SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30014
         (611 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Y00371-1|CAA68445.1|  646|Homo sapiens 71 Kd heat shock cognate ...   153   5e-37
BC019816-1|AAH19816.1|  646|Homo sapiens heat shock 70kDa protei...   153   5e-37
BC016660-1|AAH16660.1|  646|Homo sapiens heat shock 70kDa protei...   153   5e-37
BC016179-1|AAH16179.1|  646|Homo sapiens heat shock 70kDa protei...   153   5e-37
BC015699-1|AAH15699.1|  269|Homo sapiens Unknown (protein for IM...   153   5e-37
BC008907-1|AAH08907.2|  219|Homo sapiens HSPA8 protein protein.       153   5e-37
BC007276-1|AAH07276.2|  587|Homo sapiens HSPA8 protein protein.       153   5e-37
AK222785-1|BAD96505.1|  646|Homo sapiens heat shock 70kDa protei...   153   5e-37
AF352832-1|AAK17898.1|  646|Homo sapiens constitutive heat shock...   153   5e-37
AB209818-1|BAD93055.1|  709|Homo sapiens heat shock 70kDa protei...   141   2e-33
M59830-1|AAA63227.1|  641|Homo sapiens heat shock-induced protei...   140   3e-33
M59828-1|AAA63226.1|  641|Homo sapiens heat shock-induced protei...   140   3e-33
DQ451402-1|ABD96830.1|  641|Homo sapiens heat shock 70kDa protei...   140   3e-33
DQ388429-1|ABD48956.1|  641|Homo sapiens heat shock 70kDa protei...   140   3e-33
BC063507-1|AAH63507.1|  641|Homo sapiens heat shock 70kDa protei...   140   3e-33
BC057397-1|AAH57397.1|  641|Homo sapiens heat shock 70kDa protei...   140   3e-33
BC018740-1|AAH18740.1|  641|Homo sapiens HSPA1A protein protein.      140   3e-33
BC009322-1|AAH09322.1|  641|Homo sapiens HSPA1A protein protein.      140   3e-33
BC002453-1|AAH02453.1|  641|Homo sapiens heat shock 70kDa protei...   140   3e-33
BA000025-9|BAB63300.1|  641|Homo sapiens heat shock protein prot...   140   3e-33
BA000025-8|BAB63299.1|  641|Homo sapiens heat shock protein prot...   140   3e-33
AL929592-7|CAI18466.1|  641|Homo sapiens heat shock 70kDa protei...   140   3e-33
AL929592-6|CAI18465.1|  476|Homo sapiens heat shock 70kDa protei...   140   3e-33
AL929592-5|CAI18464.1|  641|Homo sapiens heat shock 70kDa protei...   140   3e-33
AL671762-7|CAI18217.1|  641|Homo sapiens heat shock 70kDa protei...   140   3e-33
AL671762-6|CAI18216.1|  641|Homo sapiens heat shock 70kDa protei...   140   3e-33
AL671762-5|CAM25532.1|  476|Homo sapiens heat shock 70kDa protei...   140   3e-33
AL662834-18|CAI17738.1|  641|Homo sapiens heat shock 70kDa prote...   140   3e-33
AL662834-17|CAI17737.1|  641|Homo sapiens heat shock 70kDa prote...   140   3e-33
AL662834-16|CAM24989.1|  476|Homo sapiens heat shock 70kDa prote...   140   3e-33
AF134726-7|AAD21816.1|  641|Homo sapiens HSP70-1 protein.             140   3e-33
D85730-1|BAA32521.1|  641|Homo sapiens Heat shock protein 70 tes...   139   6e-33
DQ383515-1|ABC88476.1|  641|Homo sapiens heat shock 70kDa protei...   139   6e-33
BC034483-1|AAH34483.1|  641|Homo sapiens heat shock 70kDa protei...   139   6e-33
BA000025-10|BAB63301.1|  641|Homo sapiens heat shock protein pro...   139   6e-33
AL929592-4|CAI18463.1|  641|Homo sapiens heat shock 70kDa protei...   139   6e-33
AL662834-15|CAI17736.1|  641|Homo sapiens heat shock 70kDa prote...   139   6e-33
AK223386-1|BAD97106.1|  641|Homo sapiens heat shock 70kDa protei...   139   6e-33
AF134726-8|AAD21817.1|  641|Homo sapiens HSP70-HOM protein.           139   6e-33
M59829-1|AAA63228.1|  641|Homo sapiens heat shock-induced protei...   138   1e-32
AL671762-4|CAI18215.1|  641|Homo sapiens heat shock 70kDa protei...   138   1e-32
AF134726-6|AAD21815.1|  641|Homo sapiens HSP70-2 protein.             138   1e-32
U56725-1|AAD11466.1|  639|Homo sapiens heat shock protein protein.    135   1e-31
L26336-1|AAA52698.1|  639|Homo sapiens heat shock protein protein.    135   1e-31
DQ489378-1|ABE96830.1|  639|Homo sapiens heat shock 70kDa protei...   135   1e-31
BT009815-1|AAP88817.1|  639|Homo sapiens heat shock 70kDa protei...   135   1e-31
BC036107-1|AAH36107.1|  639|Homo sapiens HSPA2 protein protein.       135   1e-31
BC001752-1|AAH01752.1|  639|Homo sapiens heat shock 70kDa protei...   135   1e-31
M11717-1|AAA52697.1|  640|Homo sapiens heat shock protein protein.    134   2e-31
AK223362-1|BAD97082.1|  643|Homo sapiens heat shock 70kDa protei...   132   1e-30
X51758-1|CAA36062.1|  289|Homo sapiens heat shock protein 70B' (...   130   3e-30
X51757-1|CAA36061.1|  643|Homo sapiens protein ( Human heat-shoc...   130   3e-30
DQ521571-1|ABF47108.1|  643|Homo sapiens heat shock 70kDa protei...   130   3e-30
BC035665-1|AAH35665.1|  643|Homo sapiens heat shock 70kDa protei...   130   3e-30
AL590385-3|CAI16120.1|  643|Homo sapiens heat shock 70kDa protei...   130   3e-30
X87949-1|CAA61201.1|  653|Homo sapiens BiP protein.                   109   1e-23
M19645-1|AAA52614.1|  653|Homo sapiens protein ( Human 78 kdalto...   109   1e-23
DQ385847-1|ABD04090.1|  654|Homo sapiens heat shock 70kDa protei...   109   1e-23
BC112963-1|AAI12964.1|  655|Homo sapiens HSPA5 protein protein.       109   1e-23
BC020235-1|AAH20235.1|  654|Homo sapiens heat shock 70kDa protei...   109   1e-23
AJ271729-1|CAB71335.1|  654|Homo sapiens glucose-regulated prote...   109   1e-23
AF216292-1|AAF42836.1|  654|Homo sapiens endoplasmic reticulum l...   109   1e-23
AF188611-1|AAF13605.1|  639|Homo sapiens BiP protein protein.         109   1e-23
L15189-1|AAA67526.1|  679|Homo sapiens MTHSP75 protein.                95   2e-19
DQ531046-1|ABF50973.1|  679|Homo sapiens heat shock 70kDa protei...    95   2e-19
DQ480334-1|ABF19573.1|  350|Homo sapiens catecholamine-regulated...    95   2e-19
BC030634-1|AAH30634.1|  681|Homo sapiens HSPA9 protein protein.        95   2e-19
BC024034-1|AAH24034.1|  679|Homo sapiens heat shock 70kDa protei...    95   2e-19
BC000478-1|AAH00478.1|  679|Homo sapiens heat shock 70kDa protei...    95   2e-19
AK222758-1|BAD96478.1|  679|Homo sapiens heat shock 70kDa protei...    95   2e-19
AK222628-1|BAD96348.1|  493|Homo sapiens heat shock 70kDa protei...    77   7e-14
AB034951-1|BAB18615.1|  493|Homo sapiens heat shock cognate prot...    77   7e-14
BC004279-1|AAH04279.1|  145|Homo sapiens Similar to heat shock 7...    56   1e-07
BC014608-1|AAH14608.1|  361|Homo sapiens spermatogenesis associa...    31   4.2  
AY963797-1|AAY33662.1|  361|Homo sapiens spermatogenesis-related...    31   4.2  
AL445428-2|CAH70554.1|  361|Homo sapiens novel protein (FLJ25725...    31   4.2  
AL354659-3|CAH70665.1|  361|Homo sapiens novel protein (FLJ25725...    31   4.2  
AK098591-1|BAC05343.1|  361|Homo sapiens protein ( Homo sapiens ...    31   4.2  
M18112-1|AAA60137.1| 1014|Homo sapiens PPOL protein.                   29   9.8  
AL731535-1|CAI15257.1|  279|Homo sapiens family with sequence si...    29   9.8  
AL645998-3|CAI16355.1|  279|Homo sapiens family with sequence si...    29   9.8  

>Y00371-1|CAA68445.1|  646|Homo sapiens 71 Kd heat shock cognate
           protein protein.
          Length = 646

 Score =  153 bits (371), Expect = 5e-37
 Identities = 80/142 (56%), Positives = 99/142 (69%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGVLIQV+EGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA
Sbjct: 431 YSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 490

Query: 227 IEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQECIGILLASA* 406
           ++KST KEN+  +   K    ++     +      +    +Q++ +  +  +     +  
Sbjct: 491 VDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNM- 549

Query: 407 SATMEDEKLKEKILLNSDKQTI 472
            AT+EDEKL+ KI  + DKQ I
Sbjct: 550 KATVEDEKLQGKI-NDEDKQKI 570


>BC019816-1|AAH19816.1|  646|Homo sapiens heat shock 70kDa protein 8
           protein.
          Length = 646

 Score =  153 bits (371), Expect = 5e-37
 Identities = 80/142 (56%), Positives = 99/142 (69%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGVLIQV+EGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA
Sbjct: 431 YSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 490

Query: 227 IEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQECIGILLASA* 406
           ++KST KEN+  +   K    ++     +      +    +Q++ +  +  +     +  
Sbjct: 491 VDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNM- 549

Query: 407 SATMEDEKLKEKILLNSDKQTI 472
            AT+EDEKL+ KI  + DKQ I
Sbjct: 550 KATVEDEKLQGKI-NDEDKQKI 570


>BC016660-1|AAH16660.1|  646|Homo sapiens heat shock 70kDa protein 8
           protein.
          Length = 646

 Score =  153 bits (371), Expect = 5e-37
 Identities = 80/142 (56%), Positives = 99/142 (69%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGVLIQV+EGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA
Sbjct: 431 YSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 490

Query: 227 IEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQECIGILLASA* 406
           ++KST KEN+  +   K    ++     +      +    +Q++ +  +  +     +  
Sbjct: 491 VDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNM- 549

Query: 407 SATMEDEKLKEKILLNSDKQTI 472
            AT+EDEKL+ KI  + DKQ I
Sbjct: 550 KATVEDEKLQGKI-NDEDKQKI 570


>BC016179-1|AAH16179.1|  646|Homo sapiens heat shock 70kDa protein 8
           protein.
          Length = 646

 Score =  153 bits (371), Expect = 5e-37
 Identities = 80/142 (56%), Positives = 99/142 (69%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGVLIQV+EGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA
Sbjct: 431 YSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 490

Query: 227 IEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQECIGILLASA* 406
           ++KST KEN+  +   K    ++     +      +    +Q++ +  +  +     +  
Sbjct: 491 VDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNM- 549

Query: 407 SATMEDEKLKEKILLNSDKQTI 472
            AT+EDEKL+ KI  + DKQ I
Sbjct: 550 KATVEDEKLQGKI-NDEDKQKI 570


>BC015699-1|AAH15699.1|  269|Homo sapiens Unknown (protein for
           IMAGE:3906958) protein.
          Length = 269

 Score =  153 bits (371), Expect = 5e-37
 Identities = 80/142 (56%), Positives = 99/142 (69%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGVLIQV+EGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA
Sbjct: 54  YSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 113

Query: 227 IEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQECIGILLASA* 406
           ++KST KEN+  +   K    ++     +      +    +Q++ +  +  +     +  
Sbjct: 114 VDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNM- 172

Query: 407 SATMEDEKLKEKILLNSDKQTI 472
            AT+EDEKL+ KI  + DKQ I
Sbjct: 173 KATVEDEKLQGKI-NDEDKQKI 193


>BC008907-1|AAH08907.2|  219|Homo sapiens HSPA8 protein protein.
          Length = 219

 Score =  153 bits (371), Expect = 5e-37
 Identities = 80/142 (56%), Positives = 99/142 (69%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGVLIQV+EGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA
Sbjct: 4   YSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 63

Query: 227 IEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQECIGILLASA* 406
           ++KST KEN+  +   K    ++     +      +    +Q++ +  +  +     +  
Sbjct: 64  VDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNM- 122

Query: 407 SATMEDEKLKEKILLNSDKQTI 472
            AT+EDEKL+ KI  + DKQ I
Sbjct: 123 KATVEDEKLQGKI-NDEDKQKI 143


>BC007276-1|AAH07276.2|  587|Homo sapiens HSPA8 protein protein.
          Length = 587

 Score =  153 bits (371), Expect = 5e-37
 Identities = 80/142 (56%), Positives = 99/142 (69%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGVLIQV+EGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA
Sbjct: 372 YSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 431

Query: 227 IEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQECIGILLASA* 406
           ++KST KEN+  +   K    ++     +      +    +Q++ +  +  +     +  
Sbjct: 432 VDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNM- 490

Query: 407 SATMEDEKLKEKILLNSDKQTI 472
            AT+EDEKL+ KI  + DKQ I
Sbjct: 491 KATVEDEKLQGKI-NDEDKQKI 511


>AK222785-1|BAD96505.1|  646|Homo sapiens heat shock 70kDa protein 8
           isoform 1 variant protein.
          Length = 646

 Score =  153 bits (371), Expect = 5e-37
 Identities = 80/142 (56%), Positives = 99/142 (69%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGVLIQV+EGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA
Sbjct: 431 YSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 490

Query: 227 IEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQECIGILLASA* 406
           ++KST KEN+  +   K    ++     +      +    +Q++ +  +  +     +  
Sbjct: 491 VDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNM- 549

Query: 407 SATMEDEKLKEKILLNSDKQTI 472
            AT+EDEKL+ KI  + DKQ I
Sbjct: 550 KATVEDEKLQGKI-NDEDKQKI 570


>AF352832-1|AAK17898.1|  646|Homo sapiens constitutive heat shock
           protein 70 protein.
          Length = 646

 Score =  153 bits (371), Expect = 5e-37
 Identities = 80/142 (56%), Positives = 99/142 (69%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGVLIQV+EGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA
Sbjct: 431 YSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 490

Query: 227 IEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQECIGILLASA* 406
           ++KST KEN+  +   K    ++     +      +    +Q++ +  +  +     +  
Sbjct: 491 VDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNM- 549

Query: 407 SATMEDEKLKEKILLNSDKQTI 472
            AT+EDEKL+ KI  + DKQ I
Sbjct: 550 KATVEDEKLQGKI-NDEDKQKI 570


>AB209818-1|BAD93055.1|  709|Homo sapiens heat shock 70kDa protein
           1A variant protein.
          Length = 709

 Score =  141 bits (341), Expect = 2e-33
 Identities = 75/142 (52%), Positives = 95/142 (66%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGVLIQV+EGERAMTKDNNLLG+FEL+GIPPAPRGVPQIEVTFDIDANGILNV+A
Sbjct: 499 YSDNQPGVLIQVYEGERAMTKDNNLLGRFELSGIPPAPRGVPQIEVTFDIDANGILNVTA 558

Query: 227 IEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQECIGILLASA* 406
            +KST K N+  +   K    ++     +      +     Q+E +  +  +     +  
Sbjct: 559 TDKSTGKANKITITNDKGRLSKEEIESMVQEAEKYKAEDEVQRERVSAKNALESYAFNMK 618

Query: 407 SATMEDEKLKEKILLNSDKQTI 472
           SA +EDE LK KI   +DK+ +
Sbjct: 619 SA-VEDEGLKGKI-SEADKKKV 638


>M59830-1|AAA63227.1|  641|Homo sapiens heat shock-induced protein
           protein.
          Length = 641

 Score =  140 bits (340), Expect = 3e-33
 Identities = 75/142 (52%), Positives = 95/142 (66%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGVLIQV+EGERAMTKDNNLLG+FEL+GIPPAPRGVPQIEVTFDIDANGILNV+A
Sbjct: 431 YSDNQPGVLIQVYEGERAMTKDNNLLGRFELSGIPPAPRGVPQIEVTFDIDANGILNVTA 490

Query: 227 IEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQECIGILLASA* 406
            +KST K N+  +   K    ++     +      +     Q+E +  +  +     +  
Sbjct: 491 TDKSTGKANKITITNDKGRLSKEEIERMVQEAEKYKAEDEVQRERVSAKNALESYAFNMK 550

Query: 407 SATMEDEKLKEKILLNSDKQTI 472
           SA +EDE LK KI   +DK+ +
Sbjct: 551 SA-VEDEGLKGKI-SEADKKKV 570


>M59828-1|AAA63226.1|  641|Homo sapiens heat shock-induced protein
           protein.
          Length = 641

 Score =  140 bits (340), Expect = 3e-33
 Identities = 75/142 (52%), Positives = 95/142 (66%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGVLIQV+EGERAMTKDNNLLG+FEL+GIPPAPRGVPQIEVTFDIDANGILNV+A
Sbjct: 431 YSDNQPGVLIQVYEGERAMTKDNNLLGRFELSGIPPAPRGVPQIEVTFDIDANGILNVTA 490

Query: 227 IEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQECIGILLASA* 406
            +KST K N+  +   K    ++     +      +     Q+E +  +  +     +  
Sbjct: 491 TDKSTGKANKITITNDKGRLSKEEIERMVQEAEKYKAEDEVQRERVSAKNALESYAFNMK 550

Query: 407 SATMEDEKLKEKILLNSDKQTI 472
           SA +EDE LK KI   +DK+ +
Sbjct: 551 SA-VEDEGLKGKI-SEADKKKV 570


>DQ451402-1|ABD96830.1|  641|Homo sapiens heat shock 70kDa protein
           1A protein.
          Length = 641

 Score =  140 bits (340), Expect = 3e-33
 Identities = 75/142 (52%), Positives = 95/142 (66%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGVLIQV+EGERAMTKDNNLLG+FEL+GIPPAPRGVPQIEVTFDIDANGILNV+A
Sbjct: 431 YSDNQPGVLIQVYEGERAMTKDNNLLGRFELSGIPPAPRGVPQIEVTFDIDANGILNVTA 490

Query: 227 IEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQECIGILLASA* 406
            +KST K N+  +   K    ++     +      +     Q+E +  +  +     +  
Sbjct: 491 TDKSTGKANKITITNDKGRLSKEEIERMVQEAEKYKAEDEVQRERVSAKNALESYAFNMK 550

Query: 407 SATMEDEKLKEKILLNSDKQTI 472
           SA +EDE LK KI   +DK+ +
Sbjct: 551 SA-VEDEGLKGKI-SEADKKKV 570


>DQ388429-1|ABD48956.1|  641|Homo sapiens heat shock 70kDa protein
           1B protein.
          Length = 641

 Score =  140 bits (340), Expect = 3e-33
 Identities = 75/142 (52%), Positives = 95/142 (66%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGVLIQV+EGERAMTKDNNLLG+FEL+GIPPAPRGVPQIEVTFDIDANGILNV+A
Sbjct: 431 YSDNQPGVLIQVYEGERAMTKDNNLLGRFELSGIPPAPRGVPQIEVTFDIDANGILNVTA 490

Query: 227 IEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQECIGILLASA* 406
            +KST K N+  +   K    ++     +      +     Q+E +  +  +     +  
Sbjct: 491 TDKSTGKANKITITNDKGRLSKEEIERMVQEAEKYKAEDEVQRERVSAKNALESYAFNMK 550

Query: 407 SATMEDEKLKEKILLNSDKQTI 472
           SA +EDE LK KI   +DK+ +
Sbjct: 551 SA-VEDEGLKGKI-SEADKKKV 570


>BC063507-1|AAH63507.1|  641|Homo sapiens heat shock 70kDa protein
           1B protein.
          Length = 641

 Score =  140 bits (340), Expect = 3e-33
 Identities = 75/142 (52%), Positives = 95/142 (66%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGVLIQV+EGERAMTKDNNLLG+FEL+GIPPAPRGVPQIEVTFDIDANGILNV+A
Sbjct: 431 YSDNQPGVLIQVYEGERAMTKDNNLLGRFELSGIPPAPRGVPQIEVTFDIDANGILNVTA 490

Query: 227 IEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQECIGILLASA* 406
            +KST K N+  +   K    ++     +      +     Q+E +  +  +     +  
Sbjct: 491 TDKSTGKANKITITNDKGRLSKEEIERMVQEAEKYKAEDEVQRERVSAKNALESYAFNMK 550

Query: 407 SATMEDEKLKEKILLNSDKQTI 472
           SA +EDE LK KI   +DK+ +
Sbjct: 551 SA-VEDEGLKGKI-SEADKKKV 570


>BC057397-1|AAH57397.1|  641|Homo sapiens heat shock 70kDa protein
           1B protein.
          Length = 641

 Score =  140 bits (340), Expect = 3e-33
 Identities = 75/142 (52%), Positives = 95/142 (66%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGVLIQV+EGERAMTKDNNLLG+FEL+GIPPAPRGVPQIEVTFDIDANGILNV+A
Sbjct: 431 YSDNQPGVLIQVYEGERAMTKDNNLLGRFELSGIPPAPRGVPQIEVTFDIDANGILNVTA 490

Query: 227 IEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQECIGILLASA* 406
            +KST K N+  +   K    ++     +      +     Q+E +  +  +     +  
Sbjct: 491 TDKSTGKANKITITNDKGRLSKEEIERMVQEAEKYKAEDEVQRERVSAKNALESYAFNMK 550

Query: 407 SATMEDEKLKEKILLNSDKQTI 472
           SA +EDE LK KI   +DK+ +
Sbjct: 551 SA-VEDEGLKGKI-SEADKKKV 570


>BC018740-1|AAH18740.1|  641|Homo sapiens HSPA1A protein protein.
          Length = 641

 Score =  140 bits (340), Expect = 3e-33
 Identities = 75/142 (52%), Positives = 95/142 (66%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGVLIQV+EGERAMTKDNNLLG+FEL+GIPPAPRGVPQIEVTFDIDANGILNV+A
Sbjct: 431 YSDNQPGVLIQVYEGERAMTKDNNLLGRFELSGIPPAPRGVPQIEVTFDIDANGILNVTA 490

Query: 227 IEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQECIGILLASA* 406
            +KST K N+  +   K    ++     +      +     Q+E +  +  +     +  
Sbjct: 491 TDKSTGKANKITITNDKGRLSKEEIERMVQEAEKYKAEDEVQRERVSAKNALESYAFNMK 550

Query: 407 SATMEDEKLKEKILLNSDKQTI 472
           SA +EDE LK KI   +DK+ +
Sbjct: 551 SA-VEDEGLKGKI-SEADKKKV 570


>BC009322-1|AAH09322.1|  641|Homo sapiens HSPA1A protein protein.
          Length = 641

 Score =  140 bits (340), Expect = 3e-33
 Identities = 75/142 (52%), Positives = 95/142 (66%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGVLIQV+EGERAMTKDNNLLG+FEL+GIPPAPRGVPQIEVTFDIDANGILNV+A
Sbjct: 431 YSDNQPGVLIQVYEGERAMTKDNNLLGRFELSGIPPAPRGVPQIEVTFDIDANGILNVTA 490

Query: 227 IEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQECIGILLASA* 406
            +KST K N+  +   K    ++     +      +     Q+E +  +  +     +  
Sbjct: 491 TDKSTGKANKITITNDKGRLSKEEIERMVQEAEKYKAEDEVQRERVSAKNALESYAFNMK 550

Query: 407 SATMEDEKLKEKILLNSDKQTI 472
           SA +EDE LK KI   +DK+ +
Sbjct: 551 SA-VEDEGLKGKI-SEADKKKV 570


>BC002453-1|AAH02453.1|  641|Homo sapiens heat shock 70kDa protein
           1A protein.
          Length = 641

 Score =  140 bits (340), Expect = 3e-33
 Identities = 75/142 (52%), Positives = 95/142 (66%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGVLIQV+EGERAMTKDNNLLG+FEL+GIPPAPRGVPQIEVTFDIDANGILNV+A
Sbjct: 431 YSDNQPGVLIQVYEGERAMTKDNNLLGRFELSGIPPAPRGVPQIEVTFDIDANGILNVTA 490

Query: 227 IEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQECIGILLASA* 406
            +KST K N+  +   K    ++     +      +     Q+E +  +  +     +  
Sbjct: 491 TDKSTGKANKITITNDKGRLSKEEIERMVQEAEKYKAEDEVQRERVSAKNALESYAFNMK 550

Query: 407 SATMEDEKLKEKILLNSDKQTI 472
           SA +EDE LK KI   +DK+ +
Sbjct: 551 SA-VEDEGLKGKI-SEADKKKV 570


>BA000025-9|BAB63300.1|  641|Homo sapiens heat shock protein
           protein.
          Length = 641

 Score =  140 bits (340), Expect = 3e-33
 Identities = 75/142 (52%), Positives = 95/142 (66%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGVLIQV+EGERAMTKDNNLLG+FEL+GIPPAPRGVPQIEVTFDIDANGILNV+A
Sbjct: 431 YSDNQPGVLIQVYEGERAMTKDNNLLGRFELSGIPPAPRGVPQIEVTFDIDANGILNVTA 490

Query: 227 IEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQECIGILLASA* 406
            +KST K N+  +   K    ++     +      +     Q+E +  +  +     +  
Sbjct: 491 TDKSTGKANKITITNDKGRLSKEEIERMVQEAEKYKAEDEVQRERVSAKNALESYAFNMK 550

Query: 407 SATMEDEKLKEKILLNSDKQTI 472
           SA +EDE LK KI   +DK+ +
Sbjct: 551 SA-VEDEGLKGKI-SEADKKKV 570


>BA000025-8|BAB63299.1|  641|Homo sapiens heat shock protein
           protein.
          Length = 641

 Score =  140 bits (340), Expect = 3e-33
 Identities = 75/142 (52%), Positives = 95/142 (66%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGVLIQV+EGERAMTKDNNLLG+FEL+GIPPAPRGVPQIEVTFDIDANGILNV+A
Sbjct: 431 YSDNQPGVLIQVYEGERAMTKDNNLLGRFELSGIPPAPRGVPQIEVTFDIDANGILNVTA 490

Query: 227 IEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQECIGILLASA* 406
            +KST K N+  +   K    ++     +      +     Q+E +  +  +     +  
Sbjct: 491 TDKSTGKANKITITNDKGRLSKEEIERMVQEAEKYKAEDEVQRERVSAKNALESYAFNMK 550

Query: 407 SATMEDEKLKEKILLNSDKQTI 472
           SA +EDE LK KI   +DK+ +
Sbjct: 551 SA-VEDEGLKGKI-SEADKKKV 570


>AL929592-7|CAI18466.1|  641|Homo sapiens heat shock 70kDa protein
           1B protein.
          Length = 641

 Score =  140 bits (340), Expect = 3e-33
 Identities = 75/142 (52%), Positives = 95/142 (66%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGVLIQV+EGERAMTKDNNLLG+FEL+GIPPAPRGVPQIEVTFDIDANGILNV+A
Sbjct: 431 YSDNQPGVLIQVYEGERAMTKDNNLLGRFELSGIPPAPRGVPQIEVTFDIDANGILNVTA 490

Query: 227 IEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQECIGILLASA* 406
            +KST K N+  +   K    ++     +      +     Q+E +  +  +     +  
Sbjct: 491 TDKSTGKANKITITNDKGRLSKEEIERMVQEAEKYKAEDEVQRERVSAKNALESYAFNMK 550

Query: 407 SATMEDEKLKEKILLNSDKQTI 472
           SA +EDE LK KI   +DK+ +
Sbjct: 551 SA-VEDEGLKGKI-SEADKKKV 570


>AL929592-6|CAI18465.1|  476|Homo sapiens heat shock 70kDa protein
           1A protein.
          Length = 476

 Score =  140 bits (340), Expect = 3e-33
 Identities = 75/142 (52%), Positives = 95/142 (66%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGVLIQV+EGERAMTKDNNLLG+FEL+GIPPAPRGVPQIEVTFDIDANGILNV+A
Sbjct: 266 YSDNQPGVLIQVYEGERAMTKDNNLLGRFELSGIPPAPRGVPQIEVTFDIDANGILNVTA 325

Query: 227 IEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQECIGILLASA* 406
            +KST K N+  +   K    ++     +      +     Q+E +  +  +     +  
Sbjct: 326 TDKSTGKANKITITNDKGRLSKEEIERMVQEAEKYKAEDEVQRERVSAKNALESYAFNMK 385

Query: 407 SATMEDEKLKEKILLNSDKQTI 472
           SA +EDE LK KI   +DK+ +
Sbjct: 386 SA-VEDEGLKGKI-SEADKKKV 405


>AL929592-5|CAI18464.1|  641|Homo sapiens heat shock 70kDa protein
           1A protein.
          Length = 641

 Score =  140 bits (340), Expect = 3e-33
 Identities = 75/142 (52%), Positives = 95/142 (66%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGVLIQV+EGERAMTKDNNLLG+FEL+GIPPAPRGVPQIEVTFDIDANGILNV+A
Sbjct: 431 YSDNQPGVLIQVYEGERAMTKDNNLLGRFELSGIPPAPRGVPQIEVTFDIDANGILNVTA 490

Query: 227 IEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQECIGILLASA* 406
            +KST K N+  +   K    ++     +      +     Q+E +  +  +     +  
Sbjct: 491 TDKSTGKANKITITNDKGRLSKEEIERMVQEAEKYKAEDEVQRERVSAKNALESYAFNMK 550

Query: 407 SATMEDEKLKEKILLNSDKQTI 472
           SA +EDE LK KI   +DK+ +
Sbjct: 551 SA-VEDEGLKGKI-SEADKKKV 570


>AL671762-7|CAI18217.1|  641|Homo sapiens heat shock 70kDa protein
           1B protein.
          Length = 641

 Score =  140 bits (340), Expect = 3e-33
 Identities = 75/142 (52%), Positives = 95/142 (66%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGVLIQV+EGERAMTKDNNLLG+FEL+GIPPAPRGVPQIEVTFDIDANGILNV+A
Sbjct: 431 YSDNQPGVLIQVYEGERAMTKDNNLLGRFELSGIPPAPRGVPQIEVTFDIDANGILNVTA 490

Query: 227 IEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQECIGILLASA* 406
            +KST K N+  +   K    ++     +      +     Q+E +  +  +     +  
Sbjct: 491 TDKSTGKANKITITNDKGRLSKEEIERMVQEAEKYKAEDEVQRERVSAKNALESYAFNMK 550

Query: 407 SATMEDEKLKEKILLNSDKQTI 472
           SA +EDE LK KI   +DK+ +
Sbjct: 551 SA-VEDEGLKGKI-SEADKKKV 570


>AL671762-6|CAI18216.1|  641|Homo sapiens heat shock 70kDa protein
           1A protein.
          Length = 641

 Score =  140 bits (340), Expect = 3e-33
 Identities = 75/142 (52%), Positives = 95/142 (66%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGVLIQV+EGERAMTKDNNLLG+FEL+GIPPAPRGVPQIEVTFDIDANGILNV+A
Sbjct: 431 YSDNQPGVLIQVYEGERAMTKDNNLLGRFELSGIPPAPRGVPQIEVTFDIDANGILNVTA 490

Query: 227 IEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQECIGILLASA* 406
            +KST K N+  +   K    ++     +      +     Q+E +  +  +     +  
Sbjct: 491 TDKSTGKANKITITNDKGRLSKEEIERMVQEAEKYKAEDEVQRERVSAKNALESYAFNMK 550

Query: 407 SATMEDEKLKEKILLNSDKQTI 472
           SA +EDE LK KI   +DK+ +
Sbjct: 551 SA-VEDEGLKGKI-SEADKKKV 570


>AL671762-5|CAM25532.1|  476|Homo sapiens heat shock 70kDa protein
           1A protein.
          Length = 476

 Score =  140 bits (340), Expect = 3e-33
 Identities = 75/142 (52%), Positives = 95/142 (66%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGVLIQV+EGERAMTKDNNLLG+FEL+GIPPAPRGVPQIEVTFDIDANGILNV+A
Sbjct: 266 YSDNQPGVLIQVYEGERAMTKDNNLLGRFELSGIPPAPRGVPQIEVTFDIDANGILNVTA 325

Query: 227 IEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQECIGILLASA* 406
            +KST K N+  +   K    ++     +      +     Q+E +  +  +     +  
Sbjct: 326 TDKSTGKANKITITNDKGRLSKEEIERMVQEAEKYKAEDEVQRERVSAKNALESYAFNMK 385

Query: 407 SATMEDEKLKEKILLNSDKQTI 472
           SA +EDE LK KI   +DK+ +
Sbjct: 386 SA-VEDEGLKGKI-SEADKKKV 405


>AL662834-18|CAI17738.1|  641|Homo sapiens heat shock 70kDa protein
           1B protein.
          Length = 641

 Score =  140 bits (340), Expect = 3e-33
 Identities = 75/142 (52%), Positives = 95/142 (66%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGVLIQV+EGERAMTKDNNLLG+FEL+GIPPAPRGVPQIEVTFDIDANGILNV+A
Sbjct: 431 YSDNQPGVLIQVYEGERAMTKDNNLLGRFELSGIPPAPRGVPQIEVTFDIDANGILNVTA 490

Query: 227 IEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQECIGILLASA* 406
            +KST K N+  +   K    ++     +      +     Q+E +  +  +     +  
Sbjct: 491 TDKSTGKANKITITNDKGRLSKEEIERMVQEAEKYKAEDEVQRERVSAKNALESYAFNMK 550

Query: 407 SATMEDEKLKEKILLNSDKQTI 472
           SA +EDE LK KI   +DK+ +
Sbjct: 551 SA-VEDEGLKGKI-SEADKKKV 570


>AL662834-17|CAI17737.1|  641|Homo sapiens heat shock 70kDa protein
           1A protein.
          Length = 641

 Score =  140 bits (340), Expect = 3e-33
 Identities = 75/142 (52%), Positives = 95/142 (66%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGVLIQV+EGERAMTKDNNLLG+FEL+GIPPAPRGVPQIEVTFDIDANGILNV+A
Sbjct: 431 YSDNQPGVLIQVYEGERAMTKDNNLLGRFELSGIPPAPRGVPQIEVTFDIDANGILNVTA 490

Query: 227 IEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQECIGILLASA* 406
            +KST K N+  +   K    ++     +      +     Q+E +  +  +     +  
Sbjct: 491 TDKSTGKANKITITNDKGRLSKEEIERMVQEAEKYKAEDEVQRERVSAKNALESYAFNMK 550

Query: 407 SATMEDEKLKEKILLNSDKQTI 472
           SA +EDE LK KI   +DK+ +
Sbjct: 551 SA-VEDEGLKGKI-SEADKKKV 570


>AL662834-16|CAM24989.1|  476|Homo sapiens heat shock 70kDa protein
           1A protein.
          Length = 476

 Score =  140 bits (340), Expect = 3e-33
 Identities = 75/142 (52%), Positives = 95/142 (66%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGVLIQV+EGERAMTKDNNLLG+FEL+GIPPAPRGVPQIEVTFDIDANGILNV+A
Sbjct: 266 YSDNQPGVLIQVYEGERAMTKDNNLLGRFELSGIPPAPRGVPQIEVTFDIDANGILNVTA 325

Query: 227 IEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQECIGILLASA* 406
            +KST K N+  +   K    ++     +      +     Q+E +  +  +     +  
Sbjct: 326 TDKSTGKANKITITNDKGRLSKEEIERMVQEAEKYKAEDEVQRERVSAKNALESYAFNMK 385

Query: 407 SATMEDEKLKEKILLNSDKQTI 472
           SA +EDE LK KI   +DK+ +
Sbjct: 386 SA-VEDEGLKGKI-SEADKKKV 405


>AF134726-7|AAD21816.1|  641|Homo sapiens HSP70-1 protein.
          Length = 641

 Score =  140 bits (340), Expect = 3e-33
 Identities = 75/142 (52%), Positives = 95/142 (66%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGVLIQV+EGERAMTKDNNLLG+FEL+GIPPAPRGVPQIEVTFDIDANGILNV+A
Sbjct: 431 YSDNQPGVLIQVYEGERAMTKDNNLLGRFELSGIPPAPRGVPQIEVTFDIDANGILNVTA 490

Query: 227 IEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQECIGILLASA* 406
            +KST K N+  +   K    ++     +      +     Q+E +  +  +     +  
Sbjct: 491 TDKSTGKANKITITNDKGRLSKEEIERMVQEAEKYKAEDEVQRERVSAKNALESYAFNMK 550

Query: 407 SATMEDEKLKEKILLNSDKQTI 472
           SA +EDE LK KI   +DK+ +
Sbjct: 551 SA-VEDEGLKGKI-SEADKKKV 570


>D85730-1|BAA32521.1|  641|Homo sapiens Heat shock protein 70 testis
           variant protein.
          Length = 641

 Score =  139 bits (337), Expect = 6e-33
 Identities = 75/142 (52%), Positives = 94/142 (66%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGVLIQV+EGERAMTKDNNLLG+F+LTGIPPAPRGVPQIEVTFDIDANGILNV+A
Sbjct: 433 YSDNQPGVLIQVYEGERAMTKDNNLLGRFDLTGIPPAPRGVPQIEVTFDIDANGILNVTA 492

Query: 227 IEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQECIGILLASA* 406
           ++KST K N+  +   K    ++     ++     +     Q+E I  +  +     +  
Sbjct: 493 MDKSTGKVNKITITNDKGRLSKEEIERMVLDAEKYKAEDEVQREKIAAKNALESYAFNM- 551

Query: 407 SATMEDEKLKEKILLNSDKQTI 472
            + + DE LK KI   SDK  I
Sbjct: 552 KSVVSDEGLKGKI-SESDKNKI 572


>DQ383515-1|ABC88476.1|  641|Homo sapiens heat shock 70kDa protein
           1-like protein.
          Length = 641

 Score =  139 bits (337), Expect = 6e-33
 Identities = 75/142 (52%), Positives = 94/142 (66%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGVLIQV+EGERAMTKDNNLLG+F+LTGIPPAPRGVPQIEVTFDIDANGILNV+A
Sbjct: 433 YSDNQPGVLIQVYEGERAMTKDNNLLGRFDLTGIPPAPRGVPQIEVTFDIDANGILNVTA 492

Query: 227 IEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQECIGILLASA* 406
           ++KST K N+  +   K    ++     ++     +     Q+E I  +  +     +  
Sbjct: 493 MDKSTGKVNKITITNDKGRLSKEEIERMVLDAEKYKAEDEVQREKIAAKNALESYAFNM- 551

Query: 407 SATMEDEKLKEKILLNSDKQTI 472
            + + DE LK KI   SDK  I
Sbjct: 552 KSVVSDEGLKGKI-SESDKNKI 572


>BC034483-1|AAH34483.1|  641|Homo sapiens heat shock 70kDa protein
           1-like protein.
          Length = 641

 Score =  139 bits (337), Expect = 6e-33
 Identities = 75/142 (52%), Positives = 94/142 (66%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGVLIQV+EGERAMTKDNNLLG+F+LTGIPPAPRGVPQIEVTFDIDANGILNV+A
Sbjct: 433 YSDNQPGVLIQVYEGERAMTKDNNLLGRFDLTGIPPAPRGVPQIEVTFDIDANGILNVTA 492

Query: 227 IEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQECIGILLASA* 406
           ++KST K N+  +   K    ++     ++     +     Q+E I  +  +     +  
Sbjct: 493 MDKSTGKVNKITIANDKGRLSKEEIERMVLDAEKYKAEDEVQREKIAAKNALESYAFNM- 551

Query: 407 SATMEDEKLKEKILLNSDKQTI 472
            + + DE LK KI   SDK  I
Sbjct: 552 KSVVSDEGLKGKI-SESDKNKI 572


>BA000025-10|BAB63301.1|  641|Homo sapiens heat shock protein
           protein.
          Length = 641

 Score =  139 bits (337), Expect = 6e-33
 Identities = 75/142 (52%), Positives = 94/142 (66%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGVLIQV+EGERAMTKDNNLLG+F+LTGIPPAPRGVPQIEVTFDIDANGILNV+A
Sbjct: 433 YSDNQPGVLIQVYEGERAMTKDNNLLGRFDLTGIPPAPRGVPQIEVTFDIDANGILNVTA 492

Query: 227 IEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQECIGILLASA* 406
           ++KST K N+  +   K    ++     ++     +     Q+E I  +  +     +  
Sbjct: 493 MDKSTGKVNKITITNDKGRLSKEEIERMVLDAEKYKAEDEVQREKIAAKNALESYAFNM- 551

Query: 407 SATMEDEKLKEKILLNSDKQTI 472
            + + DE LK KI   SDK  I
Sbjct: 552 KSVVSDEGLKGKI-SESDKNKI 572


>AL929592-4|CAI18463.1|  641|Homo sapiens heat shock 70kDa protein
           1-like protein.
          Length = 641

 Score =  139 bits (337), Expect = 6e-33
 Identities = 75/142 (52%), Positives = 94/142 (66%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGVLIQV+EGERAMTKDNNLLG+F+LTGIPPAPRGVPQIEVTFDIDANGILNV+A
Sbjct: 433 YSDNQPGVLIQVYEGERAMTKDNNLLGRFDLTGIPPAPRGVPQIEVTFDIDANGILNVTA 492

Query: 227 IEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQECIGILLASA* 406
           ++KST K N+  +   K    ++     ++     +     Q+E I  +  +     +  
Sbjct: 493 MDKSTGKVNKITITNDKGRLSKEEIERMVLDAEKYKAEDEVQREKIAAKNALESYAFNM- 551

Query: 407 SATMEDEKLKEKILLNSDKQTI 472
            + + DE LK KI   SDK  I
Sbjct: 552 KSVVSDEGLKGKI-SESDKNKI 572


>AL662834-15|CAI17736.1|  641|Homo sapiens heat shock 70kDa protein
           1-like protein.
          Length = 641

 Score =  139 bits (337), Expect = 6e-33
 Identities = 75/142 (52%), Positives = 94/142 (66%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGVLIQV+EGERAMTKDNNLLG+F+LTGIPPAPRGVPQIEVTFDIDANGILNV+A
Sbjct: 433 YSDNQPGVLIQVYEGERAMTKDNNLLGRFDLTGIPPAPRGVPQIEVTFDIDANGILNVTA 492

Query: 227 IEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQECIGILLASA* 406
           ++KST K N+  +   K    ++     ++     +     Q+E I  +  +     +  
Sbjct: 493 MDKSTGKVNKITITNDKGRLSKEEIERMVLDAEKYKAEDEVQREKIAAKNALESYAFNM- 551

Query: 407 SATMEDEKLKEKILLNSDKQTI 472
            + + DE LK KI   SDK  I
Sbjct: 552 KSVVSDEGLKGKI-SESDKNKI 572


>AK223386-1|BAD97106.1|  641|Homo sapiens heat shock 70kDa protein
           1-like variant protein.
          Length = 641

 Score =  139 bits (337), Expect = 6e-33
 Identities = 75/142 (52%), Positives = 94/142 (66%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGVLIQV+EGERAMTKDNNLLG+F+LTGIPPAPRGVPQIEVTFDIDANGILNV+A
Sbjct: 433 YSDNQPGVLIQVYEGERAMTKDNNLLGRFDLTGIPPAPRGVPQIEVTFDIDANGILNVTA 492

Query: 227 IEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQECIGILLASA* 406
           ++KST K N+  +   K    ++     ++     +     Q+E I  +  +     +  
Sbjct: 493 MDKSTGKVNKITITNDKGRLSKEEIERMVLDAEKYKAEDEVQREKIAAKNALESYAFNM- 551

Query: 407 SATMEDEKLKEKILLNSDKQTI 472
            + + DE LK KI   SDK  I
Sbjct: 552 KSVVSDEGLKGKI-SESDKNKI 572


>AF134726-8|AAD21817.1|  641|Homo sapiens HSP70-HOM protein.
          Length = 641

 Score =  139 bits (337), Expect = 6e-33
 Identities = 75/142 (52%), Positives = 94/142 (66%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGVLIQV+EGERAMTKDNNLLG+F+LTGIPPAPRGVPQIEVTFDIDANGILNV+A
Sbjct: 433 YSDNQPGVLIQVYEGERAMTKDNNLLGRFDLTGIPPAPRGVPQIEVTFDIDANGILNVTA 492

Query: 227 IEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQECIGILLASA* 406
           ++KST K N+  +   K    ++     ++     +     Q+E I  +  +     +  
Sbjct: 493 MDKSTGKVNKITITNDKGRLSKEEIERMVLDAEKYKAEDEVQREKIAAKNALESYAFNM- 551

Query: 407 SATMEDEKLKEKILLNSDKQTI 472
            + + DE LK KI   SDK  I
Sbjct: 552 KSVVSDEGLKGKI-SESDKNKI 572


>M59829-1|AAA63228.1|  641|Homo sapiens heat shock-induced protein
           protein.
          Length = 641

 Score =  138 bits (335), Expect = 1e-32
 Identities = 75/142 (52%), Positives = 93/142 (65%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGVLIQV+EGERAMTKDNNLLG+F+LTGIPPAPRGVPQIEVTFDIDANGILNV+A
Sbjct: 433 YSDNQPGVLIQVYEGERAMTKDNNLLGRFDLTGIPPAPRGVPQIEVTFDIDANGILNVTA 492

Query: 227 IEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQECIGILLASA* 406
            +KST K N+  +   K    ++     ++     +     Q+E I  +  +     +  
Sbjct: 493 TDKSTGKVNKITITNDKGRLSKEEIERMVLDAEKYKAEDEVQREKIAAKNALESYAFNM- 551

Query: 407 SATMEDEKLKEKILLNSDKQTI 472
            + + DE LK KI   SDK  I
Sbjct: 552 KSVVSDEGLKGKI-SESDKNKI 572


>AL671762-4|CAI18215.1|  641|Homo sapiens heat shock 70kDa protein
           1-like protein.
          Length = 641

 Score =  138 bits (335), Expect = 1e-32
 Identities = 75/142 (52%), Positives = 93/142 (65%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGVLIQV+EGERAMTKDNNLLG+F+LTGIPPAPRGVPQIEVTFDIDANGILNV+A
Sbjct: 433 YSDNQPGVLIQVYEGERAMTKDNNLLGRFDLTGIPPAPRGVPQIEVTFDIDANGILNVTA 492

Query: 227 IEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQECIGILLASA* 406
            +KST K N+  +   K    ++     ++     +     Q+E I  +  +     +  
Sbjct: 493 TDKSTGKVNKITITNDKGRLSKEEIERMVLDAEKYKAEDEVQREKIAAKNALESYAFNM- 551

Query: 407 SATMEDEKLKEKILLNSDKQTI 472
            + + DE LK KI   SDK  I
Sbjct: 552 KSVVSDEGLKGKI-SESDKNKI 572


>AF134726-6|AAD21815.1|  641|Homo sapiens HSP70-2 protein.
          Length = 641

 Score =  138 bits (335), Expect = 1e-32
 Identities = 74/142 (52%), Positives = 95/142 (66%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGVLIQV+EGERAMTKDNNLLG+FEL+GIPPAPRGVPQIEVTFDIDANGILNV+A
Sbjct: 431 YSDNQPGVLIQVYEGERAMTKDNNLLGRFELSGIPPAPRGVPQIEVTFDIDANGILNVTA 490

Query: 227 IEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQECIGILLASA* 406
            +KST K ++  +   K    ++     +      +     Q+E +  +  +     +  
Sbjct: 491 TDKSTGKASKITITNDKGRLSKEEIERMVQEAEKYKAEDEVQRERVSAKNALESYAFNMK 550

Query: 407 SATMEDEKLKEKILLNSDKQTI 472
           SA +EDE LK KI   +DK+ +
Sbjct: 551 SA-VEDEGLKGKI-SEADKKKV 570


>U56725-1|AAD11466.1|  639|Homo sapiens heat shock protein protein.
          Length = 639

 Score =  135 bits (327), Expect = 1e-31
 Identities = 72/142 (50%), Positives = 91/142 (64%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQ  VL+QV+EGERAMTKDNNLLGKF+LTGIPPAPRGVPQIEVTFDIDANGILNV+A
Sbjct: 434 YSDNQSSVLVQVYEGERAMTKDNNLLGKFDLTGIPPAPRGVPQIEVTFDIDANGILNVTA 493

Query: 227 IEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQECIGILLASA* 406
            +KST KEN+  +   K    +      +      ++     ++ +  +  +     +  
Sbjct: 494 ADKSTGKENKITITNDKGRLSKDDIDRMVQEAERYKSEDEANRDRVAAKNALESYTYNI- 552

Query: 407 SATMEDEKLKEKILLNSDKQTI 472
             T+EDEKL+ KI    DK  I
Sbjct: 553 KQTVEDEKLRGKI-SEQDKNKI 573


>L26336-1|AAA52698.1|  639|Homo sapiens heat shock protein protein.
          Length = 639

 Score =  135 bits (327), Expect = 1e-31
 Identities = 72/142 (50%), Positives = 91/142 (64%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQ  VL+QV+EGERAMTKDNNLLGKF+LTGIPPAPRGVPQIEVTFDIDANGILNV+A
Sbjct: 434 YSDNQSSVLVQVYEGERAMTKDNNLLGKFDLTGIPPAPRGVPQIEVTFDIDANGILNVTA 493

Query: 227 IEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQECIGILLASA* 406
            +KST KEN+  +   K    +      +      ++     ++ +  +  +     +  
Sbjct: 494 ADKSTGKENKITITNDKGRLSKDDIDRMVQEAERYKSEDEANRDRVAAKNALESYTYNI- 552

Query: 407 SATMEDEKLKEKILLNSDKQTI 472
             T+EDEKL+ KI    DK  I
Sbjct: 553 KQTVEDEKLRGKI-SEQDKNKI 573


>DQ489378-1|ABE96830.1|  639|Homo sapiens heat shock 70kDa protein 2
           protein.
          Length = 639

 Score =  135 bits (327), Expect = 1e-31
 Identities = 72/142 (50%), Positives = 91/142 (64%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQ  VL+QV+EGERAMTKDNNLLGKF+LTGIPPAPRGVPQIEVTFDIDANGILNV+A
Sbjct: 434 YSDNQSSVLVQVYEGERAMTKDNNLLGKFDLTGIPPAPRGVPQIEVTFDIDANGILNVTA 493

Query: 227 IEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQECIGILLASA* 406
            +KST KEN+  +   K    +      +      ++     ++ +  +  +     +  
Sbjct: 494 ADKSTGKENKITITNDKGRLSKDDIDRMVQEAERYKSEDEANRDRVAAKNALESYTYNI- 552

Query: 407 SATMEDEKLKEKILLNSDKQTI 472
             T+EDEKL+ KI    DK  I
Sbjct: 553 KQTVEDEKLRGKI-SEQDKNKI 573


>BT009815-1|AAP88817.1|  639|Homo sapiens heat shock 70kDa protein 2
           protein.
          Length = 639

 Score =  135 bits (327), Expect = 1e-31
 Identities = 72/142 (50%), Positives = 91/142 (64%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQ  VL+QV+EGERAMTKDNNLLGKF+LTGIPPAPRGVPQIEVTFDIDANGILNV+A
Sbjct: 434 YSDNQSSVLVQVYEGERAMTKDNNLLGKFDLTGIPPAPRGVPQIEVTFDIDANGILNVTA 493

Query: 227 IEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQECIGILLASA* 406
            +KST KEN+  +   K    +      +      ++     ++ +  +  +     +  
Sbjct: 494 ADKSTGKENKITITNDKGRLSKDDIDRMVQEAERYKSEDEANRDRVAAKNALESYTYNI- 552

Query: 407 SATMEDEKLKEKILLNSDKQTI 472
             T+EDEKL+ KI    DK  I
Sbjct: 553 KQTVEDEKLRGKI-SEQDKNKI 573


>BC036107-1|AAH36107.1|  639|Homo sapiens HSPA2 protein protein.
          Length = 639

 Score =  135 bits (327), Expect = 1e-31
 Identities = 72/142 (50%), Positives = 91/142 (64%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQ  VL+QV+EGERAMTKDNNLLGKF+LTGIPPAPRGVPQIEVTFDIDANGILNV+A
Sbjct: 434 YSDNQSSVLVQVYEGERAMTKDNNLLGKFDLTGIPPAPRGVPQIEVTFDIDANGILNVTA 493

Query: 227 IEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQECIGILLASA* 406
            +KST KEN+  +   K    +      +      ++     ++ +  +  +     +  
Sbjct: 494 ADKSTGKENKITITNDKGRLSKDDIDRMVQEAERYKSEDEANRDRVAAKNALESYTYNI- 552

Query: 407 SATMEDEKLKEKILLNSDKQTI 472
             T+EDEKL+ KI    DK  I
Sbjct: 553 KQTVEDEKLRGKI-SEQDKNKI 573


>BC001752-1|AAH01752.1|  639|Homo sapiens heat shock 70kDa protein 2
           protein.
          Length = 639

 Score =  135 bits (327), Expect = 1e-31
 Identities = 72/142 (50%), Positives = 91/142 (64%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQ  VL+QV+EGERAMTKDNNLLGKF+LTGIPPAPRGVPQIEVTFDIDANGILNV+A
Sbjct: 434 YSDNQSSVLVQVYEGERAMTKDNNLLGKFDLTGIPPAPRGVPQIEVTFDIDANGILNVTA 493

Query: 227 IEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQECIGILLASA* 406
            +KST KEN+  +   K    +      +      ++     ++ +  +  +     +  
Sbjct: 494 ADKSTGKENKITITNDKGRLSKDDIDRMVQEAERYKSEDEANRDRVAAKNALESYTYNI- 552

Query: 407 SATMEDEKLKEKILLNSDKQTI 472
             T+EDEKL+ KI    DK  I
Sbjct: 553 KQTVEDEKLRGKI-SEQDKNKI 573


>M11717-1|AAA52697.1|  640|Homo sapiens heat shock protein protein.
          Length = 640

 Score =  134 bits (324), Expect = 2e-31
 Identities = 74/142 (52%), Positives = 94/142 (66%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGVLIQV+EGERAMTKDNNLLG+FEL+GIPPAP GVPQIEVTFDIDANGILNV+A
Sbjct: 431 YSDNQPGVLIQVYEGERAMTKDNNLLGRFELSGIPPAP-GVPQIEVTFDIDANGILNVTA 489

Query: 227 IEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQECIGILLASA* 406
            +KST K N+  +   K    ++     +      +     Q+E +  +  +     +  
Sbjct: 490 TDKSTGKANKITITNDKGRLSKEEIERMVQEAEKYKAEDEVQRERVSAKNALESYAFNMK 549

Query: 407 SATMEDEKLKEKILLNSDKQTI 472
           SA +EDE LK KI   +DK+ +
Sbjct: 550 SA-VEDEGLKGKI-SEADKKKV 569


>AK223362-1|BAD97082.1|  643|Homo sapiens heat shock 70kDa protein 6
           (HSP70B') variant protein.
          Length = 643

 Score =  132 bits (318), Expect = 1e-30
 Identities = 65/133 (48%), Positives = 89/133 (66%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGV IQV+EGERAMTKDNNLLG+FEL+GIPPAPRGVPQIEVTFDIDANGIL+V+A
Sbjct: 433 YSDNQPGVFIQVYEGERAMTKDNNLLGRFELSGIPPAPRGVPQIEVTFDIDANGILSVTA 492

Query: 227 IEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQECIGILLASA* 406
            ++ST K N+  +   K    ++     +      +     Q++ +  +  +   +    
Sbjct: 493 TDRSTGKANKITITNDKGRLSKEEVERMVHEAEQYKAEDEAQRDRVAAKNSLEAHVFHV- 551

Query: 407 SATMEDEKLKEKI 445
             ++++E L+EKI
Sbjct: 552 KGSLQEESLREKI 564


>X51758-1|CAA36062.1|  289|Homo sapiens heat shock protein 70B' (AA
           355-643) protein.
          Length = 289

 Score =  130 bits (315), Expect = 3e-30
 Identities = 64/133 (48%), Positives = 89/133 (66%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGV IQV+EGERAMTKDNNLLG+FEL+GIPPAPRGVPQIEVTFDIDANGIL+V+A
Sbjct: 79  YSDNQPGVFIQVYEGERAMTKDNNLLGRFELSGIPPAPRGVPQIEVTFDIDANGILSVTA 138

Query: 227 IEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQECIGILLASA* 406
            ++ST K N+  +   K    ++     +      +     Q++ +  +  +   +    
Sbjct: 139 TDRSTGKANKITITNDKGRLSKEEVERMVHEAEQYKAEDEAQRDRVAAKNSLEAHVFHV- 197

Query: 407 SATMEDEKLKEKI 445
             ++++E L++KI
Sbjct: 198 KGSLQEESLRDKI 210


>X51757-1|CAA36061.1|  643|Homo sapiens protein ( Human heat-shock
           protein HSP70B' gene. ).
          Length = 643

 Score =  130 bits (315), Expect = 3e-30
 Identities = 64/133 (48%), Positives = 89/133 (66%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGV IQV+EGERAMTKDNNLLG+FEL+GIPPAPRGVPQIEVTFDIDANGIL+V+A
Sbjct: 433 YSDNQPGVFIQVYEGERAMTKDNNLLGRFELSGIPPAPRGVPQIEVTFDIDANGILSVTA 492

Query: 227 IEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQECIGILLASA* 406
            ++ST K N+  +   K    ++     +      +     Q++ +  +  +   +    
Sbjct: 493 TDRSTGKANKITITNDKGRLSKEEVERMVHEAEQYKAEDEAQRDRVAAKNSLEAHVFHV- 551

Query: 407 SATMEDEKLKEKI 445
             ++++E L++KI
Sbjct: 552 KGSLQEESLRDKI 564


>DQ521571-1|ABF47108.1|  643|Homo sapiens heat shock 70kDa protein 6
           (HSP70B') protein.
          Length = 643

 Score =  130 bits (315), Expect = 3e-30
 Identities = 64/133 (48%), Positives = 89/133 (66%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGV IQV+EGERAMTKDNNLLG+FEL+GIPPAPRGVPQIEVTFDIDANGIL+V+A
Sbjct: 433 YSDNQPGVFIQVYEGERAMTKDNNLLGRFELSGIPPAPRGVPQIEVTFDIDANGILSVTA 492

Query: 227 IEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQECIGILLASA* 406
            ++ST K N+  +   K    ++     +      +     Q++ +  +  +   +    
Sbjct: 493 TDRSTGKANKITITNDKGRLSKEEVERMVHEAEQYKAEDEAQRDRVAAKNSLEAHVFHV- 551

Query: 407 SATMEDEKLKEKI 445
             ++++E L++KI
Sbjct: 552 KGSLQEESLRDKI 564


>BC035665-1|AAH35665.1|  643|Homo sapiens heat shock 70kDa protein 6
           (HSP70B') protein.
          Length = 643

 Score =  130 bits (315), Expect = 3e-30
 Identities = 64/133 (48%), Positives = 89/133 (66%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGV IQV+EGERAMTKDNNLLG+FEL+GIPPAPRGVPQIEVTFDIDANGIL+V+A
Sbjct: 433 YSDNQPGVFIQVYEGERAMTKDNNLLGRFELSGIPPAPRGVPQIEVTFDIDANGILSVTA 492

Query: 227 IEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQECIGILLASA* 406
            ++ST K N+  +   K    ++     +      +     Q++ +  +  +   +    
Sbjct: 493 TDRSTGKANKITITNDKGRLSKEEVERMVHEAEQYKAEDEAQRDRVAAKNSLEAHVFHV- 551

Query: 407 SATMEDEKLKEKI 445
             ++++E L++KI
Sbjct: 552 KGSLQEESLRDKI 564


>AL590385-3|CAI16120.1|  643|Homo sapiens heat shock 70kDa protein 6
           (HSP70B') protein.
          Length = 643

 Score =  130 bits (315), Expect = 3e-30
 Identities = 64/133 (48%), Positives = 89/133 (66%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGV IQV+EGERAMTKDNNLLG+FEL+GIPPAPRGVPQIEVTFDIDANGIL+V+A
Sbjct: 433 YSDNQPGVFIQVYEGERAMTKDNNLLGRFELSGIPPAPRGVPQIEVTFDIDANGILSVTA 492

Query: 227 IEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQECIGILLASA* 406
            ++ST K N+  +   K    ++     +      +     Q++ +  +  +   +    
Sbjct: 493 TDRSTGKANKITITNDKGRLSKEEVERMVHEAEQYKAEDEAQRDRVAAKNSLEAHVFHV- 551

Query: 407 SATMEDEKLKEKI 445
             ++++E L++KI
Sbjct: 552 KGSLQEESLRDKI 564


>X87949-1|CAA61201.1|  653|Homo sapiens BiP protein.
          Length = 653

 Score =  109 bits (261), Expect = 1e-23
 Identities = 49/69 (71%), Positives = 59/69 (85%)
 Frame = +2

Query: 50  SDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAI 229
           SDNQP V I+V+EGER +TKDN+LLG F+LTGIPPAPRGVPQIEVTF+ID NGIL V+A 
Sbjct: 454 SDNQPTVTIKVYEGERPLTKDNHLLGTFDLTGIPPAPRGVPQIEVTFEIDVNGILRVTAE 513

Query: 230 EKSTNKENR 256
           +K T  +N+
Sbjct: 514 DKGTGNKNK 522



 Score = 51.2 bits (117), Expect = 3e-06
 Identities = 23/34 (67%), Positives = 28/34 (82%)
 Frame = +1

Query: 253 QITITNDKGRLSKEEIERMVNEAEKYRNEDDKAK 354
           +ITITND+ RL+ EEIERMVN+AEK+  ED K K
Sbjct: 522 KITITNDQNRLTPEEIERMVNDAEKFAEEDKKLK 555


>M19645-1|AAA52614.1|  653|Homo sapiens protein ( Human 78 kdalton
           glucose-regulated protein (GRP78) gene, complete cds. ).
          Length = 653

 Score =  109 bits (261), Expect = 1e-23
 Identities = 49/69 (71%), Positives = 59/69 (85%)
 Frame = +2

Query: 50  SDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAI 229
           SDNQP V I+V+EGER +TKDN+LLG F+LTGIPPAPRGVPQIEVTF+ID NGIL V+A 
Sbjct: 454 SDNQPTVTIKVYEGERPLTKDNHLLGTFDLTGIPPAPRGVPQIEVTFEIDVNGILRVTAE 513

Query: 230 EKSTNKENR 256
           +K T  +N+
Sbjct: 514 DKGTGNKNK 522



 Score = 51.2 bits (117), Expect = 3e-06
 Identities = 23/34 (67%), Positives = 28/34 (82%)
 Frame = +1

Query: 253 QITITNDKGRLSKEEIERMVNEAEKYRNEDDKAK 354
           +ITITND+ RL+ EEIERMVN+AEK+  ED K K
Sbjct: 522 KITITNDQNRLTPEEIERMVNDAEKFAEEDKKLK 555


>DQ385847-1|ABD04090.1|  654|Homo sapiens heat shock 70kDa protein 5
           (glucose-regulated protein, 78kDa) protein.
          Length = 654

 Score =  109 bits (261), Expect = 1e-23
 Identities = 49/69 (71%), Positives = 59/69 (85%)
 Frame = +2

Query: 50  SDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAI 229
           SDNQP V I+V+EGER +TKDN+LLG F+LTGIPPAPRGVPQIEVTF+ID NGIL V+A 
Sbjct: 455 SDNQPTVTIKVYEGERPLTKDNHLLGTFDLTGIPPAPRGVPQIEVTFEIDVNGILRVTAE 514

Query: 230 EKSTNKENR 256
           +K T  +N+
Sbjct: 515 DKGTGNKNK 523



 Score = 51.2 bits (117), Expect = 3e-06
 Identities = 23/34 (67%), Positives = 28/34 (82%)
 Frame = +1

Query: 253 QITITNDKGRLSKEEIERMVNEAEKYRNEDDKAK 354
           +ITITND+ RL+ EEIERMVN+AEK+  ED K K
Sbjct: 523 KITITNDQNRLTPEEIERMVNDAEKFAEEDKKLK 556


>BC112963-1|AAI12964.1|  655|Homo sapiens HSPA5 protein protein.
          Length = 655

 Score =  109 bits (261), Expect = 1e-23
 Identities = 49/69 (71%), Positives = 59/69 (85%)
 Frame = +2

Query: 50  SDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAI 229
           SDNQP V I+V+EGER +TKDN+LLG F+LTGIPPAPRGVPQIEVTF+ID NGIL V+A 
Sbjct: 456 SDNQPTVTIKVYEGERPLTKDNHLLGTFDLTGIPPAPRGVPQIEVTFEIDVNGILRVTAE 515

Query: 230 EKSTNKENR 256
           +K T  +N+
Sbjct: 516 DKGTGNKNK 524



 Score = 51.2 bits (117), Expect = 3e-06
 Identities = 23/34 (67%), Positives = 28/34 (82%)
 Frame = +1

Query: 253 QITITNDKGRLSKEEIERMVNEAEKYRNEDDKAK 354
           +ITITND+ RL+ EEIERMVN+AEK+  ED K K
Sbjct: 524 KITITNDQNRLTPEEIERMVNDAEKFAEEDKKLK 557


>BC020235-1|AAH20235.1|  654|Homo sapiens heat shock 70kDa protein 5
           (glucose-regulated protein, 78kDa) protein.
          Length = 654

 Score =  109 bits (261), Expect = 1e-23
 Identities = 49/69 (71%), Positives = 59/69 (85%)
 Frame = +2

Query: 50  SDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAI 229
           SDNQP V I+V+EGER +TKDN+LLG F+LTGIPPAPRGVPQIEVTF+ID NGIL V+A 
Sbjct: 455 SDNQPTVTIKVYEGERPLTKDNHLLGTFDLTGIPPAPRGVPQIEVTFEIDVNGILRVTAE 514

Query: 230 EKSTNKENR 256
           +K T  +N+
Sbjct: 515 DKGTGNKNK 523



 Score = 51.2 bits (117), Expect = 3e-06
 Identities = 23/34 (67%), Positives = 28/34 (82%)
 Frame = +1

Query: 253 QITITNDKGRLSKEEIERMVNEAEKYRNEDDKAK 354
           +ITITND+ RL+ EEIERMVN+AEK+  ED K K
Sbjct: 523 KITITNDQNRLTPEEIERMVNDAEKFAEEDKKLK 556


>AJ271729-1|CAB71335.1|  654|Homo sapiens glucose-regulated protein
           protein.
          Length = 654

 Score =  109 bits (261), Expect = 1e-23
 Identities = 49/69 (71%), Positives = 59/69 (85%)
 Frame = +2

Query: 50  SDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAI 229
           SDNQP V I+V+EGER +TKDN+LLG F+LTGIPPAPRGVPQIEVTF+ID NGIL V+A 
Sbjct: 455 SDNQPTVTIKVYEGERPLTKDNHLLGTFDLTGIPPAPRGVPQIEVTFEIDVNGILRVTAE 514

Query: 230 EKSTNKENR 256
           +K T  +N+
Sbjct: 515 DKGTGNKNK 523



 Score = 51.2 bits (117), Expect = 3e-06
 Identities = 23/34 (67%), Positives = 28/34 (82%)
 Frame = +1

Query: 253 QITITNDKGRLSKEEIERMVNEAEKYRNEDDKAK 354
           +ITITND+ RL+ EEIERMVN+AEK+  ED K K
Sbjct: 523 KITITNDQNRLTPEEIERMVNDAEKFAEEDKKLK 556


>AF216292-1|AAF42836.1|  654|Homo sapiens endoplasmic reticulum
           lumenal Ca2+ binding protein grp78 protein.
          Length = 654

 Score =  109 bits (261), Expect = 1e-23
 Identities = 49/69 (71%), Positives = 59/69 (85%)
 Frame = +2

Query: 50  SDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAI 229
           SDNQP V I+V+EGER +TKDN+LLG F+LTGIPPAPRGVPQIEVTF+ID NGIL V+A 
Sbjct: 455 SDNQPTVTIKVYEGERPLTKDNHLLGTFDLTGIPPAPRGVPQIEVTFEIDVNGILRVTAE 514

Query: 230 EKSTNKENR 256
           +K T  +N+
Sbjct: 515 DKGTGNKNK 523



 Score = 51.2 bits (117), Expect = 3e-06
 Identities = 23/34 (67%), Positives = 28/34 (82%)
 Frame = +1

Query: 253 QITITNDKGRLSKEEIERMVNEAEKYRNEDDKAK 354
           +ITITND+ RL+ EEIERMVN+AEK+  ED K K
Sbjct: 523 KITITNDQNRLTPEEIERMVNDAEKFAEEDKKLK 556


>AF188611-1|AAF13605.1|  639|Homo sapiens BiP protein protein.
          Length = 639

 Score =  109 bits (261), Expect = 1e-23
 Identities = 49/69 (71%), Positives = 59/69 (85%)
 Frame = +2

Query: 50  SDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAI 229
           SDNQP V I+V+EGER +TKDN+LLG F+LTGIPPAPRGVPQIEVTF+ID NGIL V+A 
Sbjct: 437 SDNQPTVTIKVYEGERPLTKDNHLLGTFDLTGIPPAPRGVPQIEVTFEIDVNGILRVTAE 496

Query: 230 EKSTNKENR 256
           +K T  +N+
Sbjct: 497 DKGTGNKNK 505



 Score = 51.2 bits (117), Expect = 3e-06
 Identities = 23/34 (67%), Positives = 28/34 (82%)
 Frame = +1

Query: 253 QITITNDKGRLSKEEIERMVNEAEKYRNEDDKAK 354
           +ITITND+ RL+ EEIERMVN+AEK+  ED K K
Sbjct: 505 KITITNDQNRLTPEEIERMVNDAEKFAEEDKKLK 538


>L15189-1|AAA67526.1|  679|Homo sapiens MTHSP75 protein.
          Length = 679

 Score = 94.7 bits (225), Expect = 2e-19
 Identities = 45/69 (65%), Positives = 54/69 (78%)
 Frame = +2

Query: 50  SDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAI 229
           +D Q  V I+V +GER M  DN LLG+F L GIPPAPRGVPQIEVTFDIDANGI++VSA 
Sbjct: 476 ADGQTQVEIKVCQGEREMAGDNKLLGQFTLIGIPPAPRGVPQIEVTFDIDANGIVHVSAK 535

Query: 230 EKSTNKENR 256
           +K T +E +
Sbjct: 536 DKGTRREQQ 544



 Score = 37.1 bits (82), Expect = 0.049
 Identities = 17/35 (48%), Positives = 21/35 (60%)
 Frame = +1

Query: 250 EQITITNDKGRLSKEEIERMVNEAEKYRNEDDKAK 354
           EQ  +    G LSK++IE MV  AEKY  ED + K
Sbjct: 542 EQQIVIQSSGGLSKDDIENMVKNAEKYAEEDRRKK 576


>DQ531046-1|ABF50973.1|  679|Homo sapiens heat shock 70kDa protein
           9B (mortalin-2) protein.
          Length = 679

 Score = 94.7 bits (225), Expect = 2e-19
 Identities = 45/69 (65%), Positives = 54/69 (78%)
 Frame = +2

Query: 50  SDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAI 229
           +D Q  V I+V +GER M  DN LLG+F L GIPPAPRGVPQIEVTFDIDANGI++VSA 
Sbjct: 476 ADGQTQVEIKVCQGEREMAGDNKLLGQFTLIGIPPAPRGVPQIEVTFDIDANGIVHVSAK 535

Query: 230 EKSTNKENR 256
           +K T +E +
Sbjct: 536 DKGTGREQQ 544



 Score = 37.1 bits (82), Expect = 0.049
 Identities = 17/35 (48%), Positives = 21/35 (60%)
 Frame = +1

Query: 250 EQITITNDKGRLSKEEIERMVNEAEKYRNEDDKAK 354
           EQ  +    G LSK++IE MV  AEKY  ED + K
Sbjct: 542 EQQIVIQSSGGLSKDDIENMVKNAEKYAEEDRRKK 576


>DQ480334-1|ABF19573.1|  350|Homo sapiens catecholamine-regulated
           protein 40 protein.
          Length = 350

 Score = 94.7 bits (225), Expect = 2e-19
 Identities = 45/69 (65%), Positives = 54/69 (78%)
 Frame = +2

Query: 50  SDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAI 229
           +D Q  V I+V +GER M  DN LLG+F L GIPPAPRGVPQIEVTFDIDANGI++VSA 
Sbjct: 143 ADGQTQVEIKVCQGEREMAGDNKLLGQFTLIGIPPAPRGVPQIEVTFDIDANGIVHVSAK 202

Query: 230 EKSTNKENR 256
           +K T +E +
Sbjct: 203 DKGTGRERQ 211



 Score = 35.5 bits (78), Expect = 0.15
 Identities = 16/35 (45%), Positives = 21/35 (60%)
 Frame = +1

Query: 250 EQITITNDKGRLSKEEIERMVNEAEKYRNEDDKAK 354
           E+  +    G LSK++IE MV  AEKY  ED + K
Sbjct: 209 ERQIVIQSSGGLSKDDIENMVKNAEKYAEEDRRKK 243


>BC030634-1|AAH30634.1|  681|Homo sapiens HSPA9 protein protein.
          Length = 681

 Score = 94.7 bits (225), Expect = 2e-19
 Identities = 45/69 (65%), Positives = 54/69 (78%)
 Frame = +2

Query: 50  SDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAI 229
           +D Q  V I+V +GER M  DN LLG+F L GIPPAPRGVPQIEVTFDIDANGI++VSA 
Sbjct: 478 ADGQTQVEIKVCQGEREMAGDNKLLGQFTLIGIPPAPRGVPQIEVTFDIDANGIVHVSAK 537

Query: 230 EKSTNKENR 256
           +K T +E +
Sbjct: 538 DKGTGREQQ 546



 Score = 37.1 bits (82), Expect = 0.049
 Identities = 17/35 (48%), Positives = 21/35 (60%)
 Frame = +1

Query: 250 EQITITNDKGRLSKEEIERMVNEAEKYRNEDDKAK 354
           EQ  +    G LSK++IE MV  AEKY  ED + K
Sbjct: 544 EQQIVIQSSGGLSKDDIENMVKNAEKYAEEDRRKK 578


>BC024034-1|AAH24034.1|  679|Homo sapiens heat shock 70kDa protein 9
           (mortalin) protein.
          Length = 679

 Score = 94.7 bits (225), Expect = 2e-19
 Identities = 45/69 (65%), Positives = 54/69 (78%)
 Frame = +2

Query: 50  SDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAI 229
           +D Q  V I+V +GER M  DN LLG+F L GIPPAPRGVPQIEVTFDIDANGI++VSA 
Sbjct: 476 ADGQTQVEIKVCQGEREMAGDNKLLGQFTLIGIPPAPRGVPQIEVTFDIDANGIVHVSAK 535

Query: 230 EKSTNKENR 256
           +K T +E +
Sbjct: 536 DKGTGREQQ 544



 Score = 37.1 bits (82), Expect = 0.049
 Identities = 17/35 (48%), Positives = 21/35 (60%)
 Frame = +1

Query: 250 EQITITNDKGRLSKEEIERMVNEAEKYRNEDDKAK 354
           EQ  +    G LSK++IE MV  AEKY  ED + K
Sbjct: 542 EQQIVIQSSGGLSKDDIENMVKNAEKYAEEDRRKK 576


>BC000478-1|AAH00478.1|  679|Homo sapiens heat shock 70kDa protein 9
           (mortalin) protein.
          Length = 679

 Score = 94.7 bits (225), Expect = 2e-19
 Identities = 45/69 (65%), Positives = 54/69 (78%)
 Frame = +2

Query: 50  SDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAI 229
           +D Q  V I+V +GER M  DN LLG+F L GIPPAPRGVPQIEVTFDIDANGI++VSA 
Sbjct: 476 ADGQTQVEIKVCQGEREMAGDNKLLGQFTLIGIPPAPRGVPQIEVTFDIDANGIVHVSAK 535

Query: 230 EKSTNKENR 256
           +K T +E +
Sbjct: 536 DKGTGREQQ 544



 Score = 37.1 bits (82), Expect = 0.049
 Identities = 17/35 (48%), Positives = 21/35 (60%)
 Frame = +1

Query: 250 EQITITNDKGRLSKEEIERMVNEAEKYRNEDDKAK 354
           EQ  +    G LSK++IE MV  AEKY  ED + K
Sbjct: 542 EQQIVIQSSGGLSKDDIENMVKNAEKYAEEDRRKK 576


>AK222758-1|BAD96478.1|  679|Homo sapiens heat shock 70kDa protein
           9B precursor variant protein.
          Length = 679

 Score = 94.7 bits (225), Expect = 2e-19
 Identities = 45/69 (65%), Positives = 54/69 (78%)
 Frame = +2

Query: 50  SDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAI 229
           +D Q  V I+V +GER M  DN LLG+F L GIPPAPRGVPQIEVTFDIDANGI++VSA 
Sbjct: 476 ADGQTQVEIKVCQGEREMAGDNKLLGQFTLIGIPPAPRGVPQIEVTFDIDANGIVHVSAK 535

Query: 230 EKSTNKENR 256
           +K T +E +
Sbjct: 536 DKGTGREQQ 544



 Score = 37.1 bits (82), Expect = 0.049
 Identities = 17/35 (48%), Positives = 21/35 (60%)
 Frame = +1

Query: 250 EQITITNDKGRLSKEEIERMVNEAEKYRNEDDKAK 354
           EQ  +    G LSK++IE MV  AEKY  ED + K
Sbjct: 542 EQQIVIQSSGGLSKDDIENMVKNAEKYAEEDRRKK 576


>AK222628-1|BAD96348.1|  493|Homo sapiens heat shock 70kDa protein 8
           isoform 2 variant protein.
          Length = 493

 Score = 76.6 bits (180), Expect = 7e-14
 Identities = 36/43 (83%), Positives = 38/43 (88%), Gaps = 1/43 (2%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPA-PRGVP 172
           YSDNQPGVLIQV+EGERAMTKDNNLLGKFELTG+P   P G P
Sbjct: 431 YSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGMPGGMPGGFP 473


>AB034951-1|BAB18615.1|  493|Homo sapiens heat shock cognate protein
           54 protein.
          Length = 493

 Score = 76.6 bits (180), Expect = 7e-14
 Identities = 36/43 (83%), Positives = 38/43 (88%), Gaps = 1/43 (2%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPA-PRGVP 172
           YSDNQPGVLIQV+EGERAMTKDNNLLGKFELTG+P   P G P
Sbjct: 431 YSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGMPGGMPGGFP 473


>BC004279-1|AAH04279.1|  145|Homo sapiens Similar to heat shock 70kD
           protein 6 (HSP70B') protein.
          Length = 145

 Score = 56.0 bits (129), Expect = 1e-07
 Identities = 24/34 (70%), Positives = 31/34 (91%)
 Frame = +1

Query: 244 QGEQITITNDKGRLSKEEIERMVNEAEKYRNEDD 345
           +  +ITITNDKGRLSKEE+ERMV+EAE+Y+ ED+
Sbjct: 1   KANKITITNDKGRLSKEEVERMVHEAEQYKAEDE 34


>BC014608-1|AAH14608.1|  361|Homo sapiens spermatogenesis associated
           17 protein.
          Length = 361

 Score = 30.7 bits (66), Expect = 4.2
 Identities = 20/68 (29%), Positives = 35/68 (51%), Gaps = 1/68 (1%)
 Frame = +1

Query: 193 HRCQRYPQRFRYREVHQQGEQITITNDKGRLSKEEIERMVNEAEKYRN-EDDKAKGDHPG 369
           +R ++Y   F Y  + +  + ++ TND  R + EE   M    EK  N E ++ K D+  
Sbjct: 105 YRVRKY--LFNYYYLKEYLKVVSETNDAIRKALEEFAEMKEREEKKANLEREEKKRDYQA 162

Query: 370 PRMHWNLT 393
            +MH+ L+
Sbjct: 163 RKMHYLLS 170


>AY963797-1|AAY33662.1|  361|Homo sapiens spermatogenesis-related
           protein 11 protein.
          Length = 361

 Score = 30.7 bits (66), Expect = 4.2
 Identities = 20/68 (29%), Positives = 35/68 (51%), Gaps = 1/68 (1%)
 Frame = +1

Query: 193 HRCQRYPQRFRYREVHQQGEQITITNDKGRLSKEEIERMVNEAEKYRN-EDDKAKGDHPG 369
           +R ++Y   F Y  + +  + ++ TND  R + EE   M    EK  N E ++ K D+  
Sbjct: 105 YRVRKY--LFNYYYLKEYLKVVSETNDAIRKALEEFAEMKEREEKKANLEREEKKRDYQA 162

Query: 370 PRMHWNLT 393
            +MH+ L+
Sbjct: 163 RKMHYLLS 170


>AL445428-2|CAH70554.1|  361|Homo sapiens novel protein (FLJ25725)
           protein.
          Length = 361

 Score = 30.7 bits (66), Expect = 4.2
 Identities = 20/68 (29%), Positives = 35/68 (51%), Gaps = 1/68 (1%)
 Frame = +1

Query: 193 HRCQRYPQRFRYREVHQQGEQITITNDKGRLSKEEIERMVNEAEKYRN-EDDKAKGDHPG 369
           +R ++Y   F Y  + +  + ++ TND  R + EE   M    EK  N E ++ K D+  
Sbjct: 105 YRVRKY--LFNYYYLKEYLKVVSETNDAIRKALEEFAEMKEREEKKANLEREEKKRDYQA 162

Query: 370 PRMHWNLT 393
            +MH+ L+
Sbjct: 163 RKMHYLLS 170


>AL354659-3|CAH70665.1|  361|Homo sapiens novel protein (FLJ25725)
           protein.
          Length = 361

 Score = 30.7 bits (66), Expect = 4.2
 Identities = 20/68 (29%), Positives = 35/68 (51%), Gaps = 1/68 (1%)
 Frame = +1

Query: 193 HRCQRYPQRFRYREVHQQGEQITITNDKGRLSKEEIERMVNEAEKYRN-EDDKAKGDHPG 369
           +R ++Y   F Y  + +  + ++ TND  R + EE   M    EK  N E ++ K D+  
Sbjct: 105 YRVRKY--LFNYYYLKEYLKVVSETNDAIRKALEEFAEMKEREEKKANLEREEKKRDYQA 162

Query: 370 PRMHWNLT 393
            +MH+ L+
Sbjct: 163 RKMHYLLS 170


>AK098591-1|BAC05343.1|  361|Homo sapiens protein ( Homo sapiens
           cDNA FLJ25725 fis, clone TST05462. ).
          Length = 361

 Score = 30.7 bits (66), Expect = 4.2
 Identities = 20/68 (29%), Positives = 35/68 (51%), Gaps = 1/68 (1%)
 Frame = +1

Query: 193 HRCQRYPQRFRYREVHQQGEQITITNDKGRLSKEEIERMVNEAEKYRN-EDDKAKGDHPG 369
           +R ++Y   F Y  + +  + ++ TND  R + EE   M    EK  N E ++ K D+  
Sbjct: 105 YRVRKY--LFNYYYLKEYLKVVSETNDAIRKALEEFAEMKEREEKKANLEREEKKRDYQA 162

Query: 370 PRMHWNLT 393
            +MH+ L+
Sbjct: 163 RKMHYLLS 170


>M18112-1|AAA60137.1| 1014|Homo sapiens PPOL protein.
          Length = 1014

 Score = 29.5 bits (63), Expect = 9.8
 Identities = 11/30 (36%), Positives = 18/30 (60%)
 Frame = +3

Query: 483 VQHPPIQVDGISSPGWPSKEEYEHKAERIG 572
           ++HP +QVDG S   W  +++ +  AE  G
Sbjct: 64  IRHPDVQVDGFSELRWDDQQKVKKTAEAGG 93


>AL731535-1|CAI15257.1|  279|Homo sapiens family with sequence
           similarity 21, member C protein.
          Length = 279

 Score = 29.5 bits (63), Expect = 9.8
 Identities = 12/41 (29%), Positives = 23/41 (56%)
 Frame = +1

Query: 232 EVHQQGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDKAK 354
           E+ +  +  ++  D GR+  EE+E  V +AE  + E +K +
Sbjct: 27  EIRRSSQSWSLAADAGRVYDEEVEEPVLKAEAEKTEQEKTR 67


>AL645998-3|CAI16355.1|  279|Homo sapiens family with sequence
           similarity 21, member C protein.
          Length = 279

 Score = 29.5 bits (63), Expect = 9.8
 Identities = 12/41 (29%), Positives = 23/41 (56%)
 Frame = +1

Query: 232 EVHQQGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDKAK 354
           E+ +  +  ++  D GR+  EE+E  V +AE  + E +K +
Sbjct: 27  EIRRSSQSWSLAADAGRVYDEEVEEPVLKAEAEKTEQEKTR 67


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 98,904,244
Number of Sequences: 237096
Number of extensions: 2278700
Number of successful extensions: 7017
Number of sequences better than 10.0: 81
Number of HSP's better than 10.0 without gapping: 6568
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6940
length of database: 76,859,062
effective HSP length: 87
effective length of database: 56,231,710
effective search space used: 6522878360
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).