SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30012
         (706 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Y10351-1|CAA71377.1|  711|Homo sapiens nuclear protein SDK3 prot...    33   0.99 
U77718-1|AAB48304.1|  743|Homo sapiens pinin protein.                  33   0.99 
U59479-1|AAB03391.1|   99|Homo sapiens neutrophil protein protein.     33   0.99 
BC062602-1|AAH62602.1|  717|Homo sapiens pinin, desmosome associ...    33   0.99 
AF112222-1|AAF17209.1|  717|Homo sapiens nuclear protein SDK3 pr...    33   0.99 
AJ298318-1|CAC83675.1| 1349|Homo sapiens mucin 5 protein.              32   1.7  
Y09703-1|CAA70874.1|  586|Homo sapiens MEMA protein.                   31   3.0  
AK223612-1|BAD97332.1|  717|Homo sapiens pinin, desmosome associ...    31   3.0  
AC004653-1|AAC17116.1|  338|Homo sapiens AP-4 protein.                 31   5.3  
X85133-1|CAA59445.1|  948|Homo sapiens RB protein binding protei...    30   7.0  
AY072922-1|AAL68925.1| 1625|Homo sapiens p53-associated cellular...    30   7.0  
AF352051-1|AAL05625.1| 1616|Homo sapiens proliferation potential...    30   7.0  
AB112075-1|BAC77637.1| 1758|Homo sapiens retinoblastoma binding ...    30   7.0  
AB112074-1|BAC77636.1| 1792|Homo sapiens retinoblastoma binding ...    30   7.0  
AF195139-1|AAG33941.1|  717|Homo sapiens pinin protein.                30   9.3  

>Y10351-1|CAA71377.1|  711|Homo sapiens nuclear protein SDK3
           protein.
          Length = 711

 Score = 33.1 bits (72), Expect = 0.99
 Identities = 17/49 (34%), Positives = 29/49 (59%)
 Frame = -2

Query: 372 NRCRRQGRVHHRDRVHQKSVRRQGKCCLQKGHLGIQNDHHSNSSVSAAD 226
           +R R +GR H+RDR H++SV R+     ++   G++  H S+   S+ D
Sbjct: 625 SRSRSRGRGHNRDRKHRRSVDRK-----RRDTSGLERSHKSSKGGSSRD 668


>U77718-1|AAB48304.1|  743|Homo sapiens pinin protein.
          Length = 743

 Score = 33.1 bits (72), Expect = 0.99
 Identities = 17/49 (34%), Positives = 29/49 (59%)
 Frame = -2

Query: 372 NRCRRQGRVHHRDRVHQKSVRRQGKCCLQKGHLGIQNDHHSNSSVSAAD 226
           +R R +GR H+RDR H++SV R+     ++   G++  H S+   S+ D
Sbjct: 657 SRSRSRGRGHNRDRKHRRSVDRK-----RRDTSGLERSHKSSKGGSSRD 700


>U59479-1|AAB03391.1|   99|Homo sapiens neutrophil protein protein.
          Length = 99

 Score = 33.1 bits (72), Expect = 0.99
 Identities = 17/49 (34%), Positives = 29/49 (59%)
 Frame = -2

Query: 372 NRCRRQGRVHHRDRVHQKSVRRQGKCCLQKGHLGIQNDHHSNSSVSAAD 226
           +R R +GR H+RDR H++SV R+     ++   G++  H S+   S+ D
Sbjct: 13  SRSRSRGRGHNRDRKHRRSVDRK-----RRDTSGLERSHKSSKGGSSRD 56


>BC062602-1|AAH62602.1|  717|Homo sapiens pinin, desmosome
           associated protein protein.
          Length = 717

 Score = 33.1 bits (72), Expect = 0.99
 Identities = 17/49 (34%), Positives = 29/49 (59%)
 Frame = -2

Query: 372 NRCRRQGRVHHRDRVHQKSVRRQGKCCLQKGHLGIQNDHHSNSSVSAAD 226
           +R R +GR H+RDR H++SV R+     ++   G++  H S+   S+ D
Sbjct: 631 SRSRSRGRGHNRDRKHRRSVDRK-----RRDTSGLERSHKSSKGGSSRD 674


>AF112222-1|AAF17209.1|  717|Homo sapiens nuclear protein SDK3
           protein.
          Length = 717

 Score = 33.1 bits (72), Expect = 0.99
 Identities = 17/49 (34%), Positives = 29/49 (59%)
 Frame = -2

Query: 372 NRCRRQGRVHHRDRVHQKSVRRQGKCCLQKGHLGIQNDHHSNSSVSAAD 226
           +R R +GR H+RDR H++SV R+     ++   G++  H S+   S+ D
Sbjct: 631 SRSRSRGRGHNRDRKHRRSVDRK-----RRDTSGLERSHKSSKGGSSRD 674


>AJ298318-1|CAC83675.1| 1349|Homo sapiens mucin 5 protein.
          Length = 1349

 Score = 32.3 bits (70), Expect = 1.7
 Identities = 19/58 (32%), Positives = 28/58 (48%)
 Frame = -3

Query: 419 STRISATESSITSEAQTAAAAKGESTTETESIRRVSAAKGNAASRKAT*GSRMTTIAT 246
           ST  S T S+ ++   +  +A   STT T    + SAA  +  S   T  S +TT +T
Sbjct: 413 STTSSPTTSTTSATTTSTTSAPTSSTTSTPQTSKTSAATSSTTSSSGTTPSPVTTTST 470


>Y09703-1|CAA70874.1|  586|Homo sapiens MEMA protein.
          Length = 586

 Score = 31.5 bits (68), Expect = 3.0
 Identities = 16/49 (32%), Positives = 28/49 (57%)
 Frame = -2

Query: 372 NRCRRQGRVHHRDRVHQKSVRRQGKCCLQKGHLGIQNDHHSNSSVSAAD 226
           +R R +GR H+RDR H++SV R+     ++   G++  H S+    + D
Sbjct: 500 SRSRSRGRGHNRDRKHRRSVDRK-----RRDTSGLERSHKSSKGGGSRD 543


>AK223612-1|BAD97332.1|  717|Homo sapiens pinin, desmosome
           associated protein variant protein.
          Length = 717

 Score = 31.5 bits (68), Expect = 3.0
 Identities = 16/49 (32%), Positives = 28/49 (57%)
 Frame = -2

Query: 372 NRCRRQGRVHHRDRVHQKSVRRQGKCCLQKGHLGIQNDHHSNSSVSAAD 226
           +R R +GR H+RDR H++SV R+     ++   G++  H S+    + D
Sbjct: 631 SRSRSRGRGHNRDRKHRRSVDRK-----RRDTSGLERSHKSSKGGGSRD 674


>AC004653-1|AAC17116.1|  338|Homo sapiens AP-4 protein.
          Length = 338

 Score = 30.7 bits (66), Expect = 5.3
 Identities = 18/61 (29%), Positives = 28/61 (45%), Gaps = 1/61 (1%)
 Frame = +3

Query: 441 QKHIYVHV-PPPEPVEQRLPRIPGVAPPQKHYKIIFIKGPNSSHSYCPHNSYPTTKRRED 617
           Q+H+   + PPP P       +P   PP  H+  +   GP+S       NS  T+++  D
Sbjct: 216 QQHLRTQLLPPPAPTHHPTVIVPAPPPPPSHHINVVTMGPSS-----VINSVSTSRQNLD 270

Query: 618 T 620
           T
Sbjct: 271 T 271


>X85133-1|CAA59445.1|  948|Homo sapiens RB protein binding protein
           protein.
          Length = 948

 Score = 30.3 bits (65), Expect = 7.0
 Identities = 20/63 (31%), Positives = 29/63 (46%), Gaps = 3/63 (4%)
 Frame = +3

Query: 450 IYVHVPPPE---PVEQRLPRIPGVAPPQKHYKIIFIKGPNSSHSYCPHNSYPTTKRREDT 620
           ++V VPPP    P    LP  PGV PPQ   +    + P + +S  P   +P       T
Sbjct: 379 VFVPVPPPPLYPPPPHTLPLPPGVPPPQFSPQFPPGQPPPAGYS-VPPPGFPPAPANLST 437

Query: 621 PYM 629
           P++
Sbjct: 438 PWV 440


>AY072922-1|AAL68925.1| 1625|Homo sapiens p53-associated cellular
           protein PACT protein.
          Length = 1625

 Score = 30.3 bits (65), Expect = 7.0
 Identities = 20/63 (31%), Positives = 29/63 (46%), Gaps = 3/63 (4%)
 Frame = +3

Query: 450 IYVHVPPPE---PVEQRLPRIPGVAPPQKHYKIIFIKGPNSSHSYCPHNSYPTTKRREDT 620
           ++V VPPP    P    LP  PGV PPQ   +    + P + +S  P   +P       T
Sbjct: 422 VFVPVPPPPLYPPPPHTLPLPPGVPPPQFSPQFPPGQPPPAGYS-VPPPGFPPAPANLST 480

Query: 621 PYM 629
           P++
Sbjct: 481 PWV 483


>AF352051-1|AAL05625.1| 1616|Homo sapiens proliferation
           potential-related protein protein.
          Length = 1616

 Score = 30.3 bits (65), Expect = 7.0
 Identities = 20/63 (31%), Positives = 29/63 (46%), Gaps = 3/63 (4%)
 Frame = +3

Query: 450 IYVHVPPPE---PVEQRLPRIPGVAPPQKHYKIIFIKGPNSSHSYCPHNSYPTTKRREDT 620
           ++V VPPP    P    LP  PGV PPQ   +    + P + +S  P   +P       T
Sbjct: 379 VFVPVPPPPLYPPPPHTLPLPPGVPPPQFSPQFPPGQPPPAGYS-VPPPGFPPAPANLST 437

Query: 621 PYM 629
           P++
Sbjct: 438 PWV 440


>AB112075-1|BAC77637.1| 1758|Homo sapiens retinoblastoma binding
           protein 6 isoform 2 protein.
          Length = 1758

 Score = 30.3 bits (65), Expect = 7.0
 Identities = 20/63 (31%), Positives = 29/63 (46%), Gaps = 3/63 (4%)
 Frame = +3

Query: 450 IYVHVPPPE---PVEQRLPRIPGVAPPQKHYKIIFIKGPNSSHSYCPHNSYPTTKRREDT 620
           ++V VPPP    P    LP  PGV PPQ   +    + P + +S  P   +P       T
Sbjct: 555 VFVPVPPPPLYPPPPHTLPLPPGVPPPQFSPQFPPGQPPPAGYS-VPPPGFPPAPANLST 613

Query: 621 PYM 629
           P++
Sbjct: 614 PWV 616


>AB112074-1|BAC77636.1| 1792|Homo sapiens retinoblastoma binding
           protein 6 isoform 1 protein.
          Length = 1792

 Score = 30.3 bits (65), Expect = 7.0
 Identities = 20/63 (31%), Positives = 29/63 (46%), Gaps = 3/63 (4%)
 Frame = +3

Query: 450 IYVHVPPPE---PVEQRLPRIPGVAPPQKHYKIIFIKGPNSSHSYCPHNSYPTTKRREDT 620
           ++V VPPP    P    LP  PGV PPQ   +    + P + +S  P   +P       T
Sbjct: 555 VFVPVPPPPLYPPPPHTLPLPPGVPPPQFSPQFPPGQPPPAGYS-VPPPGFPPAPANLST 613

Query: 621 PYM 629
           P++
Sbjct: 614 PWV 616


>AF195139-1|AAG33941.1|  717|Homo sapiens pinin protein.
          Length = 717

 Score = 29.9 bits (64), Expect = 9.3
 Identities = 12/23 (52%), Positives = 18/23 (78%)
 Frame = -2

Query: 372 NRCRRQGRVHHRDRVHQKSVRRQ 304
           +R R +GR H+RDR H++SV R+
Sbjct: 631 SRSRSRGRGHNRDRKHRRSVDRK 653


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 83,549,879
Number of Sequences: 237096
Number of extensions: 1495131
Number of successful extensions: 4840
Number of sequences better than 10.0: 15
Number of HSP's better than 10.0 without gapping: 4500
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4833
length of database: 76,859,062
effective HSP length: 88
effective length of database: 55,994,614
effective search space used: 8175213644
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).