+TV      K    +  L       G   P           
Sbjct: 2   NTNPSRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPA 61

Query: 369 XXXXXXXXXXXXXCHVGRLSHEIGWKYRDVVRKLEDKRKGKA 494
                         ++GRL+HE+GWKY+ V   LE+KRK KA
Sbjct: 62  ALKVVRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKA 103



 Score = 53.6 bits (123), Expect = 6e-07
 Identities = 24/50 (48%), Positives = 30/50 (60%)
 Frame = +2

Query: 254 RGMIPHKTERGKNALRRLRTYDGCPPPFDNXXXXXXXXXXXXFCLKPGRK 403
           RGM+PHKT+RG+ AL RL+ +DG PPP+D               LKP RK
Sbjct: 24  RGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKVVRLKPTRK 73


>BC067891-1|AAH67891.1|  102|Homo sapiens Unknown (protein for
           MGC:87657) protein.
          Length = 102

 Score = 41.1 bits (92), Expect = 0.003
 Identities = 23/61 (37%), Positives = 29/61 (47%), Gaps = 1/61 (1%)
 Frame = +2

Query: 260 MIPHKTERGKNALRRLRTYDGCPPPFDNXXXXXXXXXXXXFCLKPGRKL-LSCRQTVP*N 436
           M+ HKT+RG  +L  L+ +DG PPP+D               LKP RK  L  RQ     
Sbjct: 1   MLRHKTKRGHASLDCLKVFDGIPPPYDKKKRMVVPAALKVVRLKPTRKFALLGRQAQEVR 60

Query: 437 W 439
           W
Sbjct: 61  W 61



 Score = 33.9 bits (74), Expect = 0.52
 Identities = 14/27 (51%), Positives = 19/27 (70%)
 Frame = +3

Query: 414 VGRLSHEIGWKYRDVVRKLEDKRKGKA 494
           +GR + E+ WKY+ V   LE+KRK KA
Sbjct: 52  LGRQAQEVRWKYQAVTATLEEKRKEKA 78


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 102,174,673
Number of Sequences: 237096
Number of extensions: 2237339
Number of successful extensions: 8210
Number of sequences better than 10.0: 15
Number of HSP's better than 10.0 without gapping: 8059
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 8210
length of database: 76,859,062
effective HSP length: 87
effective length of database: 56,231,710
effective search space used: 7422585720
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).