SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30011
         (766 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

X79536-1|CAA56072.1|  320|Homo sapiens hnRNPcore protein A1 prot...   122   1e-27
X12671-1|CAA31191.1|  320|Homo sapiens hnrnp a1 protein protein.      122   1e-27
X06747-1|CAA29922.1|  320|Homo sapiens protein ( Human hnRNP cor...   122   1e-27
BC121133-1|AAI21134.1|  320|Homo sapiens heterogeneous nuclear r...   122   1e-27
BC103707-1|AAI03708.1|  267|Homo sapiens HNRPA1 protein protein.      122   1e-27
BC074502-1|AAH74502.1|  320|Homo sapiens heterogeneous nuclear r...   122   1e-27
BC073162-1|AAH73162.1|  320|Homo sapiens heterogeneous nuclear r...   122   1e-27
BC071945-1|AAH71945.1|  320|Homo sapiens heterogeneous nuclear r...   122   1e-27
BC070315-1|AAH70315.1|  320|Homo sapiens HNRPA1 protein protein.      122   1e-27
BC052296-1|AAH52296.1|  320|Homo sapiens heterogeneous nuclear r...   122   1e-27
BC033714-1|AAH33714.1|  320|Homo sapiens heterogeneous nuclear r...   122   1e-27
BC012158-1|AAH12158.1|  320|Homo sapiens heterogeneous nuclear r...   122   1e-27
BC009600-1|AAH09600.1|  320|Homo sapiens heterogeneous nuclear r...   122   1e-27
BC004945-1|AAH04945.1|  298|Homo sapiens Unknown (protein for IM...   122   1e-27
BC002355-1|AAH02355.1|  320|Homo sapiens heterogeneous nuclear r...   122   1e-27
BC108266-1|AAI08267.1|  320|Homo sapiens heterogeneous nuclear r...   120   4e-27
AL137058-3|CAI16736.1|  320|Homo sapiens protein ( Human DNA seq...   120   4e-27
BC113470-1|AAI13471.1|  378|Homo sapiens LOC653115 protein protein.   117   5e-26
BC112027-1|AAI12028.1|  378|Homo sapiens heterogeneous nuclear r...   117   5e-26
AY363225-1|AAQ63629.1|  378|Homo sapiens heterogeneous nuclear r...   117   5e-26
AC079305-1|AAY14709.1|  378|Homo sapiens unknown protein.             117   5e-26
U09123-1|AAB60650.1|  341|Homo sapiens hnRNP protein A2 protein.      115   2e-25
M29065-1|AAA36574.1|  341|Homo sapiens protein ( Human hnRNP A2 ...   115   2e-25
M29064-1|AAA60271.1|  353|Homo sapiens SNRPB1 protein.                115   2e-25
D28877-2|BAA06032.1|  341|Homo sapiens hnRNP A2 protein protein.      115   2e-25
D28877-1|BAA06031.1|  353|Homo sapiens hnRNP B1 protein protein.      115   2e-25
BC000506-1|AAH00506.3|  249|Homo sapiens HNRPA2B1 protein protein.    115   2e-25
S63912-1|AAB27595.1|  269|Homo sapiens FBRNP protein.                 109   1e-23
U23803-1|AAA65094.1|  305|Homo sapiens heterogeneous ribonucleop...    96   1e-19
CR456986-1|CAG33267.1|  305|Homo sapiens HNRPA0 protein.               96   1e-19
BC030249-1|AAH30249.1|  305|Homo sapiens heterogeneous nuclear r...    96   1e-19
BC028976-1|AAH28976.1|  305|Homo sapiens heterogeneous nuclear r...    96   1e-19
BC019271-1|AAH19271.1|  305|Homo sapiens heterogeneous nuclear r...    96   1e-19
BC018949-1|AAH18949.1|  305|Homo sapiens heterogeneous nuclear r...    96   1e-19
BC012980-1|AAH12980.1|  305|Homo sapiens heterogeneous nuclear r...    96   1e-19
BC011972-1|AAH11972.1|  305|Homo sapiens heterogeneous nuclear r...    96   1e-19
BC009284-1|AAH09284.1|  305|Homo sapiens heterogeneous nuclear r...    96   1e-19
BC007271-1|AAH07271.1|  305|Homo sapiens heterogeneous nuclear r...    96   1e-19
BC001008-1|AAH01008.1|  305|Homo sapiens heterogeneous nuclear r...    96   1e-19
BC001526-1|AAH01526.1|  328|Homo sapiens musashi homolog 2 (Dros...    74   5e-13
AK093888-1|BAC04244.1|  251|Homo sapiens protein ( Homo sapiens ...    74   5e-13
U02019-1|AAC50056.1|  286|Homo sapiens p37 AUF1 protein.               74   6e-13
M94630-1|AAA35781.1|  328|Homo sapiens DNA-binding protein protein.    74   6e-13
D55674-1|BAA09525.1|  355|Homo sapiens heterogeneous nuclear rib...    74   6e-13
D55673-1|BAA09524.1|  215|Homo sapiens heterogeneous nuclear rib...    74   6e-13
D55672-1|BAA09523.1|  306|Homo sapiens heterogeneous nuclear rib...    74   6e-13
D55671-1|BAA09522.1|  267|Homo sapiens heterogeneous nuclear rib...    74   6e-13
BC026015-1|AAH26015.1|  306|Homo sapiens heterogeneous nuclear r...    74   6e-13
BC023977-1|AAH23977.1|  306|Homo sapiens heterogeneous nuclear r...    74   6e-13
BC002401-1|AAH02401.1|  355|Homo sapiens heterogeneous nuclear r...    74   6e-13
AF039575-1|AAB96683.1|  298|Homo sapiens heterogeneous nuclear r...    74   6e-13
AF026126-3|AAC23476.1|  336|Homo sapiens heterogeneous nuclear r...    74   6e-13
AF026126-2|AAC23475.1|  306|Homo sapiens heterogeneous nuclear r...    74   6e-13
AF026126-1|AAC23474.1|  355|Homo sapiens heterogeneous nuclear r...    74   6e-13
AC124016-1|AAY40913.1|  355|Homo sapiens unknown protein.              74   6e-13
D89678-1|BAA22860.1|  271|Homo sapiens A+U-rich element RNA bind...    72   2e-12
D89092-1|BAA24361.1|  301|Homo sapiens hnRNP JKTBP protein.            72   2e-12
CR407623-1|CAG28551.1|  420|Homo sapiens HNRPDL protein.               72   2e-12
BC071944-1|AAH71944.1|  420|Homo sapiens heterogeneous nuclear r...    72   2e-12
BC036708-1|AAH36708.1|  332|Homo sapiens heterogeneous nuclear r...    72   2e-12
BC011714-1|AAH11714.1|  420|Homo sapiens heterogeneous nuclear r...    72   2e-12
BC009359-1|AAH09359.1|  285|Homo sapiens heterogeneous nuclear r...    72   2e-12
BC007392-1|AAH07392.2|  415|Homo sapiens HNRPDL protein protein.       72   2e-12
BC004561-1|AAH04561.1|  285|Homo sapiens heterogeneous nuclear r...    72   2e-12
BC002625-1|AAH02625.1|  285|Homo sapiens heterogeneous nuclear r...    72   2e-12
BC001616-1|AAH01616.1|  285|Homo sapiens heterogeneous nuclear r...    72   2e-12
AY453824-1|AAR17782.1|  298|Homo sapiens CArG binding factor pro...    72   2e-12
AK223425-1|BAD97145.1|  332|Homo sapiens heterogeneous nuclear r...    72   2e-12
AK097657-1|BAC05134.1|  332|Homo sapiens protein ( Homo sapiens ...    72   2e-12
AC124016-2|AAY40914.1|  420|Homo sapiens unknown protein.              72   2e-12
AB066484-1|BAB62188.1|  244|Homo sapiens JKTBP1delta6 protein.         72   2e-12
AB017019-1|BAA75241.1|  420|Homo sapiens JKTBP2 protein.               72   2e-12
AB017018-2|BAA75240.1|  301|Homo sapiens JKTBP1 protein.               72   2e-12
AB017018-1|BAA75239.1|  420|Homo sapiens JKTBP2 protein.               72   2e-12
AC003982-3|AAB95636.1|  362|Homo sapiens WUGSC:H_166H1.2 protein.      72   3e-12
AB012851-1|BAA33962.1|  362|Homo sapiens Musashi protein.              72   3e-12
U76713-1|AAC50956.1|  331|Homo sapiens ABBP-1 protein.                 70   1e-11
M65028-1|AAA36575.1|  284|Homo sapiens hnRNP type A/B protein pr...    70   1e-11
BC012062-1|AAH12062.1|  407|Homo sapiens DAZ associated protein ...    64   7e-10
AY678451-1|AAV97647.1|  454|Homo sapiens DAZAP1/MEF2D fusion pro...    64   7e-10
AF181719-1|AAF78364.1|  407|Homo sapiens DAZ associated protein ...    63   9e-10
AL354775-1|CAI12730.1|  276|Homo sapiens protein ( Human DNA seq...    61   5e-09
X04347-1|CAA27874.1|  196|Homo sapiens protein ( Human liver mRN...    56   1e-07
AK056850-1|BAB71295.1|  289|Homo sapiens protein ( Homo sapiens ...    54   6e-07
U23731-1|AAA70033.1|  414|Homo sapiens TAR DNA-binding protein-4...    53   1e-06
EF434182-1|ABO32291.1|  414|Homo sapiens TDP43 splice variant 1 ...    53   1e-06
EF434181-1|ABO32290.1|  416|Homo sapiens TDP43 protein.                53   1e-06
CR533534-1|CAG38565.1|  414|Homo sapiens TARDBP protein.               53   1e-06
BC095435-1|AAH95435.1|  414|Homo sapiens TAR DNA binding protein...    53   1e-06
BC071657-1|AAH71657.1|  414|Homo sapiens TARDBP protein protein.       53   1e-06
AL109811-2|CAI22099.1|  295|Homo sapiens TAR DNA binding protein...    53   1e-06
AL109811-1|CAI22098.1|  414|Homo sapiens TAR DNA binding protein...    53   1e-06
AK222754-1|BAD96474.1|  414|Homo sapiens TAR DNA binding protein...    53   1e-06
AY547318-1|AAS55633.1|  236|Homo sapiens unknown protein.              52   2e-06
AL136305-1|CAC36889.1|  236|Homo sapiens protein ( Human DNA seq...    52   2e-06
AK095016-1|BAC04474.1|  211|Homo sapiens protein ( Homo sapiens ...    52   2e-06
X75315-1|CAA53064.1|  230|Homo sapiens SEB4B protein.                  52   2e-06
X75314-1|CAA53063.1|  229|Homo sapiens SEB4D protein.                  52   2e-06
BC018711-1|AAH18711.1|  216|Homo sapiens RBM38 protein protein.        52   2e-06
AF432218-1|AAL99924.1|  216|Homo sapiens CLL-associated antigen ...    52   2e-06
AB073212-1|BAB70469.1|  179|Homo sapiens Musashi1 protein.             51   4e-06
AB072592-1|BAB69769.1|  181|Homo sapiens Musashi1 protein.             51   4e-06
AB072591-1|BAB69768.1|  181|Homo sapiens Musashi1 protein.             51   4e-06
AB072590-1|BAB69767.1|  180|Homo sapiens Musashi1 protein.             51   4e-06
BC017560-1|AAH17560.1|  151|Homo sapiens MSI2 protein protein.         50   7e-06
BC011731-1|AAH11731.1|  449|Homo sapiens GTPase activating prote...    48   5e-05
AF145284-1|AAD51932.1|  482|Homo sapiens RNA-binding protein iso...    48   5e-05
AF053535-1|AAC95292.1|  449|Homo sapiens ras-GAP/RNA binding pro...    48   5e-05
AB014560-1|BAA31635.2|  490|Homo sapiens KIAA0660 protein protein.     48   5e-05
AF051311-1|AAC15705.1|  449|Homo sapiens Ras-GAP SH3 binding pro...    47   8e-05
AK128423-1|BAC87434.1|  135|Homo sapiens protein ( Homo sapiens ...    46   1e-04
Z23064-1|CAA80599.1|  391|Homo sapiens hnRNP G protein protein.        45   3e-04
BC007435-1|AAH07435.1|  391|Homo sapiens RNA binding motif prote...    45   3e-04
BC006550-1|AAH06550.1|  391|Homo sapiens RNA binding motif prote...    45   3e-04
AY464692-1|AAR28036.1|  391|Homo sapiens heterogeneous nuclear r...    45   3e-04
AL683813-6|CAI39448.1|  391|Homo sapiens RNA binding motif prote...    45   3e-04
AF266723-1|AAK58567.1|  391|Homo sapiens RBMX protein.                 45   3e-04
Z48501-1|CAA88401.1|  522|Homo sapiens polyadenylate binding pro...    45   3e-04
U68104-1|AAD08718.1|  636|Homo sapiens poly(A)-binding protein p...    45   3e-04
DQ120640-1|ABB92425.1|  630|Homo sapiens PABP3 protein.                45   3e-04
BC045608-1|AAH45608.1|  631|Homo sapiens poly(A) binding protein...    45   3e-04
BC041863-1|AAH41863.1|  636|Homo sapiens poly(A) binding protein...    45   3e-04
BC027617-1|AAH27617.1|  631|Homo sapiens poly(A) binding protein...    45   3e-04
BC023520-1|AAH23520.1|  636|Homo sapiens poly(A) binding protein...    45   3e-04
BC015958-1|AAH15958.1|  636|Homo sapiens PABPC1 protein protein.       45   3e-04
AL359757-1|CAH70805.1|  631|Homo sapiens poly(A) binding protein...    45   3e-04
AF132026-1|AAG38953.1|  631|Homo sapiens testis-specific poly(A)...    45   3e-04
D78134-1|BAA11212.1|  172|Homo sapiens CIRP protein.                   44   5e-04
BT007210-1|AAP35874.1|  172|Homo sapiens cold inducible RNA bind...    44   5e-04
BC028239-1|AAH28239.1|  616|Homo sapiens cleavage stimulation fa...    44   5e-04
BC000901-1|AAH00901.1|  172|Homo sapiens cold inducible RNA bind...    44   5e-04
BC000403-1|AAH00403.1|  172|Homo sapiens cold inducible RNA bind...    44   5e-04
AY130299-1|AAN05429.1|  616|Homo sapiens tCstF-64 protein.             44   5e-04
AK222574-1|BAD96294.1|  616|Homo sapiens cleavage stimulation fa...    44   5e-04
AF021336-1|AAC51787.1|  172|Homo sapiens DNA damage-inducible RN...    44   5e-04
AC004258-1|AAC04895.1|  172|Homo sapiens CIRP protein.                 44   5e-04
U53209-1|AAC50658.1|  282|Homo sapiens transformer-2 alpha protein.    44   6e-04
BC017094-1|AAH17094.1|  282|Homo sapiens transformer-2 alpha pro...    44   6e-04
AC023105-1|AAQ96870.1|  282|Homo sapiens unknown protein.              44   6e-04
AB097048-1|BAC77401.1|  282|Homo sapiens putative MAPK activatin...    44   6e-04
X03910-1|CAA27544.1|  225|Homo sapiens protein ( Human mRNA for ...    44   8e-04
U68063-1|AAB08701.1|  288|Homo sapiens transformer-2 beta protein.     44   8e-04
U61267-1|AAC28242.1|  288|Homo sapiens htra2-beta protein.             44   8e-04
DQ120650-1|ABB92435.1|  384|Homo sapiens RBM1 protein.                 44   8e-04
BC012942-1|AAH12942.1|  390|Homo sapiens RNA binding motif prote...    44   8e-04
BC005898-1|AAH05898.1|  288|Homo sapiens splicing factor, argini...    44   8e-04
BC000451-1|AAH00451.1|  288|Homo sapiens splicing factor, argini...    44   8e-04
BC000160-1|AAH00160.1|  288|Homo sapiens splicing factor, argini...    44   8e-04
AL139416-3|CAI21694.1|  159|Homo sapiens RNA binding motif prote...    44   8e-04
AL139416-2|CAI21693.1|  390|Homo sapiens RNA binding motif prote...    44   8e-04
AK098191-1|BAC05256.1|  252|Homo sapiens protein ( Homo sapiens ...    44   8e-04
AF057159-3|AAD19278.1|  188|Homo sapiens transformer-2-beta isof...    44   8e-04
AF057159-1|AAD19277.1|  288|Homo sapiens transformer-2-beta isof...    44   8e-04
AB209208-1|BAD92445.1|  278|Homo sapiens splicing factor, argini...    44   8e-04
Z95327-4|CAI42681.1|  225|Homo sapiens cleavage stimulation fact...    43   0.001
Z95327-3|CAI42680.1|  577|Homo sapiens cleavage stimulation fact...    43   0.001
Z83819-6|CAB06072.2|  577|Homo sapiens cleavage stimulation fact...    43   0.001
M85085-1|AAA35724.1|  577|Homo sapiens cleavage stimulation fact...    43   0.001
L10911-1|AAA16347.1|  530|Homo sapiens splicing factor protein.        43   0.001
L10910-1|AAA16346.1|  524|Homo sapiens splicing factor protein.        43   0.001
BX537770-1|CAD97833.1|  373|Homo sapiens hypothetical protein pr...    43   0.001
BT009778-1|AAP88780.1|  577|Homo sapiens cleavage stimulation fa...    43   0.001
BC141835-1|AAI41836.1|  530|Homo sapiens RNA binding motif prote...    43   0.001
BC131543-1|AAI31544.1|  508|Homo sapiens RBM39 protein protein.        43   0.001
BC033135-1|AAH33135.1|  559|Homo sapiens Similar to cleavage sti...    43   0.001
BC017895-1|AAH17895.1|  109|Homo sapiens chromosome 14 open read...    43   0.001
BC017712-1|AAH17712.1|  577|Homo sapiens cleavage stimulation fa...    43   0.001
AY860853-1|AAX58600.1|  109|Homo sapiens SRA stem-loop-interacti...    43   0.001
AL357374-9|CAC11119.1|  524|Homo sapiens RNA binding motif prote...    43   0.001
AL357374-8|CAC11118.1|  530|Homo sapiens RNA binding motif prote...    43   0.001
AJ272055-1|CAC81241.1|  109|Homo sapiens hypothetical protein pr...    43   0.001
AF271779-1|AAG44790.1|  109|Homo sapiens DC50 protein.                 43   0.001
AF253980-1|AAG44629.1|  109|Homo sapiens DC23 protein.                 43   0.001
U28686-1|AAB17212.1|  157|Homo sapiens RNPL protein.                   42   0.002
BC006825-1|AAH06825.1|  157|Homo sapiens RNA binding motif (RNP1...    42   0.002
AY675556-1|AAV91783.1|  474|Homo sapiens myocyte enhancer factor...    42   0.002
AF087905-1|AAP97203.1|  425|Homo sapiens splicing factor SF2 pro...    42   0.002
U75686-1|AAB97309.1|  644|Homo sapiens polyadenylate binding pro...    41   0.004
U33818-1|AAC50350.1|  644|Homo sapiens inducible poly(A)-binding...    41   0.004
D12799-1|BAA02244.1|  193|Homo sapiens polyadenylate binding pro...    41   0.004
DQ351905-1|ABC73063.1|  595|Homo sapiens heterogeneous nuclear r...    41   0.004
BX640912-1|CAE45953.1|  613|Homo sapiens hypothetical protein pr...    41   0.004
BC110389-1|AAI10390.1|  607|Homo sapiens HNRPR protein protein.        41   0.004
BC094755-1|AAH94755.1|  660|Homo sapiens PABPC4 protein protein.       41   0.004
BC071591-1|AAH71591.1|  660|Homo sapiens PABPC4 protein protein.       41   0.004
BC065540-1|AAH65540.1|  631|Homo sapiens PABPC4 protein protein.       41   0.004
BC057796-1|AAH57796.1|  392|Homo sapiens RNA binding motif prote...    41   0.004
BC001449-1|AAH01449.1|  636|Homo sapiens HNRPR protein protein.        41   0.004
AL845289-3|CAI12300.1|  644|Homo sapiens poly(A) binding protein...    41   0.004
AL845289-2|CAI12298.1|  660|Homo sapiens poly(A) binding protein...    41   0.004
AL845289-1|CAI12299.1|  615|Homo sapiens poly(A) binding protein...    41   0.004
AL365277-4|CAI16414.1|  644|Homo sapiens poly(A) binding protein...    41   0.004
AL365277-3|CAI16412.1|  660|Homo sapiens poly(A) binding protein...    41   0.004
AL365277-2|CAI16413.1|  615|Homo sapiens poly(A) binding protein...    41   0.004
AL109936-4|CAI19027.1|  636|Homo sapiens heterogeneous nuclear r...    41   0.004
AL109936-3|CAI19026.1|  633|Homo sapiens heterogeneous nuclear r...    41   0.004
AF069682-1|AAC24858.2|  392|Homo sapiens testes specific heterog...    41   0.004
AF000364-1|AAC39540.1|  633|Homo sapiens heterogeneous nuclear r...    41   0.004
BC024208-1|AAH24208.1|  423|Homo sapiens RNA binding motif prote...    40   0.007
BC002566-1|AAH02566.1|  424|Homo sapiens RNA binding motif prote...    40   0.007
AL357374-11|CAI13608.1|  202|Homo sapiens RNA binding motif prot...    40   0.007
AL357374-10|CAI13606.1|  231|Homo sapiens RNA binding motif prot...    40   0.007
AL357374-7|CAI13605.1|  336|Homo sapiens RNA binding motif prote...    40   0.007
AK001344-1|BAA91638.1|  406|Homo sapiens protein ( Homo sapiens ...    40   0.007
AF275678-1|AAG24388.1|  418|Homo sapiens PP239 protein protein.        40   0.007
U32519-1|AAB07787.1|  466|Homo sapiens GAP SH3 binding protein p...    40   0.010
CR536535-1|CAG38772.1|  466|Homo sapiens G3BP protein.                 40   0.010
BT019384-1|AAV38191.1|  466|Homo sapiens Ras-GTPase-activating p...    40   0.010
BC006997-1|AAH06997.1|  466|Homo sapiens GTPase activating prote...    40   0.010
AK222606-1|BAD96326.1|  466|Homo sapiens Ras-GTPase-activating p...    40   0.010
AK130003-1|BAC85272.1|  307|Homo sapiens protein ( Homo sapiens ...    40   0.010
BC105582-1|AAI05583.1|  173|Homo sapiens RBMX2 protein protein.        40   0.013
BC033750-1|AAH33750.1|  322|Homo sapiens RNA binding motif prote...    40   0.013
BC031682-1|AAH31682.1|  450|Homo sapiens RBM42 protein protein.        40   0.013
BC004204-1|AAH04204.1|  480|Homo sapiens hypothetical protein MG...    40   0.013
BC003676-1|AAH03676.1|  163|Homo sapiens Unknown (protein for IM...    40   0.013
BC002868-1|AAH02868.1|  451|Homo sapiens MGC10433 protein protein.     40   0.013
AL050405-1|CAB43745.1|  322|Homo sapiens hypothetical protein pr...    40   0.013
AL035423-8|CAI42444.1|  322|Homo sapiens RNA binding motif prote...    40   0.013
AF279289-1|AAF82129.1|  386|Homo sapiens testes-specific heterog...    40   0.013
AF151837-1|AAD34074.1|  351|Homo sapiens CGI-79 protein protein.       40   0.013
AC002115-1|AAB57629.1|  339|Homo sapiens F25451_2 protein.             40   0.013
BC047522-1|AAH47522.1|  402|Homo sapiens BRUNOL5 protein protein.      39   0.017
M62843-1|AAA58396.1|  380|Homo sapiens brain protein protein.          39   0.023
AY033998-1|AAK57541.1|  380|Homo sapiens HUDPRO1 protein.              39   0.023
AY033997-1|AAK57540.1|  366|Homo sapiens HUD1 protein.                 39   0.023
AY033996-1|AAK57539.1|  383|Homo sapiens HUD4 protein.                 39   0.023
AY033995-1|AAK57538.1|  366|Homo sapiens HUD3 protein.                 39   0.023
AL592182-6|CAI15792.1|  385|Homo sapiens ELAV (embryonic lethal,...    39   0.023
AL592182-5|CAI15793.1|  371|Homo sapiens ELAV (embryonic lethal,...    39   0.023
AL592182-4|CAI15791.1|  380|Homo sapiens ELAV (embryonic lethal,...    39   0.023
AL592182-3|CAI15790.1|  366|Homo sapiens ELAV (embryonic lethal,...    39   0.023
AL592182-2|CAI15789.1|  383|Homo sapiens ELAV (embryonic lethal,...    39   0.023
AL592182-1|CAI15788.1|  366|Homo sapiens ELAV (embryonic lethal,...    39   0.023
AL583843-6|CAI14638.1|  385|Homo sapiens ELAV (embryonic lethal,...    39   0.023
AL583843-5|CAI14639.1|  371|Homo sapiens ELAV (embryonic lethal,...    39   0.023
AL583843-4|CAI14637.1|  380|Homo sapiens ELAV (embryonic lethal,...    39   0.023
AL583843-3|CAI14636.1|  366|Homo sapiens ELAV (embryonic lethal,...    39   0.023
AL583843-2|CAI14635.1|  383|Homo sapiens ELAV (embryonic lethal,...    39   0.023
AL583843-1|CAI14634.1|  366|Homo sapiens ELAV (embryonic lethal,...    39   0.023
U63289-1|AAC50895.1|  482|Homo sapiens CUG-BP/hNab50 protein.          38   0.030
U29943-1|AAA70417.1|  346|Homo sapiens Hel-N2 protein.                 38   0.030
U12431-1|AAA69698.1|  359|Homo sapiens ELAV-like neuronal protei...    38   0.030
BC031079-1|AAH31079.1|  483|Homo sapiens CUG triplet repeat, RNA...    38   0.030
BC030692-1|AAH30692.1|  346|Homo sapiens ELAVL2 protein protein.       38   0.030
AL161628-4|CAI13378.1|  387|Homo sapiens ELAV (embryonic lethal,...    38   0.030
AL161628-3|CAI13377.1|  189|Homo sapiens ELAV (embryonic lethal,...    38   0.030
AL161628-2|CAC22160.1|  359|Homo sapiens ELAV (embryonic lethal,...    38   0.030
AL161628-1|CAI13376.1|  346|Homo sapiens ELAV (embryonic lethal,...    38   0.030
AL109839-2|CAI95632.1|  330|Homo sapiens chromosome 20 open read...    38   0.030
AL109839-1|CAI95631.1|  614|Homo sapiens chromosome 20 open read...    38   0.030
AL008725-5|CAI95663.1|  330|Homo sapiens chromosome 20 open read...    38   0.030
AL008725-4|CAI95662.1|  614|Homo sapiens chromosome 20 open read...    38   0.030
AJ007988-1|CAC20566.1|  486|Homo sapiens deadenylation factor CU...    38   0.030
AF267534-1|AAF78956.1|  483|Homo sapiens CUG-binding protein A i...    38   0.030
AF267533-1|AAF78955.1|  486|Homo sapiens CUG-binding protein LYL...    38   0.030
AF248648-1|AAF86230.1|  486|Homo sapiens RNA-binding protein BRU...    38   0.030
AB210019-1|BAE06101.1|  544|Homo sapiens CUGBP1 variant protein ...    38   0.030
AB209294-1|BAD92531.1|  367|Homo sapiens ELAV (embryonic lethal,...    38   0.030
Y00345-1|CAA68428.1|  633|Homo sapiens protein ( Human mRNA for ...    38   0.039
L26405-1|AAA58677.1|  359|Homo sapiens huc protein.                    38   0.039
D26158-1|BAA21838.1|  350|Homo sapiens PLE21 protein protein.          38   0.039
CR457257-1|CAG33538.1|  423|Homo sapiens RNPC4 protein.                38   0.039
BC029451-1|AAH29451.1|  425|Homo sapiens RNA binding motif prote...    38   0.039
BC014144-1|AAH14144.1|  367|Homo sapiens ELAVL3 protein protein.       38   0.039
AY036909-1|AAK67714.1|  360|Homo sapiens HUC protein.                  38   0.039
AY034002-1|AAK57545.1|  318|Homo sapiens Hu antigen C long protein.    38   0.039
AL732292-3|CAM28277.1|  408|Homo sapiens novel protein protein.        38   0.039
AL732292-2|CAI21936.1|  430|Homo sapiens RNA binding motif prote...    38   0.039
AL133418-4|CAM28326.1|  408|Homo sapiens novel protein protein.        38   0.039
AL133418-3|CAI22960.1|  430|Homo sapiens RNA binding motif prote...    38   0.039
U69546-1|AAB09040.1|  490|Homo sapiens RNA-binding protein BRUNO...    38   0.052
BC118568-1|AAI18569.1|  252|Homo sapiens PABPC4 protein protein.       38   0.052
BC108278-1|AAI08279.1|  466|Homo sapiens GTPase activating prote...    38   0.052
BC106908-1|AAI06909.1|  281|Homo sapiens PABPC4 protein protein.       38   0.052
BC066549-1|AAH66549.1|  474|Homo sapiens RNA binding motif prote...    38   0.052
BC037837-1|AAH37837.2|  248|Homo sapiens Unknown (protein for MG...    38   0.052
BC028101-1|AAH28101.1|  485|Homo sapiens bruno-like 5, RNA bindi...    38   0.052
BC022543-1|AAH22543.1|  217|Homo sapiens zinc finger CCHC-type a...    38   0.052
BC010177-1|AAH10177.1|  140|Homo sapiens ZCRB1 protein protein.        38   0.052
BC005099-1|AAH05099.1|  141|Homo sapiens Unknown (protein for IM...    38   0.052
AL365277-15|CAI16425.1|  410|Homo sapiens poly(A) binding protei...    38   0.052
AK222917-1|BAD96637.1|  371|Homo sapiens PABPC4 protein variant ...    38   0.052
AF526533-1|AAM88417.1|  328|Homo sapiens putative RNA binding pr...    38   0.052
AF329266-1|AAK07476.1|  481|Homo sapiens CUG-BP and ETR-3 like f...    38   0.052
AF248649-1|AAF86231.1|   83|Homo sapiens RNA-binding protein BRU...    38   0.052
AF090694-1|AAD13761.1|  509|Homo sapiens apoptosis-related RNA b...    38   0.052
AB209067-1|BAD92304.1|  421|Homo sapiens bruno-like 5, RNA bindi...    38   0.052
AB208962-1|BAD92199.1|  358|Homo sapiens PABPC4 protein variant ...    38   0.052
AB062361-1|BAB56132.1|  217|Homo sapiens ZCRB1 protein protein.        38   0.052
AB036991-1|BAC16207.1|  476|Homo sapiens developmentally regulat...    38   0.052
U51586-1|AAB41656.1|  541|Homo sapiens siah binding protein 1 pr...    37   0.069
M96954-1|AAA36384.1|  375|Homo sapiens nucleolysin TIAR protein.       37   0.069
D64015-1|BAA21559.1|  265|Homo sapiens T-cluster binding protein...    37   0.069
CR457143-1|CAG33424.1|  559|Homo sapiens SIAHBP1 protein.              37   0.069
BC063113-1|AAH63113.1|  382|Homo sapiens poly(A) binding protein...    37   0.069
BC036391-1|AAH36391.1|  521|Homo sapiens CUGBP2 protein protein.       37   0.069
BC024238-1|AAH24238.1|  293|Homo sapiens MKI67 (FHA domain) inte...    37   0.069
BC022990-1|AAH22990.1|  293|Homo sapiens MKI67 (FHA domain) inte...    37   0.069
BC011979-1|AAH11979.1|  516|Homo sapiens SIAHBP1 protein protein.      37   0.069
BC011265-1|AAH11265.1|  516|Homo sapiens SIAHBP1 protein protein.      37   0.069
BC009734-1|AAH09734.1|  499|Homo sapiens SIAHBP1 protein protein.      37   0.069
BC008875-1|AAH08875.1|  542|Homo sapiens fuse-binding protein-in...    37   0.069
AY633610-1|AAV33303.1|  374|Homo sapiens aging-associated gene 7...    37   0.069
AL662874-3|CAI41476.1|  218|Homo sapiens poly(A) binding protein...    37   0.069
AL662874-2|CAI41475.1|  382|Homo sapiens poly(A) binding protein...    37   0.069
AL157704-2|CAH70230.1|  490|Homo sapiens CUG triplet repeat, RNA...    37   0.069
AL157704-1|CAH70231.1|  498|Homo sapiens CUG triplet repeat, RNA...    37   0.069
AL136320-2|CAI20169.1|  490|Homo sapiens CUG triplet repeat, RNA...    37   0.069
AL136320-1|CAI20168.1|  498|Homo sapiens CUG triplet repeat, RNA...    37   0.069
AL122118-1|CAB59276.1|  367|Homo sapiens hypothetical protein pr...    37   0.069
AJ278963-1|CAC42826.1|  382|Homo sapiens Poly(A)-binding protein...    37   0.069
AF432906-1|AAL27627.1|  488|Homo sapiens neuroblastoma apoptosis...    37   0.069
AF295068-3|AAK72223.1|  484|Homo sapiens neuroplastoma apoptosis...    37   0.069
AF295068-2|AAK92699.1|  490|Homo sapiens neuroplastoma apoptosis...    37   0.069
AF295068-1|AAK72224.1|  509|Homo sapiens neuroplastoma apoptosis...    37   0.069
AF217197-1|AAF27522.2|  542|Homo sapiens FBP-interacting repress...    37   0.069
AF190744-1|AAF05605.1|  556|Homo sapiens poly-U binding splicing...    37   0.069
AF114818-1|AAF23589.1|  559|Homo sapiens Ro ribonucleoprotein-bi...    37   0.069
AF090693-1|AAD13760.1|  508|Homo sapiens apoptosis-related RNA b...    37   0.069
AF036956-1|AAD02074.1|  490|Homo sapiens neuroblastoma apoptosis...    37   0.069
AC018737-1|AAY14830.1|  293|Homo sapiens unknown protein.              37   0.069
AB044971-1|BAB41210.1|  293|Homo sapiens nucleolar phosphoprotei...    37   0.069
X77494-1|CAA54628.1|  389|Homo sapiens MSSP-2 protein.                 37   0.091
X64652-1|CAA45923.1|  372|Homo sapiens 348 aa protein protein.         37   0.091
M60858-1|AAA59954.1|  707|Homo sapiens nucleolin protein.              37   0.091
D28483-1|BAA05842.1|  407|Homo sapiens SCR3 protein.                   37   0.091
D28482-1|BAA05841.1|  403|Homo sapiens SCR2 protein.                   37   0.091
BC072679-1|AAH72679.1|  407|Homo sapiens RNA binding motif, sing...    37   0.091
BC027863-1|AAH27863.1|  407|Homo sapiens RNA binding motif, sing...    37   0.091
BC018951-1|AAH18951.1|  406|Homo sapiens RNA binding motif, sing...    37   0.091
BC012993-1|AAH12993.1|  403|Homo sapiens RNA binding motif, sing...    37   0.091
BC012992-1|AAH12992.1|  403|Homo sapiens RNA binding motif, sing...    37   0.091
BC006516-1|AAH06516.3|  482|Homo sapiens NCL protein protein.          37   0.091
BC006494-1|AAH06494.3|  482|Homo sapiens NCL protein protein.          37   0.091
BC006137-1|AAH06137.1|  960|Homo sapiens RBM19 protein protein.        37   0.091
BC004289-1|AAH04289.1|  960|Homo sapiens RBM19 protein protein.        37   0.091
BC002343-1|AAH02343.3|  482|Homo sapiens NCL protein protein.          37   0.091
AK127608-1|BAC87055.1|  603|Homo sapiens protein ( Homo sapiens ...    37   0.091
AK091742-1|BAC03738.1|  687|Homo sapiens protein ( Homo sapiens ...    37   0.091
AC104598-1|AAX93183.1|  188|Homo sapiens unknown protein.              37   0.091
AC017104-2|AAY24247.1|  710|Homo sapiens unknown protein.              37   0.091
AB014582-1|BAA31657.2|  973|Homo sapiens KIAA0682 protein protein.     37   0.091
U38175-1|AAB41913.1|  326|Homo sapiens HuR RNA binding protein p...    36   0.12 
DQ160195-1|AAZ93379.1|  314|Homo sapiens cyclophilin-33B protein.      36   0.12 
BT009793-1|AAP88795.1|  326|Homo sapiens ELAV (embryonic lethal,...    36   0.12 
BC107736-1|AAI07737.1|  301|Homo sapiens peptidylprolyl isomeras...    36   0.12 
BC036071-1|AAH36071.1|  366|Homo sapiens ELAVL4 protein protein.       36   0.12 
BC015944-1|AAH15944.1|  214|Homo sapiens TIA1 protein protein.         36   0.12 
BC008451-1|AAH08451.1|  301|Homo sapiens peptidylprolyl isomeras...    36   0.12 
BC004898-1|AAH04898.1|  301|Homo sapiens peptidylprolyl isomeras...    36   0.12 
BC003376-1|AAH03376.1|  326|Homo sapiens ELAV (embryonic lethal,...    36   0.12 
AL049824-4|CAI19350.1|  301|Homo sapiens peptidylprolyl isomeras...    36   0.12 
AL049824-2|CAI19348.1|  296|Homo sapiens peptidylprolyl isomeras...    36   0.12 
AL049824-1|CAI19347.1|  314|Homo sapiens peptidylprolyl isomeras...    36   0.12 
AL035404-8|CAI19579.1|  301|Homo sapiens peptidylprolyl isomeras...    36   0.12 
AL035404-6|CAI19577.1|  296|Homo sapiens peptidylprolyl isomeras...    36   0.12 
AL035404-5|CAI19576.1|  314|Homo sapiens peptidylprolyl isomeras...    36   0.12 
AL033527-11|CAI19410.1|  296|Homo sapiens peptidylprolyl isomera...    36   0.12 
AL033527-10|CAI19409.1|  314|Homo sapiens peptidylprolyl isomera...    36   0.12 
AF104013-1|AAD19907.1|  296|Homo sapiens peptidyl-prolyl cis-tra...    36   0.12 
AF104012-1|AAD19906.1|  301|Homo sapiens peptidyl-prolyl cis-tra...    36   0.12 
AF042386-1|AAC00007.1|  296|Homo sapiens cyclophilin-33B protein.      36   0.12 
AF042385-1|AAC00006.1|  301|Homo sapiens cyclophilin-33A protein.      36   0.12 
AC016700-3|AAX93193.1|  386|Homo sapiens unknown protein.              36   0.12 
AB209211-1|BAD92448.1|  464|Homo sapiens TIA1 protein variant pr...    36   0.12 
U96074-1|AAC78728.1|  320|Homo sapiens translation initiation fa...    36   0.16 
CR457134-1|CAG33415.1|  320|Homo sapiens EIF3S4 protein.               36   0.16 
BT006889-1|AAP35535.1|  320|Homo sapiens eukaryotic translation ...    36   0.16 
BC024283-1|AAH24283.1|  453|Homo sapiens Unknown (protein for IM...    36   0.16 
BC015575-1|AAH15575.1|  417|Homo sapiens SYNCRIP protein protein.      36   0.16 
BC014249-1|AAH14249.1|   52|Homo sapiens VKORC1L1 protein protein.     36   0.16 
BC008469-1|AAH08469.1|  320|Homo sapiens eukaryotic translation ...    36   0.16 
BC000733-1|AAH00733.1|  320|Homo sapiens eukaryotic translation ...    36   0.16 
AL136082-4|CAI20447.1|  623|Homo sapiens RP1-3J17.2 protein.           36   0.16 
AL136082-3|CAI20446.1|  562|Homo sapiens RP1-3J17.2 protein.           36   0.16 
AK222776-1|BAD96496.1|  623|Homo sapiens synaptotagmin binding, ...    36   0.16 
AF155568-1|AAD38198.1|  562|Homo sapiens NSAP1 protein protein.        36   0.16 
AF094850-1|AAG15419.1|  320|Homo sapiens eukaryotic translation ...    36   0.16 
AF092453-1|AAG15396.1|  320|Homo sapiens eukaryotic translation ...    36   0.16 
AF020833-1|AAB71866.1|  320|Homo sapiens eukaryotic translation ...    36   0.16 
AB209098-1|BAD92335.1|  534|Homo sapiens synaptotagmin binding, ...    36   0.16 
BC117315-1|AAI17316.1|  433|Homo sapiens RBMS3 protein protein.        36   0.21 
AY236871-1|AAP75555.1|  437|Homo sapiens RNA binding motif singl...    36   0.21 
AF023259-1|AAC63910.1|  411|Homo sapiens RNA-binding protein pro...    36   0.21 
X84841-1|CAA59278.1|  437|Homo sapiens 68 kDa (U1) ribonucleopro...    35   0.28 
X06815-1|CAA29964.1|  216|Homo sapiens hU1-70K-like protein (216...    35   0.28 
X06812-1|CAA29961.1|  301|Homo sapiens protein ( Human mRNA for ...    35   0.28 
X04654-1|CAA28352.1|  614|Homo sapiens protein ( Human mRNA for ...    35   0.28 
U80746-1|AAB91444.1|  358|Homo sapiens CAGH4 protein.                  35   0.28 
M57939-2|AAA36573.1|  428|Homo sapiens ribonucleoprotein antigen...    35   0.28 
M57939-1|AAA36572.1|  437|Homo sapiens ribonucleoprotein antigen...    35   0.28 
M57935-1|AAA36571.1|  166|Homo sapiens ribonucleoprotein antigen...    35   0.28 
M22636-1|AAA03001.1|  437|Homo sapiens protein ( Human U1 small ...    35   0.28 
BC104758-1|AAI04759.1|  465|Homo sapiens trinucleotide repeat co...    35   0.28 
BC068008-1|AAH68008.1|  407|Homo sapiens TNRC4 protein protein.        35   0.28 
BC052491-1|AAH52491.1|  464|Homo sapiens trinucleotide repeat co...    35   0.28 
BC001315-1|AAH01315.1|  437|Homo sapiens small nuclear ribonucle...    35   0.28 
AY165003-1|AAN73884.1|  465|Homo sapiens CUG-BP and ETR-3 like f...    35   0.28 
AL589765-5|CAI17168.1|  465|Homo sapiens trinucleotide repeat co...    35   0.28 
AL589765-4|CAI17167.1|  415|Homo sapiens trinucleotide repeat co...    35   0.28 
AL589765-3|CAI17166.1|  465|Homo sapiens trinucleotide repeat co...    35   0.28 
AF329264-1|AAK07474.1|  462|Homo sapiens CUG-BP and ETR-3 like f...    35   0.28 
AF284423-1|AAG14457.1|  140|Homo sapiens RNA-binding protein BRU...    35   0.28 
AB209264-1|BAD92501.1|  441|Homo sapiens trinucleotide repeat co...    35   0.28 
DQ778625-1|ABG77459.1|  451|Homo sapiens unknown protein.              35   0.37 
CR456559-1|CAG30445.1|  376|Homo sapiens RBM9 protein.                 35   0.37 
BC113691-1|AAI13692.1|  395|Homo sapiens ataxin 2-binding protei...    35   0.37 
BC025281-1|AAH25281.1|  380|Homo sapiens RNA binding motif prote...    35   0.37 
BC010074-1|AAH10074.1|  173|Homo sapiens FUSIP1 protein protein.       35   0.37 
BC005039-1|AAH05039.1|  262|Homo sapiens FUS interacting protein...    35   0.37 
BC001107-1|AAH01107.1|  183|Homo sapiens FUS interacting protein...    35   0.37 
AY960684-1|AAX84843.1|  370|Homo sapiens RNA binding motif prote...    35   0.37 
AY236872-1|AAP75556.1|  419|Homo sapiens RNA binding motif singl...    35   0.37 
AY150181-1|AAN65381.1|  183|Homo sapiens splicing factor SRp38-2...    35   0.37 
AY150180-1|AAN65380.1|  262|Homo sapiens splicing factor SRp38 p...    35   0.37 
AY072786-1|AAL67150.1|  390|Homo sapiens RNA binding motif prote...    35   0.37 
AY048592-2|AAL06099.1|  262|Homo sapiens TLS-associated SR prote...    35   0.37 
AY048592-1|AAL06098.1|  183|Homo sapiens TLS-associated SR prote...    35   0.37 
AM419009-1|CAL91352.1|  398|Homo sapiens RNA binding motif prote...    35   0.37 
AL590609-10|CAI14808.1|  262|Homo sapiens FUS interacting protei...    35   0.37 
AL590609-9|CAI14807.1|  261|Homo sapiens FUS interacting protein...    35   0.37 
AL590609-8|CAI14805.1|  173|Homo sapiens FUS interacting protein...    35   0.37 
AL590609-7|CAI14806.1|  172|Homo sapiens FUS interacting protein...    35   0.37 
AL590609-6|CAI14803.1|  183|Homo sapiens FUS interacting protein...    35   0.37 
AL590609-5|CAI14804.1|  182|Homo sapiens FUS interacting protein...    35   0.37 
AL079295-2|CAI19059.1|  367|Homo sapiens RNA binding motif prote...    35   0.37 
AL049748-3|CAI20525.1|  367|Homo sapiens RNA binding motif prote...    35   0.37 
AL009266-1|CAA15842.1|  367|Homo sapiens hypothetical protein pr...    35   0.37 
AK222994-1|BAD96714.1|  262|Homo sapiens FUS interacting protein...    35   0.37 
AK055213-1|BAB70875.1|  450|Homo sapiens  mRNA.  protein.              35   0.37 
AK001286-1|BAA91601.1|  183|Homo sapiens protein ( Homo sapiens ...    35   0.37 
AK001027-1|BAA91472.1|  397|Homo sapiens protein ( Homo sapiens ...    35   0.37 
AF449427-1|AAL57514.1|  262|Homo sapiens SRrp40 protein.               35   0.37 
AF448859-1|AAP41925.1|  370|Homo sapiens ataxin 2-binding protei...    35   0.37 
AF419332-1|AAL16666.1|  261|Homo sapiens TLS-associated protein ...    35   0.37 
AF419331-1|AAL16665.1|  183|Homo sapiens TLS-associated protein ...    35   0.37 
AF229058-1|AAL71905.1|  380|Homo sapiens hexaribonucleotide bind...    35   0.37 
AF229057-1|AAL71904.1|  418|Homo sapiens hexaribonucleotide bind...    35   0.37 
AF109120-3|AAL83407.1|  395|Homo sapiens hexaribonucleotide bind...    35   0.37 
AF109120-2|AAL83408.1|  392|Homo sapiens hexaribonucleotide bind...    35   0.37 
AF109120-1|AAL83409.1|  418|Homo sapiens hexaribonucleotide bind...    35   0.37 
AF109106-1|AAL83406.1|  395|Homo sapiens hexaribonucleotide bind...    35   0.37 
AF107203-1|AAF78291.1|  377|Homo sapiens ataxin 2-binding protei...    35   0.37 
AF094849-1|AAL83405.1|  392|Homo sapiens hexaribonucleotide bind...    35   0.37 
AF067730-1|AAC26727.1|  262|Homo sapiens TLS-associated protein ...    35   0.37 
AF047448-1|AAC70918.1|  183|Homo sapiens TLS-associated protein ...    35   0.37 
AB208826-1|BAD92063.1|  303|Homo sapiens ataxin 2-binding protei...    35   0.37 
D82351-1|BAA11561.1|  373|Homo sapiens MSSP-1 protein.                 34   0.48 
BC066945-1|AAH66945.1|  582|Homo sapiens LARP7 protein protein.        34   0.48 
BC045711-1|AAH45711.1|  448|Homo sapiens BRUNOL4 protein protein.      34   0.48 
BC033838-1|AAH33838.1|  368|Homo sapiens BRUNOL6 protein protein.      34   0.48 
BC030835-1|AAH30835.1|  481|Homo sapiens bruno-like 6, RNA bindi...    34   0.48 
BC026077-1|AAH26077.1|  161|Homo sapiens RBMY2FP protein protein.      34   0.48 
AK131098-1|BAC85148.1|  376|Homo sapiens FLJ00324 protein protein.     34   0.48 
AF425606-1|AAL34513.1|  481|Homo sapiens RNA-binding protein CEL...    34   0.48 
AF401233-1|AAK95615.1|  481|Homo sapiens BRUNO-like 6 RNA-bindin...    34   0.48 
AF248650-1|AAF86232.1|  294|Homo sapiens RNA-binding protein BRU...    34   0.48 
AB209434-1|BAD92671.1|  305|Homo sapiens BRUNO-like 6 RNA-bindin...    34   0.48 
X75755-1|CAA53383.1|  221|Homo sapiens PR264/SC35 protein.             34   0.64 
X62447-1|CAA44307.1|  221|Homo sapiens PR 264 protein.                 34   0.64 
D26068-1|BAA05063.1|  230|Homo sapiens KIAA0038 protein.               34   0.64 
BT007250-1|AAP35914.1|  221|Homo sapiens splicing factor, argini...    34   0.64 
BC070086-1|AAH70086.1|  221|Homo sapiens splicing factor, argini...    34   0.64 
BC066928-1|AAH66928.1|  228|Homo sapiens eukaryotic translation ...    34   0.64 
BC021715-1|AAH21715.1|  261|Homo sapiens serine-arginine repress...    34   0.64 
BC021214-1|AAH21214.1|  228|Homo sapiens eukaryotic translation ...    34   0.64 
BC010021-1|AAH10021.1|  228|Homo sapiens eukaryotic translation ...    34   0.64 
BC001303-1|AAH01303.1|  221|Homo sapiens SFRS2 protein protein.        34   0.64 
BC000339-1|AAH00339.1|  221|Homo sapiens SFRS2 protein protein.        34   0.64 
AK223252-1|BAD96972.1|  221|Homo sapiens splicing factor, argini...    34   0.64 
AK092489-1|BAC03903.1|  201|Homo sapiens protein ( Homo sapiens ...    34   0.64 
AK074596-1|BAC11082.1|  484|Homo sapiens protein ( Homo sapiens ...    34   0.64 
AF449428-1|AAL57515.1|  261|Homo sapiens SRrp35 protein.               34   0.64 
AF045555-2|AAF75557.1|  228|Homo sapiens wbscr1 protein.               34   0.64 
AF045555-1|AAC04859.2|  248|Homo sapiens wbscr1 alternative spli...    34   0.64 
AC005057-2|AAS07440.1|  136|Homo sapiens unknown protein.              34   0.64 
AC005057-1|AAS07439.1|  156|Homo sapiens unknown protein.              34   0.64 
BC013889-1|AAH13889.1|  759|Homo sapiens RNA binding motif prote...    33   0.85 
BC010939-1|AAH10939.1|  306|Homo sapiens poly(A) binding protein...    33   0.85 
AY034483-1|AAK59705.1|  561|Homo sapiens hnRNP Q1 protein.             33   0.85 
AY034481-1|AAK59703.1|  623|Homo sapiens hnRNP Q3 protein.             33   0.85 
AK093626-1|BAC04206.1|  186|Homo sapiens protein ( Homo sapiens ...    33   0.85 
AK001239-1|BAA91575.1|  759|Homo sapiens protein ( Homo sapiens ...    33   0.85 
AF037448-1|AAC12926.1|  623|Homo sapiens Gry-rbp protein.              33   0.85 
AF026029-1|AAC39596.1|  306|Homo sapiens poly(A) binding protein...    33   0.85 
BC068242-1|AAH68242.1|  269|Homo sapiens LOC728773 protein protein.    33   1.1  
BC066958-1|AAH66958.1|  179|Homo sapiens SFRS2 protein protein.        33   1.1  
AK222716-1|BAD96436.1|  759|Homo sapiens RNA binding motif prote...    33   1.1  
BC040844-1|AAH40844.1|  410|Homo sapiens SYNCRIP protein protein.      33   1.5  
BC004167-1|AAH04167.2|  484|Homo sapiens bruno-like 4, RNA bindi...    33   1.5  
BC001946-1|AAH01946.2|  484|Homo sapiens bruno-like 4, RNA bindi...    33   1.5  
L35013-1|AAA60300.1|  424|Homo sapiens spliceosomal protein prot...    32   2.0  
BC090883-1|AAH90883.1|  424|Homo sapiens splicing factor 3b, sub...    32   2.0  
BC013886-1|AAH13886.1|  424|Homo sapiens splicing factor 3b, sub...    32   2.0  
BC004273-1|AAH04273.1|  424|Homo sapiens splicing factor 3b, sub...    32   2.0  
AL591493-2|CAI12554.1|  424|Homo sapiens splicing factor 3b, sub...    32   2.0  
AL590487-2|CAI12648.1|  424|Homo sapiens splicing factor 3b, sub...    32   2.0  
AK223322-1|BAD97042.1|  424|Homo sapiens splicing factor 3b, sub...    32   2.0  
X76059-1|CAA53659.1|  496|Homo sapiens protein ( H.sapiens mRNA ...    32   2.6  

>X79536-1|CAA56072.1|  320|Homo sapiens hnRNPcore protein A1
           protein.
          Length = 320

 Score =  122 bits (294), Expect = 1e-27
 Identities = 53/85 (62%), Positives = 65/85 (76%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           WG + D VVM+DP TKRS+GFGF+TY+    VD A N RPHK+DGR+VEPKRAV RE+ +
Sbjct: 37  WGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQ 96

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
           RP A  TVKK+FV G+K+D EE  L
Sbjct: 97  RPGAHLTVKKIFVGGIKEDTEEHHL 121



 Score = 64.9 bits (151), Expect = 3e-10
 Identities = 25/54 (46%), Positives = 38/54 (70%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFN 667
           LR+YF  +G I  + ++TD+ +GKKRGF FV FDD+D VD++ +Q+ H +   N
Sbjct: 121 LRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHN 174



 Score = 41.5 bits (93), Expect = 0.003
 Identities = 17/28 (60%), Positives = 21/28 (75%)
 Frame = +1

Query: 169 EEPEHTRKLFIGGLDYRTTDSSLKEFYE 252
           +EPE  RKLFIGGL + TTD SL+  +E
Sbjct: 8   KEPEQLRKLFIGGLSFETTDESLRSHFE 35



 Score = 38.7 bits (86), Expect = 0.023
 Identities = 16/65 (24%), Positives = 36/65 (55%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +G+I  + +M D  + + +GF F+T+     VD+    + H ++G   E ++A+ ++E+ 
Sbjct: 128 YGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMA 187

Query: 435 RPEAS 449
              +S
Sbjct: 188 SASSS 192



 Score = 37.5 bits (83), Expect = 0.052
 Identities = 16/50 (32%), Positives = 26/50 (52%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           LR +F  +G +    V+ D  T + RGFGFV +   + VD     + H++
Sbjct: 30  LRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKV 79


>X12671-1|CAA31191.1|  320|Homo sapiens hnrnp a1 protein protein.
          Length = 320

 Score =  122 bits (294), Expect = 1e-27
 Identities = 53/85 (62%), Positives = 65/85 (76%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           WG + D VVM+DP TKRS+GFGF+TY+    VD A N RPHK+DGR+VEPKRAV RE+ +
Sbjct: 37  WGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQ 96

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
           RP A  TVKK+FV G+K+D EE  L
Sbjct: 97  RPGAHLTVKKIFVGGIKEDTEEHHL 121



 Score = 64.9 bits (151), Expect = 3e-10
 Identities = 25/54 (46%), Positives = 38/54 (70%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFN 667
           LR+YF  +G I  + ++TD+ +GKKRGF FV FDD+D VD++ +Q+ H +   N
Sbjct: 121 LRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHN 174



 Score = 41.5 bits (93), Expect = 0.003
 Identities = 17/28 (60%), Positives = 21/28 (75%)
 Frame = +1

Query: 169 EEPEHTRKLFIGGLDYRTTDSSLKEFYE 252
           +EPE  RKLFIGGL + TTD SL+  +E
Sbjct: 8   KEPEQLRKLFIGGLSFETTDESLRSHFE 35



 Score = 38.7 bits (86), Expect = 0.023
 Identities = 16/65 (24%), Positives = 36/65 (55%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +G+I  + +M D  + + +GF F+T+     VD+    + H ++G   E ++A+ ++E+ 
Sbjct: 128 YGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMA 187

Query: 435 RPEAS 449
              +S
Sbjct: 188 SASSS 192



 Score = 37.5 bits (83), Expect = 0.052
 Identities = 16/50 (32%), Positives = 26/50 (52%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           LR +F  +G +    V+ D  T + RGFGFV +   + VD     + H++
Sbjct: 30  LRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKV 79


>X06747-1|CAA29922.1|  320|Homo sapiens protein ( Human hnRNP core
           protein A1. ).
          Length = 320

 Score =  122 bits (294), Expect = 1e-27
 Identities = 53/85 (62%), Positives = 65/85 (76%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           WG + D VVM+DP TKRS+GFGF+TY+    VD A N RPHK+DGR+VEPKRAV RE+ +
Sbjct: 37  WGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQ 96

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
           RP A  TVKK+FV G+K+D EE  L
Sbjct: 97  RPGAHLTVKKIFVGGIKEDTEEHHL 121



 Score = 64.9 bits (151), Expect = 3e-10
 Identities = 25/54 (46%), Positives = 38/54 (70%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFN 667
           LR+YF  FG I  + ++TD+ +GKK+GF FV FDD+D VD++ +Q+ H +   N
Sbjct: 121 LRDYFEQFGKIEVIEIMTDRGSGKKKGFAFVTFDDHDSVDKIVIQKYHTVNGHN 174



 Score = 41.5 bits (93), Expect = 0.003
 Identities = 17/28 (60%), Positives = 21/28 (75%)
 Frame = +1

Query: 169 EEPEHTRKLFIGGLDYRTTDSSLKEFYE 252
           +EPE  RKLFIGGL + TTD SL+  +E
Sbjct: 8   KEPEQLRKLFIGGLSFETTDESLRSHFE 35



 Score = 39.5 bits (88), Expect = 0.013
 Identities = 17/65 (26%), Positives = 36/65 (55%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +G+I  + +M D  + + KGF F+T+     VD+    + H ++G   E ++A+ ++E+ 
Sbjct: 128 FGKIEVIEIMTDRGSGKKKGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMA 187

Query: 435 RPEAS 449
              +S
Sbjct: 188 SASSS 192



 Score = 37.5 bits (83), Expect = 0.052
 Identities = 16/50 (32%), Positives = 26/50 (52%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           LR +F  +G +    V+ D  T + RGFGFV +   + VD     + H++
Sbjct: 30  LRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKV 79


>BC121133-1|AAI21134.1|  320|Homo sapiens heterogeneous nuclear
           ribonucleoprotein A1 protein.
          Length = 320

 Score =  122 bits (294), Expect = 1e-27
 Identities = 53/85 (62%), Positives = 65/85 (76%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           WG + D VVM+DP TKRS+GFGF+TY+    VD A N RPHK+DGR+VEPKRAV RE+ +
Sbjct: 37  WGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQ 96

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
           RP A  TVKK+FV G+K+D EE  L
Sbjct: 97  RPGAHLTVKKIFVGGIKEDTEEHHL 121



 Score = 64.9 bits (151), Expect = 3e-10
 Identities = 25/54 (46%), Positives = 38/54 (70%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFN 667
           LR+YF  +G I  + ++TD+ +GKKRGF FV FDD+D VD++ +Q+ H +   N
Sbjct: 121 LRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHN 174



 Score = 41.5 bits (93), Expect = 0.003
 Identities = 17/28 (60%), Positives = 21/28 (75%)
 Frame = +1

Query: 169 EEPEHTRKLFIGGLDYRTTDSSLKEFYE 252
           +EPE  RKLFIGGL + TTD SL+  +E
Sbjct: 8   KEPEQLRKLFIGGLSFETTDESLRSHFE 35



 Score = 38.7 bits (86), Expect = 0.023
 Identities = 16/65 (24%), Positives = 36/65 (55%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +G+I  + +M D  + + +GF F+T+     VD+    + H ++G   E ++A+ ++E+ 
Sbjct: 128 YGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMA 187

Query: 435 RPEAS 449
              +S
Sbjct: 188 SASSS 192



 Score = 37.5 bits (83), Expect = 0.052
 Identities = 16/50 (32%), Positives = 26/50 (52%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           LR +F  +G +    V+ D  T + RGFGFV +   + VD     + H++
Sbjct: 30  LRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKV 79


>BC103707-1|AAI03708.1|  267|Homo sapiens HNRPA1 protein protein.
          Length = 267

 Score =  122 bits (294), Expect = 1e-27
 Identities = 53/85 (62%), Positives = 65/85 (76%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           WG + D VVM+DP TKRS+GFGF+TY+    VD A N RPHK+DGR+VEPKRAV RE+ +
Sbjct: 37  WGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQ 96

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
           RP A  TVKK+FV G+K+D EE  L
Sbjct: 97  RPGAHLTVKKIFVGGIKEDTEEHHL 121



 Score = 64.9 bits (151), Expect = 3e-10
 Identities = 25/54 (46%), Positives = 38/54 (70%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFN 667
           LR+YF  +G I  + ++TD+ +GKKRGF FV FDD+D VD++ +Q+ H +   N
Sbjct: 121 LRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHN 174



 Score = 41.5 bits (93), Expect = 0.003
 Identities = 17/28 (60%), Positives = 21/28 (75%)
 Frame = +1

Query: 169 EEPEHTRKLFIGGLDYRTTDSSLKEFYE 252
           +EPE  RKLFIGGL + TTD SL+  +E
Sbjct: 8   KEPEQLRKLFIGGLSFETTDESLRSHFE 35



 Score = 38.7 bits (86), Expect = 0.023
 Identities = 16/65 (24%), Positives = 36/65 (55%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +G+I  + +M D  + + +GF F+T+     VD+    + H ++G   E ++A+ ++E+ 
Sbjct: 128 YGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMA 187

Query: 435 RPEAS 449
              +S
Sbjct: 188 SASSS 192



 Score = 37.5 bits (83), Expect = 0.052
 Identities = 16/50 (32%), Positives = 26/50 (52%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           LR +F  +G +    V+ D  T + RGFGFV +   + VD     + H++
Sbjct: 30  LRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKV 79


>BC074502-1|AAH74502.1|  320|Homo sapiens heterogeneous nuclear
           ribonucleoprotein A1 protein.
          Length = 320

 Score =  122 bits (294), Expect = 1e-27
 Identities = 53/85 (62%), Positives = 65/85 (76%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           WG + D VVM+DP TKRS+GFGF+TY+    VD A N RPHK+DGR+VEPKRAV RE+ +
Sbjct: 37  WGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQ 96

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
           RP A  TVKK+FV G+K+D EE  L
Sbjct: 97  RPGAHLTVKKIFVGGIKEDTEEHHL 121



 Score = 64.9 bits (151), Expect = 3e-10
 Identities = 25/54 (46%), Positives = 38/54 (70%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFN 667
           LR+YF  +G I  + ++TD+ +GKKRGF FV FDD+D VD++ +Q+ H +   N
Sbjct: 121 LRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHN 174



 Score = 41.5 bits (93), Expect = 0.003
 Identities = 17/28 (60%), Positives = 21/28 (75%)
 Frame = +1

Query: 169 EEPEHTRKLFIGGLDYRTTDSSLKEFYE 252
           +EPE  RKLFIGGL + TTD SL+  +E
Sbjct: 8   KEPEQLRKLFIGGLSFETTDESLRSHFE 35



 Score = 38.7 bits (86), Expect = 0.023
 Identities = 16/65 (24%), Positives = 36/65 (55%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +G+I  + +M D  + + +GF F+T+     VD+    + H ++G   E ++A+ ++E+ 
Sbjct: 128 YGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMA 187

Query: 435 RPEAS 449
              +S
Sbjct: 188 SASSS 192



 Score = 37.5 bits (83), Expect = 0.052
 Identities = 16/50 (32%), Positives = 26/50 (52%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           LR +F  +G +    V+ D  T + RGFGFV +   + VD     + H++
Sbjct: 30  LRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKV 79


>BC073162-1|AAH73162.1|  320|Homo sapiens heterogeneous nuclear
           ribonucleoprotein A1 protein.
          Length = 320

 Score =  122 bits (294), Expect = 1e-27
 Identities = 53/85 (62%), Positives = 65/85 (76%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           WG + D VVM+DP TKRS+GFGF+TY+    VD A N RPHK+DGR+VEPKRAV RE+ +
Sbjct: 37  WGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQ 96

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
           RP A  TVKK+FV G+K+D EE  L
Sbjct: 97  RPGAHLTVKKIFVGGIKEDTEEHHL 121



 Score = 64.9 bits (151), Expect = 3e-10
 Identities = 25/54 (46%), Positives = 38/54 (70%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFN 667
           LR+YF  +G I  + ++TD+ +GKKRGF FV FDD+D VD++ +Q+ H +   N
Sbjct: 121 LRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHN 174



 Score = 41.5 bits (93), Expect = 0.003
 Identities = 17/28 (60%), Positives = 21/28 (75%)
 Frame = +1

Query: 169 EEPEHTRKLFIGGLDYRTTDSSLKEFYE 252
           +EPE  RKLFIGGL + TTD SL+  +E
Sbjct: 8   KEPEQLRKLFIGGLSFETTDESLRSHFE 35



 Score = 38.7 bits (86), Expect = 0.023
 Identities = 16/65 (24%), Positives = 36/65 (55%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +G+I  + +M D  + + +GF F+T+     VD+    + H ++G   E ++A+ ++E+ 
Sbjct: 128 YGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMA 187

Query: 435 RPEAS 449
              +S
Sbjct: 188 SASSS 192



 Score = 37.5 bits (83), Expect = 0.052
 Identities = 16/50 (32%), Positives = 26/50 (52%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           LR +F  +G +    V+ D  T + RGFGFV +   + VD     + H++
Sbjct: 30  LRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKV 79


>BC071945-1|AAH71945.1|  320|Homo sapiens heterogeneous nuclear
           ribonucleoprotein A1 protein.
          Length = 320

 Score =  122 bits (294), Expect = 1e-27
 Identities = 53/85 (62%), Positives = 65/85 (76%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           WG + D VVM+DP TKRS+GFGF+TY+    VD A N RPHK+DGR+VEPKRAV RE+ +
Sbjct: 37  WGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQ 96

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
           RP A  TVKK+FV G+K+D EE  L
Sbjct: 97  RPGAHLTVKKIFVGGIKEDTEEHHL 121



 Score = 66.1 bits (154), Expect = 1e-10
 Identities = 26/54 (48%), Positives = 38/54 (70%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFN 667
           LR+YF  FG I  + ++TD+ +GKKRGF FV FDD+D VD++ +Q+ H +   N
Sbjct: 121 LRDYFEQFGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHN 174



 Score = 41.5 bits (93), Expect = 0.003
 Identities = 17/28 (60%), Positives = 21/28 (75%)
 Frame = +1

Query: 169 EEPEHTRKLFIGGLDYRTTDSSLKEFYE 252
           +EPE  RKLFIGGL + TTD SL+  +E
Sbjct: 8   KEPEQLRKLFIGGLSFETTDESLRSHFE 35



 Score = 38.3 bits (85), Expect = 0.030
 Identities = 16/65 (24%), Positives = 36/65 (55%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +G+I  + +M D  + + +GF F+T+     VD+    + H ++G   E ++A+ ++E+ 
Sbjct: 128 FGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMA 187

Query: 435 RPEAS 449
              +S
Sbjct: 188 SASSS 192



 Score = 37.5 bits (83), Expect = 0.052
 Identities = 16/50 (32%), Positives = 26/50 (52%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           LR +F  +G +    V+ D  T + RGFGFV +   + VD     + H++
Sbjct: 30  LRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKV 79


>BC070315-1|AAH70315.1|  320|Homo sapiens HNRPA1 protein protein.
          Length = 320

 Score =  122 bits (294), Expect = 1e-27
 Identities = 53/85 (62%), Positives = 65/85 (76%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           WG + D VVM+DP TKRS+GFGF+TY+    VD A N RPHK+DGR+VEPKRAV RE+ +
Sbjct: 37  WGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQ 96

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
           RP A  TVKK+FV G+K+D EE  L
Sbjct: 97  RPGAHLTVKKIFVGGIKEDTEEHHL 121



 Score = 64.9 bits (151), Expect = 3e-10
 Identities = 25/54 (46%), Positives = 38/54 (70%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFN 667
           LR+YF  +G I  + ++TD+ +GKKRGF FV FDD+D VD++ +Q+ H +   N
Sbjct: 121 LRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHN 174



 Score = 41.5 bits (93), Expect = 0.003
 Identities = 17/28 (60%), Positives = 21/28 (75%)
 Frame = +1

Query: 169 EEPEHTRKLFIGGLDYRTTDSSLKEFYE 252
           +EPE  RKLFIGGL + TTD SL+  +E
Sbjct: 8   KEPEQLRKLFIGGLSFETTDESLRSHFE 35



 Score = 38.7 bits (86), Expect = 0.023
 Identities = 16/65 (24%), Positives = 36/65 (55%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +G+I  + +M D  + + +GF F+T+     VD+    + H ++G   E ++A+ ++E+ 
Sbjct: 128 YGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMA 187

Query: 435 RPEAS 449
              +S
Sbjct: 188 SASSS 192



 Score = 37.5 bits (83), Expect = 0.052
 Identities = 16/50 (32%), Positives = 26/50 (52%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           LR +F  +G +    V+ D  T + RGFGFV +   + VD     + H++
Sbjct: 30  LRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKV 79


>BC052296-1|AAH52296.1|  320|Homo sapiens heterogeneous nuclear
           ribonucleoprotein A1 protein.
          Length = 320

 Score =  122 bits (294), Expect = 1e-27
 Identities = 53/85 (62%), Positives = 65/85 (76%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           WG + D VVM+DP TKRS+GFGF+TY+    VD A N RPHK+DGR+VEPKRAV RE+ +
Sbjct: 37  WGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQ 96

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
           RP A  TVKK+FV G+K+D EE  L
Sbjct: 97  RPGAHLTVKKIFVGGIKEDTEEHHL 121



 Score = 64.9 bits (151), Expect = 3e-10
 Identities = 25/54 (46%), Positives = 38/54 (70%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFN 667
           LR+YF  +G I  + ++TD+ +GKKRGF FV FDD+D VD++ +Q+ H +   N
Sbjct: 121 LRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHN 174



 Score = 41.5 bits (93), Expect = 0.003
 Identities = 17/28 (60%), Positives = 21/28 (75%)
 Frame = +1

Query: 169 EEPEHTRKLFIGGLDYRTTDSSLKEFYE 252
           +EPE  RKLFIGGL + TTD SL+  +E
Sbjct: 8   KEPEQLRKLFIGGLSFETTDESLRSHFE 35



 Score = 38.7 bits (86), Expect = 0.023
 Identities = 16/65 (24%), Positives = 36/65 (55%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +G+I  + +M D  + + +GF F+T+     VD+    + H ++G   E ++A+ ++E+ 
Sbjct: 128 YGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMA 187

Query: 435 RPEAS 449
              +S
Sbjct: 188 SASSS 192



 Score = 37.5 bits (83), Expect = 0.052
 Identities = 16/50 (32%), Positives = 26/50 (52%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           LR +F  +G +    V+ D  T + RGFGFV +   + VD     + H++
Sbjct: 30  LRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKV 79


>BC033714-1|AAH33714.1|  320|Homo sapiens heterogeneous nuclear
           ribonucleoprotein A1 protein.
          Length = 320

 Score =  122 bits (294), Expect = 1e-27
 Identities = 53/85 (62%), Positives = 65/85 (76%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           WG + D VVM+DP TKRS+GFGF+TY+    VD A N RPHK+DGR+VEPKRAV RE+ +
Sbjct: 37  WGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQ 96

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
           RP A  TVKK+FV G+K+D EE  L
Sbjct: 97  RPGAHLTVKKIFVGGIKEDTEEHHL 121



 Score = 64.9 bits (151), Expect = 3e-10
 Identities = 25/54 (46%), Positives = 38/54 (70%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFN 667
           LR+YF  +G I  + ++TD+ +GKKRGF FV FDD+D VD++ +Q+ H +   N
Sbjct: 121 LRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHN 174



 Score = 41.5 bits (93), Expect = 0.003
 Identities = 17/28 (60%), Positives = 21/28 (75%)
 Frame = +1

Query: 169 EEPEHTRKLFIGGLDYRTTDSSLKEFYE 252
           +EPE  RKLFIGGL + TTD SL+  +E
Sbjct: 8   KEPEQLRKLFIGGLSFETTDESLRSHFE 35



 Score = 38.7 bits (86), Expect = 0.023
 Identities = 16/65 (24%), Positives = 36/65 (55%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +G+I  + +M D  + + +GF F+T+     VD+    + H ++G   E ++A+ ++E+ 
Sbjct: 128 YGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMA 187

Query: 435 RPEAS 449
              +S
Sbjct: 188 SASSS 192



 Score = 37.5 bits (83), Expect = 0.052
 Identities = 16/50 (32%), Positives = 26/50 (52%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           LR +F  +G +    V+ D  T + RGFGFV +   + VD     + H++
Sbjct: 30  LRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKV 79


>BC012158-1|AAH12158.1|  320|Homo sapiens heterogeneous nuclear
           ribonucleoprotein A1 protein.
          Length = 320

 Score =  122 bits (294), Expect = 1e-27
 Identities = 53/85 (62%), Positives = 65/85 (76%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           WG + D VVM+DP TKRS+GFGF+TY+    VD A N RPHK+DGR+VEPKRAV RE+ +
Sbjct: 37  WGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQ 96

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
           RP A  TVKK+FV G+K+D EE  L
Sbjct: 97  RPGAHLTVKKIFVGGIKEDTEEHHL 121



 Score = 64.9 bits (151), Expect = 3e-10
 Identities = 25/54 (46%), Positives = 38/54 (70%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFN 667
           LR+YF  +G I  + ++TD+ +GKKRGF FV FDD+D VD++ +Q+ H +   N
Sbjct: 121 LRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHN 174



 Score = 41.5 bits (93), Expect = 0.003
 Identities = 17/28 (60%), Positives = 21/28 (75%)
 Frame = +1

Query: 169 EEPEHTRKLFIGGLDYRTTDSSLKEFYE 252
           +EPE  RKLFIGGL + TTD SL+  +E
Sbjct: 8   KEPEQLRKLFIGGLSFETTDESLRSHFE 35



 Score = 38.7 bits (86), Expect = 0.023
 Identities = 16/65 (24%), Positives = 36/65 (55%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +G+I  + +M D  + + +GF F+T+     VD+    + H ++G   E ++A+ ++E+ 
Sbjct: 128 YGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMA 187

Query: 435 RPEAS 449
              +S
Sbjct: 188 SASSS 192



 Score = 37.5 bits (83), Expect = 0.052
 Identities = 16/50 (32%), Positives = 26/50 (52%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           LR +F  +G +    V+ D  T + RGFGFV +   + VD     + H++
Sbjct: 30  LRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKV 79


>BC009600-1|AAH09600.1|  320|Homo sapiens heterogeneous nuclear
           ribonucleoprotein A1 protein.
          Length = 320

 Score =  122 bits (294), Expect = 1e-27
 Identities = 53/85 (62%), Positives = 65/85 (76%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           WG + D VVM+DP TKRS+GFGF+TY+    VD A N RPHK+DGR+VEPKRAV RE+ +
Sbjct: 37  WGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQ 96

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
           RP A  TVKK+FV G+K+D EE  L
Sbjct: 97  RPGAHLTVKKIFVGGIKEDTEEHHL 121



 Score = 64.9 bits (151), Expect = 3e-10
 Identities = 25/54 (46%), Positives = 38/54 (70%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFN 667
           LR+YF  +G I  + ++TD+ +GKKRGF FV FDD+D VD++ +Q+ H +   N
Sbjct: 121 LRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHN 174



 Score = 41.5 bits (93), Expect = 0.003
 Identities = 17/28 (60%), Positives = 21/28 (75%)
 Frame = +1

Query: 169 EEPEHTRKLFIGGLDYRTTDSSLKEFYE 252
           +EPE  RKLFIGGL + TTD SL+  +E
Sbjct: 8   KEPEQLRKLFIGGLSFETTDESLRSHFE 35



 Score = 38.7 bits (86), Expect = 0.023
 Identities = 16/65 (24%), Positives = 36/65 (55%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +G+I  + +M D  + + +GF F+T+     VD+    + H ++G   E ++A+ ++E+ 
Sbjct: 128 YGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMA 187

Query: 435 RPEAS 449
              +S
Sbjct: 188 SASSS 192



 Score = 37.5 bits (83), Expect = 0.052
 Identities = 16/50 (32%), Positives = 26/50 (52%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           LR +F  +G +    V+ D  T + RGFGFV +   + VD     + H++
Sbjct: 30  LRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKV 79


>BC004945-1|AAH04945.1|  298|Homo sapiens Unknown (protein for
           IMAGE:3615335) protein.
          Length = 298

 Score =  122 bits (294), Expect = 1e-27
 Identities = 53/85 (62%), Positives = 65/85 (76%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           WG + D VVM+DP TKRS+GFGF+TY+    VD A N RPHK+DGR+VEPKRAV RE+ +
Sbjct: 15  WGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQ 74

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
           RP A  TVKK+FV G+K+D EE  L
Sbjct: 75  RPGAHLTVKKIFVGGIKEDTEEHHL 99



 Score = 64.9 bits (151), Expect = 3e-10
 Identities = 25/54 (46%), Positives = 38/54 (70%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFN 667
           LR+YF  +G I  + ++TD+ +GKKRGF FV FDD+D VD++ +Q+ H +   N
Sbjct: 99  LRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHN 152



 Score = 38.7 bits (86), Expect = 0.023
 Identities = 16/65 (24%), Positives = 36/65 (55%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +G+I  + +M D  + + +GF F+T+     VD+    + H ++G   E ++A+ ++E+ 
Sbjct: 106 YGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMA 165

Query: 435 RPEAS 449
              +S
Sbjct: 166 SASSS 170



 Score = 37.5 bits (83), Expect = 0.052
 Identities = 16/50 (32%), Positives = 26/50 (52%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           LR +F  +G +    V+ D  T + RGFGFV +   + VD     + H++
Sbjct: 8   LRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKV 57


>BC002355-1|AAH02355.1|  320|Homo sapiens heterogeneous nuclear
           ribonucleoprotein A1 protein.
          Length = 320

 Score =  122 bits (294), Expect = 1e-27
 Identities = 53/85 (62%), Positives = 65/85 (76%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           WG + D VVM+DP TKRS+GFGF+TY+    VD A N RPHK+DGR+VEPKRAV RE+ +
Sbjct: 37  WGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQ 96

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
           RP A  TVKK+FV G+K+D EE  L
Sbjct: 97  RPGAHLTVKKIFVGGIKEDTEEHHL 121



 Score = 64.9 bits (151), Expect = 3e-10
 Identities = 25/54 (46%), Positives = 38/54 (70%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFN 667
           LR+YF  +G I  + ++TD+ +GKKRGF FV FDD+D VD++ +Q+ H +   N
Sbjct: 121 LRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHN 174



 Score = 41.5 bits (93), Expect = 0.003
 Identities = 17/28 (60%), Positives = 21/28 (75%)
 Frame = +1

Query: 169 EEPEHTRKLFIGGLDYRTTDSSLKEFYE 252
           +EPE  RKLFIGGL + TTD SL+  +E
Sbjct: 8   KEPEQLRKLFIGGLSFETTDESLRSHFE 35



 Score = 38.7 bits (86), Expect = 0.023
 Identities = 16/65 (24%), Positives = 36/65 (55%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +G+I  + +M D  + + +GF F+T+     VD+    + H ++G   E ++A+ ++E+ 
Sbjct: 128 YGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMA 187

Query: 435 RPEAS 449
              +S
Sbjct: 188 SASSS 192



 Score = 37.5 bits (83), Expect = 0.052
 Identities = 16/50 (32%), Positives = 26/50 (52%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           LR +F  +G +    V+ D  T + RGFGFV +   + VD     + H++
Sbjct: 30  LRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKV 79


>BC108266-1|AAI08267.1|  320|Homo sapiens heterogeneous nuclear
           ribonucleoprotein A1-like protein.
          Length = 320

 Score =  120 bits (290), Expect = 4e-27
 Identities = 52/85 (61%), Positives = 64/85 (75%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           WG + D VVM+DP TKRS+GFGF+TY+    VD A N  PHK+DGR+VEPKRAV RE+ +
Sbjct: 37  WGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNTTPHKVDGRVVEPKRAVSREDSQ 96

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
           RP A  TVKK+FV G+K+D EE  L
Sbjct: 97  RPGAHLTVKKIFVGGIKEDTEEHHL 121



 Score = 66.9 bits (156), Expect = 7e-11
 Identities = 26/54 (48%), Positives = 39/54 (72%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFN 667
           LR+YF  +G I  + ++TD+ +GKKRGF FV FDD+D VD++ +Q+ H +K  N
Sbjct: 121 LRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVKGHN 174



 Score = 41.5 bits (93), Expect = 0.003
 Identities = 17/28 (60%), Positives = 21/28 (75%)
 Frame = +1

Query: 169 EEPEHTRKLFIGGLDYRTTDSSLKEFYE 252
           +EPE  RKLFIGGL + TTD SL+  +E
Sbjct: 8   KEPEQLRKLFIGGLSFETTDESLRSHFE 35



 Score = 41.1 bits (92), Expect = 0.004
 Identities = 17/65 (26%), Positives = 36/65 (55%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +G+I  + +M D  + + +GF F+T+     VD+    + H + G   E ++A+P++E+ 
Sbjct: 128 YGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVKGHNCEVRKALPKQEMA 187

Query: 435 RPEAS 449
              +S
Sbjct: 188 SASSS 192



 Score = 36.7 bits (81), Expect = 0.091
 Identities = 16/50 (32%), Positives = 25/50 (50%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           LR +F  +G +    V+ D  T + RGFGFV +   + VD       H++
Sbjct: 30  LRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNTTPHKV 79


>AL137058-3|CAI16736.1|  320|Homo sapiens protein ( Human DNA
           sequence from clone RP11-78J21 on chromosome
           13q32.2-33.3 Contains 2 novel genes, a pseudogene
           similar to part of TPTE and  ).
          Length = 320

 Score =  120 bits (290), Expect = 4e-27
 Identities = 52/85 (61%), Positives = 64/85 (75%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           WG + D VVM+DP TKRS+GFGF+TY+    VD A N  PHK+DGR+VEPKRAV RE+ +
Sbjct: 37  WGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNTTPHKVDGRVVEPKRAVSREDSQ 96

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
           RP A  TVKK+FV G+K+D EE  L
Sbjct: 97  RPGAHLTVKKIFVGGIKEDTEEHHL 121



 Score = 66.9 bits (156), Expect = 7e-11
 Identities = 26/54 (48%), Positives = 39/54 (72%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFN 667
           LR+YF  +G I  + ++TD+ +GKKRGF FV FDD+D VD++ +Q+ H +K  N
Sbjct: 121 LRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVKGHN 174



 Score = 41.5 bits (93), Expect = 0.003
 Identities = 17/28 (60%), Positives = 21/28 (75%)
 Frame = +1

Query: 169 EEPEHTRKLFIGGLDYRTTDSSLKEFYE 252
           +EPE  RKLFIGGL + TTD SL+  +E
Sbjct: 8   KEPEQLRKLFIGGLSFETTDESLRSHFE 35



 Score = 41.1 bits (92), Expect = 0.004
 Identities = 17/65 (26%), Positives = 36/65 (55%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +G+I  + +M D  + + +GF F+T+     VD+    + H + G   E ++A+P++E+ 
Sbjct: 128 YGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVKGHNCEVRKALPKQEMA 187

Query: 435 RPEAS 449
              +S
Sbjct: 188 SASSS 192



 Score = 36.7 bits (81), Expect = 0.091
 Identities = 16/50 (32%), Positives = 25/50 (50%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           LR +F  +G +    V+ D  T + RGFGFV +   + VD       H++
Sbjct: 30  LRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNTTPHKV 79


>BC113470-1|AAI13471.1|  378|Homo sapiens LOC653115 protein protein.
          Length = 378

 Score =  117 bits (281), Expect = 5e-26
 Identities = 52/85 (61%), Positives = 65/85 (76%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           WG + D VVM+DP+TKRS+GFGF+TYS    VD A   RPHK+DGR+VEPKRAV RE+  
Sbjct: 58  WGTLTDCVVMRDPQTKRSRGFGFVTYSCVEEVDAAMCARPHKVDGRVVEPKRAVSREDSV 117

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
           +P A  TVKK+FV G+K+D EE +L
Sbjct: 118 KPGAHLTVKKIFVGGIKEDTEEYNL 142



 Score = 66.5 bits (155), Expect = 1e-10
 Identities = 29/64 (45%), Positives = 45/64 (70%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFNIWM*KK 685
           LR+YF  +G I ++ V+ D+++GKKRGF FV FDD+D VD++ +Q+ H I   N  + KK
Sbjct: 142 LRDYFEKYGKIETIEVMEDRQSGKKRGFAFVTFDDHDTVDKIVVQKYHTINGHNCEV-KK 200

Query: 686 PISE 697
            +S+
Sbjct: 201 ALSK 204



 Score = 48.8 bits (111), Expect = 2e-05
 Identities = 21/34 (61%), Positives = 25/34 (73%)
 Frame = +1

Query: 151 ESGDDYEEPEHTRKLFIGGLDYRTTDSSLKEFYE 252
           E G D +EPE  RKLFIGGL + TTD SL+E +E
Sbjct: 23  EEGHDPKEPEQLRKLFIGGLSFETTDDSLREHFE 56



 Score = 43.2 bits (97), Expect = 0.001
 Identities = 18/60 (30%), Positives = 37/60 (61%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +G+I  + VM+D ++ + +GF F+T+     VD+    + H I+G   E K+A+ ++E++
Sbjct: 149 YGKIETIEVMEDRQSGKKRGFAFVTFDDHDTVDKIVVQKYHTINGHNCEVKKALSKQEMQ 208



 Score = 41.1 bits (92), Expect = 0.004
 Identities = 17/50 (34%), Positives = 28/50 (56%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           LRE+F  +G +    V+ D +T + RGFGFV +   + VD     + H++
Sbjct: 51  LREHFEKWGTLTDCVVMRDPQTKRSRGFGFVTYSCVEEVDAAMCARPHKV 100


>BC112027-1|AAI12028.1|  378|Homo sapiens heterogeneous nuclear
           ribonucleoprotein A3 protein.
          Length = 378

 Score =  117 bits (281), Expect = 5e-26
 Identities = 52/85 (61%), Positives = 65/85 (76%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           WG + D VVM+DP+TKRS+GFGF+TYS    VD A   RPHK+DGR+VEPKRAV RE+  
Sbjct: 58  WGTLTDCVVMRDPQTKRSRGFGFVTYSCVEEVDAAMCARPHKVDGRVVEPKRAVSREDSV 117

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
           +P A  TVKK+FV G+K+D EE +L
Sbjct: 118 KPGAHLTVKKIFVGGIKEDTEEYNL 142



 Score = 66.5 bits (155), Expect = 1e-10
 Identities = 29/64 (45%), Positives = 45/64 (70%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFNIWM*KK 685
           LR+YF  +G I ++ V+ D+++GKKRGF FV FDD+D VD++ +Q+ H I   N  + KK
Sbjct: 142 LRDYFEKYGKIETIEVMEDRQSGKKRGFAFVTFDDHDTVDKIVVQKYHTINGHNCEV-KK 200

Query: 686 PISE 697
            +S+
Sbjct: 201 ALSK 204



 Score = 48.8 bits (111), Expect = 2e-05
 Identities = 21/34 (61%), Positives = 25/34 (73%)
 Frame = +1

Query: 151 ESGDDYEEPEHTRKLFIGGLDYRTTDSSLKEFYE 252
           E G D +EPE  RKLFIGGL + TTD SL+E +E
Sbjct: 23  EEGHDPKEPEQLRKLFIGGLSFETTDDSLREHFE 56



 Score = 43.2 bits (97), Expect = 0.001
 Identities = 18/60 (30%), Positives = 37/60 (61%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +G+I  + VM+D ++ + +GF F+T+     VD+    + H I+G   E K+A+ ++E++
Sbjct: 149 YGKIETIEVMEDRQSGKKRGFAFVTFDDHDTVDKIVVQKYHTINGHNCEVKKALSKQEMQ 208



 Score = 41.1 bits (92), Expect = 0.004
 Identities = 17/50 (34%), Positives = 28/50 (56%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           LRE+F  +G +    V+ D +T + RGFGFV +   + VD     + H++
Sbjct: 51  LREHFEKWGTLTDCVVMRDPQTKRSRGFGFVTYSCVEEVDAAMCARPHKV 100


>AY363225-1|AAQ63629.1|  378|Homo sapiens heterogeneous nuclear
           ribonucleoprotein A3 protein.
          Length = 378

 Score =  117 bits (281), Expect = 5e-26
 Identities = 52/85 (61%), Positives = 65/85 (76%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           WG + D VVM+DP+TKRS+GFGF+TYS    VD A   RPHK+DGR+VEPKRAV RE+  
Sbjct: 58  WGTLTDCVVMRDPQTKRSRGFGFVTYSCVEEVDAAMCARPHKVDGRVVEPKRAVSREDSV 117

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
           +P A  TVKK+FV G+K+D EE +L
Sbjct: 118 KPGAHLTVKKIFVGGIKEDTEEYNL 142



 Score = 66.5 bits (155), Expect = 1e-10
 Identities = 29/64 (45%), Positives = 45/64 (70%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFNIWM*KK 685
           LR+YF  +G I ++ V+ D+++GKKRGF FV FDD+D VD++ +Q+ H I   N  + KK
Sbjct: 142 LRDYFEKYGKIETIEVMEDRQSGKKRGFAFVTFDDHDTVDKIVVQKYHTINGHNCEV-KK 200

Query: 686 PISE 697
            +S+
Sbjct: 201 ALSK 204



 Score = 48.8 bits (111), Expect = 2e-05
 Identities = 21/34 (61%), Positives = 25/34 (73%)
 Frame = +1

Query: 151 ESGDDYEEPEHTRKLFIGGLDYRTTDSSLKEFYE 252
           E G D +EPE  RKLFIGGL + TTD SL+E +E
Sbjct: 23  EEGHDPKEPEQLRKLFIGGLSFETTDDSLREHFE 56



 Score = 43.2 bits (97), Expect = 0.001
 Identities = 18/60 (30%), Positives = 37/60 (61%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +G+I  + VM+D ++ + +GF F+T+     VD+    + H I+G   E K+A+ ++E++
Sbjct: 149 YGKIETIEVMEDRQSGKKRGFAFVTFDDHDTVDKIVVQKYHTINGHNCEVKKALSKQEMQ 208



 Score = 41.1 bits (92), Expect = 0.004
 Identities = 17/50 (34%), Positives = 28/50 (56%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           LRE+F  +G +    V+ D +T + RGFGFV +   + VD     + H++
Sbjct: 51  LREHFEKWGTLTDCVVMRDPQTKRSRGFGFVTYSCVEEVDAAMCARPHKV 100


>AC079305-1|AAY14709.1|  378|Homo sapiens unknown protein.
          Length = 378

 Score =  117 bits (281), Expect = 5e-26
 Identities = 52/85 (61%), Positives = 65/85 (76%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           WG + D VVM+DP+TKRS+GFGF+TYS    VD A   RPHK+DGR+VEPKRAV RE+  
Sbjct: 58  WGTLTDCVVMRDPQTKRSRGFGFVTYSCVEEVDAAMCARPHKVDGRVVEPKRAVSREDSV 117

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
           +P A  TVKK+FV G+K+D EE +L
Sbjct: 118 KPGAHLTVKKIFVGGIKEDTEEYNL 142



 Score = 66.5 bits (155), Expect = 1e-10
 Identities = 29/64 (45%), Positives = 45/64 (70%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFNIWM*KK 685
           LR+YF  +G I ++ V+ D+++GKKRGF FV FDD+D VD++ +Q+ H I   N  + KK
Sbjct: 142 LRDYFEKYGKIETIEVMEDRQSGKKRGFAFVTFDDHDTVDKIVVQKYHTINGHNCEV-KK 200

Query: 686 PISE 697
            +S+
Sbjct: 201 ALSK 204



 Score = 48.8 bits (111), Expect = 2e-05
 Identities = 21/34 (61%), Positives = 25/34 (73%)
 Frame = +1

Query: 151 ESGDDYEEPEHTRKLFIGGLDYRTTDSSLKEFYE 252
           E G D +EPE  RKLFIGGL + TTD SL+E +E
Sbjct: 23  EEGHDPKEPEQLRKLFIGGLSFETTDDSLREHFE 56



 Score = 43.2 bits (97), Expect = 0.001
 Identities = 18/60 (30%), Positives = 37/60 (61%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +G+I  + VM+D ++ + +GF F+T+     VD+    + H I+G   E K+A+ ++E++
Sbjct: 149 YGKIETIEVMEDRQSGKKRGFAFVTFDDHDTVDKIVVQKYHTINGHNCEVKKALSKQEMQ 208



 Score = 41.1 bits (92), Expect = 0.004
 Identities = 17/50 (34%), Positives = 28/50 (56%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           LRE+F  +G +    V+ D +T + RGFGFV +   + VD     + H++
Sbjct: 51  LREHFEKWGTLTDCVVMRDPQTKRSRGFGFVTYSCVEEVDAAMCARPHKV 100


>U09123-1|AAB60650.1|  341|Homo sapiens hnRNP protein A2 protein.
          Length = 341

 Score =  115 bits (276), Expect = 2e-25
 Identities = 52/85 (61%), Positives = 63/85 (74%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           WG++ D VVM+DP +KRS+GFGF+T+S    VD A   RPH IDGR+VEPKRAV REE  
Sbjct: 32  WGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESG 91

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
           +P A  TVKKLFV G+K+D EE  L
Sbjct: 92  KPGAHVTVKKLFVGGIKEDTEEHHL 116



 Score = 74.9 bits (176), Expect = 3e-13
 Identities = 29/54 (53%), Positives = 42/54 (77%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFN 667
           LR+YF  +G I ++ ++TD+++GKKRGFGFV FDD+DPVD++ LQ+ H I   N
Sbjct: 116 LRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHN 169



 Score = 44.4 bits (100), Expect = 5e-04
 Identities = 18/65 (27%), Positives = 40/65 (61%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +G+I  + ++ D ++ + +GFGF+T+     VD+    + H I+G   E ++A+ R+E++
Sbjct: 123 YGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEMQ 182

Query: 435 RPEAS 449
             ++S
Sbjct: 183 EVQSS 187



 Score = 41.1 bits (92), Expect = 0.004
 Identities = 18/32 (56%), Positives = 22/32 (68%)
 Frame = +1

Query: 172 EPEHTRKLFIGGLDYRTTDSSLKEFYEHGEKL 267
           E E  RKLFIGGL + TT+ SL+ +YE   KL
Sbjct: 4   EKEQFRKLFIGGLSFETTEESLRNYYEQWGKL 35



 Score = 37.9 bits (84), Expect = 0.039
 Identities = 17/50 (34%), Positives = 24/50 (48%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           LR Y+  +G +    V+ D  + + RGFGFV F     VD     + H I
Sbjct: 25  LRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSI 74


>M29065-1|AAA36574.1|  341|Homo sapiens protein ( Human hnRNP A2
           protein mRNA. ).
          Length = 341

 Score =  115 bits (276), Expect = 2e-25
 Identities = 52/85 (61%), Positives = 63/85 (74%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           WG++ D VVM+DP +KRS+GFGF+T+S    VD A   RPH IDGR+VEPKRAV REE  
Sbjct: 32  WGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESG 91

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
           +P A  TVKKLFV G+K+D EE  L
Sbjct: 92  KPGAHVTVKKLFVGGIKEDTEEHHL 116



 Score = 74.9 bits (176), Expect = 3e-13
 Identities = 29/54 (53%), Positives = 42/54 (77%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFN 667
           LR+YF  +G I ++ ++TD+++GKKRGFGFV FDD+DPVD++ LQ+ H I   N
Sbjct: 116 LRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHN 169



 Score = 44.4 bits (100), Expect = 5e-04
 Identities = 18/65 (27%), Positives = 40/65 (61%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +G+I  + ++ D ++ + +GFGF+T+     VD+    + H I+G   E ++A+ R+E++
Sbjct: 123 YGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEMQ 182

Query: 435 RPEAS 449
             ++S
Sbjct: 183 EVQSS 187



 Score = 41.1 bits (92), Expect = 0.004
 Identities = 18/32 (56%), Positives = 22/32 (68%)
 Frame = +1

Query: 172 EPEHTRKLFIGGLDYRTTDSSLKEFYEHGEKL 267
           E E  RKLFIGGL + TT+ SL+ +YE   KL
Sbjct: 4   EKEQFRKLFIGGLSFETTEESLRNYYEQWGKL 35



 Score = 37.9 bits (84), Expect = 0.039
 Identities = 17/50 (34%), Positives = 24/50 (48%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           LR Y+  +G +    V+ D  + + RGFGFV F     VD     + H I
Sbjct: 25  LRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSI 74


>M29064-1|AAA60271.1|  353|Homo sapiens SNRPB1 protein.
          Length = 353

 Score =  115 bits (276), Expect = 2e-25
 Identities = 52/85 (61%), Positives = 63/85 (74%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           WG++ D VVM+DP +KRS+GFGF+T+S    VD A   RPH IDGR+VEPKRAV REE  
Sbjct: 44  WGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESG 103

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
           +P A  TVKKLFV G+K+D EE  L
Sbjct: 104 KPGAHVTVKKLFVGGIKEDTEEHHL 128



 Score = 74.9 bits (176), Expect = 3e-13
 Identities = 29/54 (53%), Positives = 42/54 (77%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFN 667
           LR+YF  +G I ++ ++TD+++GKKRGFGFV FDD+DPVD++ LQ+ H I   N
Sbjct: 128 LRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHN 181



 Score = 44.4 bits (100), Expect = 5e-04
 Identities = 18/65 (27%), Positives = 40/65 (61%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +G+I  + ++ D ++ + +GFGF+T+     VD+    + H I+G   E ++A+ R+E++
Sbjct: 135 YGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEMQ 194

Query: 435 RPEAS 449
             ++S
Sbjct: 195 EVQSS 199



 Score = 41.1 bits (92), Expect = 0.004
 Identities = 18/32 (56%), Positives = 22/32 (68%)
 Frame = +1

Query: 172 EPEHTRKLFIGGLDYRTTDSSLKEFYEHGEKL 267
           E E  RKLFIGGL + TT+ SL+ +YE   KL
Sbjct: 16  EKEQFRKLFIGGLSFETTEESLRNYYEQWGKL 47



 Score = 37.9 bits (84), Expect = 0.039
 Identities = 17/50 (34%), Positives = 24/50 (48%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           LR Y+  +G +    V+ D  + + RGFGFV F     VD     + H I
Sbjct: 37  LRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSI 86


>D28877-2|BAA06032.1|  341|Homo sapiens hnRNP A2 protein protein.
          Length = 341

 Score =  115 bits (276), Expect = 2e-25
 Identities = 52/85 (61%), Positives = 63/85 (74%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           WG++ D VVM+DP +KRS+GFGF+T+S    VD A   RPH IDGR+VEPKRAV REE  
Sbjct: 32  WGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESG 91

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
           +P A  TVKKLFV G+K+D EE  L
Sbjct: 92  KPGAHVTVKKLFVGGIKEDTEEHHL 116



 Score = 74.9 bits (176), Expect = 3e-13
 Identities = 29/54 (53%), Positives = 42/54 (77%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFN 667
           LR+YF  +G I ++ ++TD+++GKKRGFGFV FDD+DPVD++ LQ+ H I   N
Sbjct: 116 LRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHN 169



 Score = 44.4 bits (100), Expect = 5e-04
 Identities = 18/65 (27%), Positives = 40/65 (61%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +G+I  + ++ D ++ + +GFGF+T+     VD+    + H I+G   E ++A+ R+E++
Sbjct: 123 YGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEMQ 182

Query: 435 RPEAS 449
             ++S
Sbjct: 183 EVQSS 187



 Score = 41.1 bits (92), Expect = 0.004
 Identities = 18/32 (56%), Positives = 22/32 (68%)
 Frame = +1

Query: 172 EPEHTRKLFIGGLDYRTTDSSLKEFYEHGEKL 267
           E E  RKLFIGGL + TT+ SL+ +YE   KL
Sbjct: 4   EKEQFRKLFIGGLSFETTEESLRNYYEQWGKL 35



 Score = 37.9 bits (84), Expect = 0.039
 Identities = 17/50 (34%), Positives = 24/50 (48%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           LR Y+  +G +    V+ D  + + RGFGFV F     VD     + H I
Sbjct: 25  LRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSI 74


>D28877-1|BAA06031.1|  353|Homo sapiens hnRNP B1 protein protein.
          Length = 353

 Score =  115 bits (276), Expect = 2e-25
 Identities = 52/85 (61%), Positives = 63/85 (74%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           WG++ D VVM+DP +KRS+GFGF+T+S    VD A   RPH IDGR+VEPKRAV REE  
Sbjct: 44  WGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESG 103

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
           +P A  TVKKLFV G+K+D EE  L
Sbjct: 104 KPGAHVTVKKLFVGGIKEDTEEHHL 128



 Score = 74.9 bits (176), Expect = 3e-13
 Identities = 29/54 (53%), Positives = 42/54 (77%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFN 667
           LR+YF  +G I ++ ++TD+++GKKRGFGFV FDD+DPVD++ LQ+ H I   N
Sbjct: 128 LRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHN 181



 Score = 44.4 bits (100), Expect = 5e-04
 Identities = 18/65 (27%), Positives = 40/65 (61%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +G+I  + ++ D ++ + +GFGF+T+     VD+    + H I+G   E ++A+ R+E++
Sbjct: 135 YGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEMQ 194

Query: 435 RPEAS 449
             ++S
Sbjct: 195 EVQSS 199



 Score = 41.1 bits (92), Expect = 0.004
 Identities = 18/32 (56%), Positives = 22/32 (68%)
 Frame = +1

Query: 172 EPEHTRKLFIGGLDYRTTDSSLKEFYEHGEKL 267
           E E  RKLFIGGL + TT+ SL+ +YE   KL
Sbjct: 16  EKEQFRKLFIGGLSFETTEESLRNYYEQWGKL 47



 Score = 37.9 bits (84), Expect = 0.039
 Identities = 17/50 (34%), Positives = 24/50 (48%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           LR Y+  +G +    V+ D  + + RGFGFV F     VD     + H I
Sbjct: 37  LRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSI 86


>BC000506-1|AAH00506.3|  249|Homo sapiens HNRPA2B1 protein protein.
          Length = 249

 Score =  115 bits (276), Expect = 2e-25
 Identities = 52/85 (61%), Positives = 63/85 (74%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           WG++ D VVM+DP +KRS+GFGF+T+S    VD A   RPH IDGR+VEPKRAV REE  
Sbjct: 32  WGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESG 91

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
           +P A  TVKKLFV G+K+D EE  L
Sbjct: 92  KPGAHVTVKKLFVGGIKEDTEEHHL 116



 Score = 74.9 bits (176), Expect = 3e-13
 Identities = 29/54 (53%), Positives = 42/54 (77%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFN 667
           LR+YF  +G I ++ ++TD+++GKKRGFGFV FDD+DPVD++ LQ+ H I   N
Sbjct: 116 LRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHN 169



 Score = 44.8 bits (101), Expect = 3e-04
 Identities = 25/85 (29%), Positives = 49/85 (57%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +G+I  + ++ D ++ + +GFGF+T+     VD+    + H I+G   E ++A+ R+E+ 
Sbjct: 123 YGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEM- 181

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
             +    V  L VA + ++ EEED+
Sbjct: 182 --QEDLEVAILEVAPVMEE-EEEDM 203



 Score = 41.1 bits (92), Expect = 0.004
 Identities = 18/32 (56%), Positives = 22/32 (68%)
 Frame = +1

Query: 172 EPEHTRKLFIGGLDYRTTDSSLKEFYEHGEKL 267
           E E  RKLFIGGL + TT+ SL+ +YE   KL
Sbjct: 4   EKEQFRKLFIGGLSFETTEESLRNYYEQWGKL 35



 Score = 37.9 bits (84), Expect = 0.039
 Identities = 17/50 (34%), Positives = 24/50 (48%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           LR Y+  +G +    V+ D  + + RGFGFV F     VD     + H I
Sbjct: 25  LRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSI 74


>S63912-1|AAB27595.1|  269|Homo sapiens FBRNP protein.
          Length = 269

 Score =  109 bits (261), Expect = 1e-23
 Identities = 49/85 (57%), Positives = 63/85 (74%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           WG + D +VM+DP+TKRS+GFGF+TYS    VD A   RP K+DGR+VEPKRAV RE+  
Sbjct: 58  WGTLTDCLVMRDPQTKRSRGFGFVTYSCVTEVDAAIGARPFKVDGRVVEPKRAVSREDSV 117

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
           +P A  TVKK+FV  +K+D EE +L
Sbjct: 118 KPGAHLTVKKIFVGSIKEDTEEYNL 142



 Score = 62.5 bits (145), Expect = 2e-09
 Identities = 25/54 (46%), Positives = 38/54 (70%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFN 667
           LR+YF  +G I ++ V+ D+++GKKRGF  V FDD+D VD++ +Q+ H I   N
Sbjct: 142 LRDYFEKYGKIETIEVMEDRQSGKKRGFASVTFDDHDTVDKIVVQKYHTINGHN 195



 Score = 48.8 bits (111), Expect = 2e-05
 Identities = 21/34 (61%), Positives = 25/34 (73%)
 Frame = +1

Query: 151 ESGDDYEEPEHTRKLFIGGLDYRTTDSSLKEFYE 252
           E G D +EPE  RKLFIGGL + TTD SL+E +E
Sbjct: 23  EEGHDPKEPEQLRKLFIGGLSFETTDDSLREHFE 56



 Score = 37.9 bits (84), Expect = 0.039
 Identities = 18/65 (27%), Positives = 37/65 (56%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +G+I  + VM+D ++ + +GF  +T+     VD+    + H I+G   E K+A+ + ++ 
Sbjct: 149 YGKIETIEVMEDRQSGKKRGFASVTFDDHDTVDKIVVQKYHTINGHNCEVKKALAK-QVM 207

Query: 435 RPEAS 449
           +P  S
Sbjct: 208 QPAGS 212



 Score = 37.1 bits (82), Expect = 0.069
 Identities = 16/40 (40%), Positives = 23/40 (57%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVD 625
           LRE+F  +G +    V+ D +T + RGFGFV +     VD
Sbjct: 51  LREHFEKWGTLTDCLVMRDPQTKRSRGFGFVTYSCVTEVD 90


>U23803-1|AAA65094.1|  305|Homo sapiens heterogeneous
           ribonucleoprotein A0 protein.
          Length = 305

 Score = 95.9 bits (228), Expect = 1e-19
 Identities = 47/86 (54%), Positives = 57/86 (66%)
 Frame = +3

Query: 252 AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEI 431
           A+G + D VV+ +P+TKRS+ FGF+TYS     D A    PH +DG  VE KRAV RE+ 
Sbjct: 29  AFGTLTDCVVVVNPQTKRSRCFGFVTYSNVEEADAAMAASPHAVDGNTVELKRAVSREDS 88

Query: 432 KRPEASATVKKLFVAGLKQDIEEEDL 509
            RP A A VKKLFV GLK D+ E DL
Sbjct: 89  ARPGAHAKVKKLFVGGLKGDVAEGDL 114



 Score = 62.1 bits (144), Expect = 2e-09
 Identities = 32/85 (37%), Positives = 49/85 (57%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFNIWM*KK 685
           L E+FS FG +    ++ DK++GKKRGFGFV F ++D  D+  + + H I+   + + K 
Sbjct: 114 LIEHFSQFGTVEKAEIIADKQSGKKRGFGFVYFQNHDAADKAAVVKFHPIQGHRVEVKKA 173

Query: 686 PISEN*HVWAGVMIRGGPRSTRGVR 760
              E+ +   G    GG RS+RG R
Sbjct: 174 VPKEDIYSGGG---GGGSRSSRGGR 195



 Score = 43.6 bits (98), Expect = 8e-04
 Identities = 19/59 (32%), Positives = 34/59 (57%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEI 431
           +G +    ++ D ++ + +GFGF+ +      D+A   + H I G  VE K+AVP+E+I
Sbjct: 121 FGTVEKAEIIADKQSGKKRGFGFVYFQNHDAADKAAVVKFHPIQGHRVEVKKAVPKEDI 179



 Score = 35.5 bits (78), Expect = 0.21
 Identities = 15/50 (30%), Positives = 24/50 (48%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           LR +F  FG +    VV + +T + R FGFV + + +  D       H +
Sbjct: 23  LRGHFEAFGTLTDCVVVVNPQTKRSRCFGFVTYSNVEEADAAMAASPHAV 72


>CR456986-1|CAG33267.1|  305|Homo sapiens HNRPA0 protein.
          Length = 305

 Score = 95.9 bits (228), Expect = 1e-19
 Identities = 47/86 (54%), Positives = 57/86 (66%)
 Frame = +3

Query: 252 AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEI 431
           A+G + D VV+ +P+TKRS+ FGF+TYS     D A    PH +DG  VE KRAV RE+ 
Sbjct: 29  AFGTLTDCVVVVNPQTKRSRCFGFVTYSNVEEADAAMAASPHAVDGNTVELKRAVSREDS 88

Query: 432 KRPEASATVKKLFVAGLKQDIEEEDL 509
            RP A A VKKLFV GLK D+ E DL
Sbjct: 89  ARPGAHAKVKKLFVGGLKGDVAEGDL 114



 Score = 62.1 bits (144), Expect = 2e-09
 Identities = 32/85 (37%), Positives = 49/85 (57%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFNIWM*KK 685
           L E+FS FG +    ++ DK++GKKRGFGFV F ++D  D+  + + H I+   + + K 
Sbjct: 114 LIEHFSQFGTVEKAEIIADKQSGKKRGFGFVYFQNHDAADKAAVVKFHPIQGHRVEVKKA 173

Query: 686 PISEN*HVWAGVMIRGGPRSTRGVR 760
              E+ +   G    GG RS+RG R
Sbjct: 174 VPKEDIYSGGG---GGGSRSSRGGR 195



 Score = 43.6 bits (98), Expect = 8e-04
 Identities = 19/59 (32%), Positives = 34/59 (57%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEI 431
           +G +    ++ D ++ + +GFGF+ +      D+A   + H I G  VE K+AVP+E+I
Sbjct: 121 FGTVEKAEIIADKQSGKKRGFGFVYFQNHDAADKAAVVKFHPIQGHRVEVKKAVPKEDI 179



 Score = 35.5 bits (78), Expect = 0.21
 Identities = 15/50 (30%), Positives = 24/50 (48%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           LR +F  FG +    VV + +T + R FGFV + + +  D       H +
Sbjct: 23  LRGHFEAFGTLTDCVVVVNPQTKRSRCFGFVTYSNVEEADAAMAASPHAV 72


>BC030249-1|AAH30249.1|  305|Homo sapiens heterogeneous nuclear
           ribonucleoprotein A0 protein.
          Length = 305

 Score = 95.9 bits (228), Expect = 1e-19
 Identities = 47/86 (54%), Positives = 57/86 (66%)
 Frame = +3

Query: 252 AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEI 431
           A+G + D VV+ +P+TKRS+ FGF+TYS     D A    PH +DG  VE KRAV RE+ 
Sbjct: 29  AFGTLTDCVVVVNPQTKRSRCFGFVTYSNVEEADAAMAASPHAVDGNTVELKRAVSREDS 88

Query: 432 KRPEASATVKKLFVAGLKQDIEEEDL 509
            RP A A VKKLFV GLK D+ E DL
Sbjct: 89  ARPGAHAKVKKLFVGGLKGDVAEGDL 114



 Score = 62.1 bits (144), Expect = 2e-09
 Identities = 32/85 (37%), Positives = 49/85 (57%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFNIWM*KK 685
           L E+FS FG +    ++ DK++GKKRGFGFV F ++D  D+  + + H I+   + + K 
Sbjct: 114 LIEHFSQFGTVEKAEIIADKQSGKKRGFGFVYFQNHDAADKAAVVKFHPIQGHRVEVKKA 173

Query: 686 PISEN*HVWAGVMIRGGPRSTRGVR 760
              E+ +   G    GG RS+RG R
Sbjct: 174 VPKEDIYSGGG---GGGSRSSRGGR 195



 Score = 43.6 bits (98), Expect = 8e-04
 Identities = 19/59 (32%), Positives = 34/59 (57%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEI 431
           +G +    ++ D ++ + +GFGF+ +      D+A   + H I G  VE K+AVP+E+I
Sbjct: 121 FGTVEKAEIIADKQSGKKRGFGFVYFQNHDAADKAAVVKFHPIQGHRVEVKKAVPKEDI 179



 Score = 35.5 bits (78), Expect = 0.21
 Identities = 15/50 (30%), Positives = 24/50 (48%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           LR +F  FG +    VV + +T + R FGFV + + +  D       H +
Sbjct: 23  LRGHFEAFGTLTDCVVVVNPQTKRSRCFGFVTYSNVEEADAAMAASPHAV 72


>BC028976-1|AAH28976.1|  305|Homo sapiens heterogeneous nuclear
           ribonucleoprotein A0 protein.
          Length = 305

 Score = 95.9 bits (228), Expect = 1e-19
 Identities = 47/86 (54%), Positives = 57/86 (66%)
 Frame = +3

Query: 252 AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEI 431
           A+G + D VV+ +P+TKRS+ FGF+TYS     D A    PH +DG  VE KRAV RE+ 
Sbjct: 29  AFGTLTDCVVVVNPQTKRSRCFGFVTYSNVEEADAAMAASPHAVDGNTVELKRAVSREDS 88

Query: 432 KRPEASATVKKLFVAGLKQDIEEEDL 509
            RP A A VKKLFV GLK D+ E DL
Sbjct: 89  ARPGAHAKVKKLFVGGLKGDVAEGDL 114



 Score = 62.1 bits (144), Expect = 2e-09
 Identities = 32/85 (37%), Positives = 49/85 (57%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFNIWM*KK 685
           L E+FS FG +    ++ DK++GKKRGFGFV F ++D  D+  + + H I+   + + K 
Sbjct: 114 LIEHFSQFGTVEKAEIIADKQSGKKRGFGFVYFQNHDAADKAAVVKFHPIQGHRVEVKKA 173

Query: 686 PISEN*HVWAGVMIRGGPRSTRGVR 760
              E+ +   G    GG RS+RG R
Sbjct: 174 VPKEDIYSGGG---GGGSRSSRGGR 195



 Score = 43.6 bits (98), Expect = 8e-04
 Identities = 19/59 (32%), Positives = 34/59 (57%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEI 431
           +G +    ++ D ++ + +GFGF+ +      D+A   + H I G  VE K+AVP+E+I
Sbjct: 121 FGTVEKAEIIADKQSGKKRGFGFVYFQNHDAADKAAVVKFHPIQGHRVEVKKAVPKEDI 179



 Score = 35.5 bits (78), Expect = 0.21
 Identities = 15/50 (30%), Positives = 24/50 (48%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           LR +F  FG +    VV + +T + R FGFV + + +  D       H +
Sbjct: 23  LRGHFEAFGTLTDCVVVVNPQTKRSRCFGFVTYSNVEEADAAMAASPHAV 72


>BC019271-1|AAH19271.1|  305|Homo sapiens heterogeneous nuclear
           ribonucleoprotein A0 protein.
          Length = 305

 Score = 95.9 bits (228), Expect = 1e-19
 Identities = 47/86 (54%), Positives = 57/86 (66%)
 Frame = +3

Query: 252 AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEI 431
           A+G + D VV+ +P+TKRS+ FGF+TYS     D A    PH +DG  VE KRAV RE+ 
Sbjct: 29  AFGTLTDCVVVVNPQTKRSRCFGFVTYSNVEEADAAMAASPHAVDGNTVELKRAVSREDS 88

Query: 432 KRPEASATVKKLFVAGLKQDIEEEDL 509
            RP A A VKKLFV GLK D+ E DL
Sbjct: 89  ARPGAHAKVKKLFVGGLKGDVAEGDL 114



 Score = 62.1 bits (144), Expect = 2e-09
 Identities = 32/85 (37%), Positives = 49/85 (57%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFNIWM*KK 685
           L E+FS FG +    ++ DK++GKKRGFGFV F ++D  D+  + + H I+   + + K 
Sbjct: 114 LIEHFSQFGTVEKAEIIADKQSGKKRGFGFVYFQNHDAADKAAVVKFHPIQGHRVEVKKA 173

Query: 686 PISEN*HVWAGVMIRGGPRSTRGVR 760
              E+ +   G    GG RS+RG R
Sbjct: 174 VPKEDIYSGGG---GGGSRSSRGGR 195



 Score = 43.6 bits (98), Expect = 8e-04
 Identities = 19/59 (32%), Positives = 34/59 (57%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEI 431
           +G +    ++ D ++ + +GFGF+ +      D+A   + H I G  VE K+AVP+E+I
Sbjct: 121 FGTVEKAEIIADKQSGKKRGFGFVYFQNHDAADKAAVVKFHPIQGHRVEVKKAVPKEDI 179



 Score = 35.5 bits (78), Expect = 0.21
 Identities = 15/50 (30%), Positives = 24/50 (48%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           LR +F  FG +    VV + +T + R FGFV + + +  D       H +
Sbjct: 23  LRGHFEAFGTLTDCVVVVNPQTKRSRCFGFVTYSNVEEADAAMAASPHAV 72


>BC018949-1|AAH18949.1|  305|Homo sapiens heterogeneous nuclear
           ribonucleoprotein A0 protein.
          Length = 305

 Score = 95.9 bits (228), Expect = 1e-19
 Identities = 47/86 (54%), Positives = 57/86 (66%)
 Frame = +3

Query: 252 AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEI 431
           A+G + D VV+ +P+TKRS+ FGF+TYS     D A    PH +DG  VE KRAV RE+ 
Sbjct: 29  AFGTLTDCVVVVNPQTKRSRCFGFVTYSNVEEADAAMAASPHAVDGNTVELKRAVSREDS 88

Query: 432 KRPEASATVKKLFVAGLKQDIEEEDL 509
            RP A A VKKLFV GLK D+ E DL
Sbjct: 89  ARPGAHAKVKKLFVGGLKGDVAEGDL 114



 Score = 62.1 bits (144), Expect = 2e-09
 Identities = 32/85 (37%), Positives = 49/85 (57%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFNIWM*KK 685
           L E+FS FG +    ++ DK++GKKRGFGFV F ++D  D+  + + H I+   + + K 
Sbjct: 114 LIEHFSQFGTVEKAEIIADKQSGKKRGFGFVYFQNHDAADKAAVVKFHPIQGHRVEVKKA 173

Query: 686 PISEN*HVWAGVMIRGGPRSTRGVR 760
              E+ +   G    GG RS+RG R
Sbjct: 174 VPKEDIYSGGG---GGGSRSSRGGR 195



 Score = 43.6 bits (98), Expect = 8e-04
 Identities = 19/59 (32%), Positives = 34/59 (57%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEI 431
           +G +    ++ D ++ + +GFGF+ +      D+A   + H I G  VE K+AVP+E+I
Sbjct: 121 FGTVEKAEIIADKQSGKKRGFGFVYFQNHDAADKAAVVKFHPIQGHRVEVKKAVPKEDI 179



 Score = 35.5 bits (78), Expect = 0.21
 Identities = 15/50 (30%), Positives = 24/50 (48%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           LR +F  FG +    VV + +T + R FGFV + + +  D       H +
Sbjct: 23  LRGHFEAFGTLTDCVVVVNPQTKRSRCFGFVTYSNVEEADAAMAASPHAV 72


>BC012980-1|AAH12980.1|  305|Homo sapiens heterogeneous nuclear
           ribonucleoprotein A0 protein.
          Length = 305

 Score = 95.9 bits (228), Expect = 1e-19
 Identities = 47/86 (54%), Positives = 57/86 (66%)
 Frame = +3

Query: 252 AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEI 431
           A+G + D VV+ +P+TKRS+ FGF+TYS     D A    PH +DG  VE KRAV RE+ 
Sbjct: 29  AFGTLTDCVVVVNPQTKRSRCFGFVTYSNVEEADAAMAASPHAVDGNTVELKRAVSREDS 88

Query: 432 KRPEASATVKKLFVAGLKQDIEEEDL 509
            RP A A VKKLFV GLK D+ E DL
Sbjct: 89  ARPGAHAKVKKLFVGGLKGDVAEGDL 114



 Score = 62.1 bits (144), Expect = 2e-09
 Identities = 32/85 (37%), Positives = 49/85 (57%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFNIWM*KK 685
           L E+FS FG +    ++ DK++GKKRGFGFV F ++D  D+  + + H I+   + + K 
Sbjct: 114 LIEHFSQFGTVEKAEIIADKQSGKKRGFGFVYFQNHDAADKAAVVKFHPIQGHRVEVKKA 173

Query: 686 PISEN*HVWAGVMIRGGPRSTRGVR 760
              E+ +   G    GG RS+RG R
Sbjct: 174 VPKEDIYSGGG---GGGSRSSRGGR 195



 Score = 43.6 bits (98), Expect = 8e-04
 Identities = 19/59 (32%), Positives = 34/59 (57%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEI 431
           +G +    ++ D ++ + +GFGF+ +      D+A   + H I G  VE K+AVP+E+I
Sbjct: 121 FGTVEKAEIIADKQSGKKRGFGFVYFQNHDAADKAAVVKFHPIQGHRVEVKKAVPKEDI 179



 Score = 35.5 bits (78), Expect = 0.21
 Identities = 15/50 (30%), Positives = 24/50 (48%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           LR +F  FG +    VV + +T + R FGFV + + +  D       H +
Sbjct: 23  LRGHFEAFGTLTDCVVVVNPQTKRSRCFGFVTYSNVEEADAAMAASPHAV 72


>BC011972-1|AAH11972.1|  305|Homo sapiens heterogeneous nuclear
           ribonucleoprotein A0 protein.
          Length = 305

 Score = 95.9 bits (228), Expect = 1e-19
 Identities = 47/86 (54%), Positives = 57/86 (66%)
 Frame = +3

Query: 252 AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEI 431
           A+G + D VV+ +P+TKRS+ FGF+TYS     D A    PH +DG  VE KRAV RE+ 
Sbjct: 29  AFGTLTDCVVVVNPQTKRSRCFGFVTYSNVEEADAAMAASPHAVDGNTVELKRAVSREDS 88

Query: 432 KRPEASATVKKLFVAGLKQDIEEEDL 509
            RP A A VKKLFV GLK D+ E DL
Sbjct: 89  ARPGAHAKVKKLFVGGLKGDVAEGDL 114



 Score = 62.1 bits (144), Expect = 2e-09
 Identities = 32/85 (37%), Positives = 49/85 (57%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFNIWM*KK 685
           L E+FS FG +    ++ DK++GKKRGFGFV F ++D  D+  + + H I+   + + K 
Sbjct: 114 LIEHFSQFGTVEKAEIIADKQSGKKRGFGFVYFQNHDAADKAAVVKFHPIQGHRVEVKKA 173

Query: 686 PISEN*HVWAGVMIRGGPRSTRGVR 760
              E+ +   G    GG RS+RG R
Sbjct: 174 VPKEDIYSGGG---GGGSRSSRGGR 195



 Score = 43.6 bits (98), Expect = 8e-04
 Identities = 19/59 (32%), Positives = 34/59 (57%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEI 431
           +G +    ++ D ++ + +GFGF+ +      D+A   + H I G  VE K+AVP+E+I
Sbjct: 121 FGTVEKAEIIADKQSGKKRGFGFVYFQNHDAADKAAVVKFHPIQGHRVEVKKAVPKEDI 179



 Score = 35.5 bits (78), Expect = 0.21
 Identities = 15/50 (30%), Positives = 24/50 (48%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           LR +F  FG +    VV + +T + R FGFV + + +  D       H +
Sbjct: 23  LRGHFEAFGTLTDCVVVVNPQTKRSRCFGFVTYSNVEEADAAMAASPHAV 72


>BC009284-1|AAH09284.1|  305|Homo sapiens heterogeneous nuclear
           ribonucleoprotein A0 protein.
          Length = 305

 Score = 95.9 bits (228), Expect = 1e-19
 Identities = 47/86 (54%), Positives = 57/86 (66%)
 Frame = +3

Query: 252 AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEI 431
           A+G + D VV+ +P+TKRS+ FGF+TYS     D A    PH +DG  VE KRAV RE+ 
Sbjct: 29  AFGTLTDCVVVVNPQTKRSRCFGFVTYSNVEEADAAMAASPHAVDGNTVELKRAVSREDS 88

Query: 432 KRPEASATVKKLFVAGLKQDIEEEDL 509
            RP A A VKKLFV GLK D+ E DL
Sbjct: 89  ARPGAHAKVKKLFVGGLKGDVAEGDL 114



 Score = 62.1 bits (144), Expect = 2e-09
 Identities = 32/85 (37%), Positives = 49/85 (57%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFNIWM*KK 685
           L E+FS FG +    ++ DK++GKKRGFGFV F ++D  D+  + + H I+   + + K 
Sbjct: 114 LIEHFSQFGTVEKAEIIADKQSGKKRGFGFVYFQNHDAADKAAVVKFHPIQGHRVEVKKA 173

Query: 686 PISEN*HVWAGVMIRGGPRSTRGVR 760
              E+ +   G    GG RS+RG R
Sbjct: 174 VPKEDIYSGGG---GGGSRSSRGGR 195



 Score = 43.6 bits (98), Expect = 8e-04
 Identities = 19/59 (32%), Positives = 34/59 (57%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEI 431
           +G +    ++ D ++ + +GFGF+ +      D+A   + H I G  VE K+AVP+E+I
Sbjct: 121 FGTVEKAEIIADKQSGKKRGFGFVYFQNHDAADKAAVVKFHPIQGHRVEVKKAVPKEDI 179



 Score = 35.5 bits (78), Expect = 0.21
 Identities = 15/50 (30%), Positives = 24/50 (48%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           LR +F  FG +    VV + +T + R FGFV + + +  D       H +
Sbjct: 23  LRGHFEAFGTLTDCVVVVNPQTKRSRCFGFVTYSNVEEADAAMAASPHAV 72


>BC007271-1|AAH07271.1|  305|Homo sapiens heterogeneous nuclear
           ribonucleoprotein A0 protein.
          Length = 305

 Score = 95.9 bits (228), Expect = 1e-19
 Identities = 47/86 (54%), Positives = 57/86 (66%)
 Frame = +3

Query: 252 AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEI 431
           A+G + D VV+ +P+TKRS+ FGF+TYS     D A    PH +DG  VE KRAV RE+ 
Sbjct: 29  AFGTLTDCVVVVNPQTKRSRCFGFVTYSNVEEADAAMAASPHAVDGNTVELKRAVSREDS 88

Query: 432 KRPEASATVKKLFVAGLKQDIEEEDL 509
            RP A A VKKLFV GLK D+ E DL
Sbjct: 89  ARPGAHAKVKKLFVGGLKGDVAEGDL 114



 Score = 62.1 bits (144), Expect = 2e-09
 Identities = 32/85 (37%), Positives = 49/85 (57%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFNIWM*KK 685
           L E+FS FG +    ++ DK++GKKRGFGFV F ++D  D+  + + H I+   + + K 
Sbjct: 114 LIEHFSQFGTVEKAEIIADKQSGKKRGFGFVYFQNHDAADKAAVVKFHPIQGHRVEVKKA 173

Query: 686 PISEN*HVWAGVMIRGGPRSTRGVR 760
              E+ +   G    GG RS+RG R
Sbjct: 174 VPKEDIYSGGG---GGGSRSSRGGR 195



 Score = 43.6 bits (98), Expect = 8e-04
 Identities = 19/59 (32%), Positives = 34/59 (57%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEI 431
           +G +    ++ D ++ + +GFGF+ +      D+A   + H I G  VE K+AVP+E+I
Sbjct: 121 FGTVEKAEIIADKQSGKKRGFGFVYFQNHDAADKAAVVKFHPIQGHRVEVKKAVPKEDI 179



 Score = 35.5 bits (78), Expect = 0.21
 Identities = 15/50 (30%), Positives = 24/50 (48%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           LR +F  FG +    VV + +T + R FGFV + + +  D       H +
Sbjct: 23  LRGHFEAFGTLTDCVVVVNPQTKRSRCFGFVTYSNVEEADAAMAASPHAV 72


>BC001008-1|AAH01008.1|  305|Homo sapiens heterogeneous nuclear
           ribonucleoprotein A0 protein.
          Length = 305

 Score = 95.9 bits (228), Expect = 1e-19
 Identities = 47/86 (54%), Positives = 57/86 (66%)
 Frame = +3

Query: 252 AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEI 431
           A+G + D VV+ +P+TKRS+ FGF+TYS     D A    PH +DG  VE KRAV RE+ 
Sbjct: 29  AFGTLTDCVVVVNPQTKRSRCFGFVTYSNVEEADAAMAASPHAVDGNTVELKRAVSREDS 88

Query: 432 KRPEASATVKKLFVAGLKQDIEEEDL 509
            RP A A VKKLFV GLK D+ E DL
Sbjct: 89  ARPGAHAKVKKLFVGGLKGDVAEGDL 114



 Score = 62.1 bits (144), Expect = 2e-09
 Identities = 32/85 (37%), Positives = 49/85 (57%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFNIWM*KK 685
           L E+FS FG +    ++ DK++GKKRGFGFV F ++D  D+  + + H I+   + + K 
Sbjct: 114 LIEHFSQFGTVEKAEIIADKQSGKKRGFGFVYFQNHDAADKAAVVKFHPIQGHRVEVKKA 173

Query: 686 PISEN*HVWAGVMIRGGPRSTRGVR 760
              E+ +   G    GG RS+RG R
Sbjct: 174 VPKEDIYSGGG---GGGSRSSRGGR 195



 Score = 43.6 bits (98), Expect = 8e-04
 Identities = 19/59 (32%), Positives = 34/59 (57%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEI 431
           +G +    ++ D ++ + +GFGF+ +      D+A   + H I G  VE K+AVP+E+I
Sbjct: 121 FGTVEKAEIIADKQSGKKRGFGFVYFQNHDAADKAAVVKFHPIQGHRVEVKKAVPKEDI 179



 Score = 35.5 bits (78), Expect = 0.21
 Identities = 15/50 (30%), Positives = 24/50 (48%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           LR +F  FG +    VV + +T + R FGFV + + +  D       H +
Sbjct: 23  LRGHFEAFGTLTDCVVVVNPQTKRSRCFGFVTYSNVEEADAAMAASPHAV 72


>BC001526-1|AAH01526.1|  328|Homo sapiens musashi homolog 2
           (Drosophila) protein.
          Length = 328

 Score = 74.1 bits (174), Expect = 5e-13
 Identities = 34/86 (39%), Positives = 54/86 (62%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GEI + +VM+DP TKRS+GFGF+T++    VD+      H++D + ++PK A PR    
Sbjct: 44  FGEIRECMVMRDPTTKRSRGFGFVTFADPASVDKVLGQPHHELDSKTIDPKVAFPRR--A 101

Query: 435 RPEASATVKKLFVAGLKQDIEEEDLE 512
           +P+     KK+FV GL  +   ED++
Sbjct: 102 QPKMVTRTKKIFVGGLSANTVVEDVK 127



 Score = 50.4 bits (115), Expect = 7e-06
 Identities = 24/50 (48%), Positives = 31/50 (62%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           LR+YFS FG I    V+ D  T + RGFGFV F D   VD+V  Q +H++
Sbjct: 37  LRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFADPASVDKVLGQPHHEL 86



 Score = 50.4 bits (115), Expect = 7e-06
 Identities = 22/69 (31%), Positives = 42/69 (60%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           +K+    +G++ D ++M D  T R +GFGF+T+    +V++      H+I+ ++VE K+A
Sbjct: 126 VKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFENEDVVEKVCEIHFHEINNKMVECKKA 185

Query: 414 VPREEIKRP 440
            P+E +  P
Sbjct: 186 QPKEVMFPP 194



 Score = 50.0 bits (114), Expect = 9e-06
 Identities = 20/50 (40%), Positives = 32/50 (64%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           +++YF  FG +    ++ DK T + RGFGFV F++ D V++VC    H+I
Sbjct: 126 VKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFENEDVVEKVCEIHFHEI 175


>AK093888-1|BAC04244.1|  251|Homo sapiens protein ( Homo sapiens
           cDNA FLJ36569 fis, clone TRACH2010824, highly similar to
           Ribonucleoprotein. ).
          Length = 251

 Score = 74.1 bits (174), Expect = 5e-13
 Identities = 34/86 (39%), Positives = 54/86 (62%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GEI + +VM+DP TKRS+GFGF+T++    VD+      H++D + ++PK A PR    
Sbjct: 40  FGEIRECMVMRDPTTKRSRGFGFVTFADPASVDKVLGQPHHELDSKTIDPKVAFPRR--A 97

Query: 435 RPEASATVKKLFVAGLKQDIEEEDLE 512
           +P+     KK+FV GL  +   ED++
Sbjct: 98  QPKMVTRTKKIFVGGLSANTVVEDVK 123



 Score = 50.4 bits (115), Expect = 7e-06
 Identities = 24/50 (48%), Positives = 31/50 (62%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           LR+YFS FG I    V+ D  T + RGFGFV F D   VD+V  Q +H++
Sbjct: 33  LRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFADPASVDKVLGQPHHEL 82



 Score = 50.4 bits (115), Expect = 7e-06
 Identities = 22/69 (31%), Positives = 42/69 (60%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           +K+    +G++ D ++M D  T R +GFGF+T+    +V++      H+I+ ++VE K+A
Sbjct: 122 VKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFENEDVVEKVCEIHFHEINNKMVECKKA 181

Query: 414 VPREEIKRP 440
            P+E +  P
Sbjct: 182 QPKEVMFPP 190



 Score = 50.0 bits (114), Expect = 9e-06
 Identities = 20/50 (40%), Positives = 32/50 (64%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           +++YF  FG +    ++ DK T + RGFGFV F++ D V++VC    H+I
Sbjct: 122 VKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFENEDVVEKVCEIHFHEI 171


>U02019-1|AAC50056.1|  286|Homo sapiens p37 AUF1 protein.
          Length = 286

 Score = 73.7 bits (173), Expect = 6e-13
 Identities = 33/85 (38%), Positives = 53/85 (62%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GE+VD  +  DP T RS+GFGF+ + ++  VD+  + + HK++G++++PKRA      K
Sbjct: 99  FGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKLNGKVIDPKRA------K 152

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
             +    VKK+FV GL  D  EE +
Sbjct: 153 AMKTKEPVKKIFVGGLSPDTPEEKI 177



 Score = 53.2 bits (122), Expect = 1e-06
 Identities = 22/53 (41%), Positives = 36/53 (67%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           ++ L++YFS FG +V  ++  D  TG+ RGFGFV F + + VD+V  Q+ H++
Sbjct: 89  KKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKL 141



 Score = 49.6 bits (113), Expect = 1e-05
 Identities = 18/51 (35%), Positives = 33/51 (64%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           ++REYF  FG + S+ +  D +T K+RGF F+ F + +PV ++  ++ H +
Sbjct: 176 KIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNV 226



 Score = 35.5 bits (78), Expect = 0.21
 Identities = 17/70 (24%), Positives = 35/70 (50%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           I+     +GE+  + +  D KT + +GF FIT+ +   V +    + H +     E K A
Sbjct: 177 IREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVA 236

Query: 414 VPREEIKRPE 443
           + +E+ ++ +
Sbjct: 237 MSKEQYQQQQ 246


>M94630-1|AAA35781.1|  328|Homo sapiens DNA-binding protein protein.
          Length = 328

 Score = 73.7 bits (173), Expect = 6e-13
 Identities = 33/85 (38%), Positives = 53/85 (62%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GE+VD  +  DP T RS+GFGF+ + ++  VD+  + + HK++G++++PKRA      K
Sbjct: 99  FGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKLNGKVIDPKRA------K 152

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
             +    VKK+FV GL  D  EE +
Sbjct: 153 AMKTKEPVKKIFVGGLSPDTPEEKI 177



 Score = 53.2 bits (122), Expect = 1e-06
 Identities = 22/53 (41%), Positives = 36/53 (67%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           ++ L++YFS FG +V  ++  D  TG+ RGFGFV F + + VD+V  Q+ H++
Sbjct: 89  KKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKL 141



 Score = 47.2 bits (107), Expect = 6e-05
 Identities = 17/51 (33%), Positives = 32/51 (62%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           ++REYF  FG + S+ +  D +T K+RG  F+ F + +PV ++  ++ H +
Sbjct: 176 KIREYFGGFGEVESIELPMDNKTNKRRGLCFITFKEEEPVKKIMEKKYHNV 226



 Score = 33.1 bits (72), Expect = 1.1
 Identities = 16/70 (22%), Positives = 34/70 (48%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           I+     +GE+  + +  D KT + +G  FIT+ +   V +    + H +     E K A
Sbjct: 177 IREYFGGFGEVESIELPMDNKTNKRRGLCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVA 236

Query: 414 VPREEIKRPE 443
           + +E+ ++ +
Sbjct: 237 MSKEQYQQQQ 246


>D55674-1|BAA09525.1|  355|Homo sapiens heterogeneous nuclear
           ribonucleoprotein D (hnRNP D) protein.
          Length = 355

 Score = 73.7 bits (173), Expect = 6e-13
 Identities = 33/85 (38%), Positives = 53/85 (62%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GE+VD  +  DP T RS+GFGF+ + ++  VD+  + + HK++G++++PKRA      K
Sbjct: 120 FGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKLNGKVIDPKRA------K 173

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
             +    VKK+FV GL  D  EE +
Sbjct: 174 AMKTKEPVKKIFVGGLSPDTPEEKI 198



 Score = 53.2 bits (122), Expect = 1e-06
 Identities = 22/53 (41%), Positives = 36/53 (67%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           ++ L++YFS FG +V  ++  D  TG+ RGFGFV F + + VD+V  Q+ H++
Sbjct: 110 KKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKL 162



 Score = 49.6 bits (113), Expect = 1e-05
 Identities = 18/51 (35%), Positives = 33/51 (64%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           ++REYF  FG + S+ +  D +T K+RGF F+ F + +PV ++  ++ H +
Sbjct: 197 KIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNV 247



 Score = 35.5 bits (78), Expect = 0.21
 Identities = 17/70 (24%), Positives = 35/70 (50%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           I+     +GE+  + +  D KT + +GF FIT+ +   V +    + H +     E K A
Sbjct: 198 IREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVA 257

Query: 414 VPREEIKRPE 443
           + +E+ ++ +
Sbjct: 258 MSKEQYQQQQ 267


>D55673-1|BAA09524.1|  215|Homo sapiens heterogeneous nuclear
           ribonucleoprotein D (hnRNP D) protein.
          Length = 215

 Score = 73.7 bits (173), Expect = 6e-13
 Identities = 33/85 (38%), Positives = 53/85 (62%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GE+VD  +  DP T RS+GFGF+ + ++  VD+  + + HK++G++++PKRA      K
Sbjct: 29  FGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKLNGKVIDPKRA------K 82

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
             +    VKK+FV GL  D  EE +
Sbjct: 83  AMKTKEPVKKIFVGGLSPDTPEEKI 107



 Score = 53.2 bits (122), Expect = 1e-06
 Identities = 22/53 (41%), Positives = 36/53 (67%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           ++ L++YFS FG +V  ++  D  TG+ RGFGFV F + + VD+V  Q+ H++
Sbjct: 19  KKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKL 71



 Score = 49.6 bits (113), Expect = 1e-05
 Identities = 18/51 (35%), Positives = 33/51 (64%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           ++REYF  FG + S+ +  D +T K+RGF F+ F + +PV ++  ++ H +
Sbjct: 106 KIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNV 156



 Score = 35.5 bits (78), Expect = 0.21
 Identities = 17/70 (24%), Positives = 35/70 (50%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           I+     +GE+  + +  D KT + +GF FIT+ +   V +    + H +     E K A
Sbjct: 107 IREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVA 166

Query: 414 VPREEIKRPE 443
           + +E+ ++ +
Sbjct: 167 MSKEQYQQQQ 176


>D55672-1|BAA09523.1|  306|Homo sapiens heterogeneous nuclear
           ribonucleoprotein D (hnRNP D) protein.
          Length = 306

 Score = 73.7 bits (173), Expect = 6e-13
 Identities = 33/85 (38%), Positives = 53/85 (62%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GE+VD  +  DP T RS+GFGF+ + ++  VD+  + + HK++G++++PKRA      K
Sbjct: 120 FGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKLNGKVIDPKRA------K 173

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
             +    VKK+FV GL  D  EE +
Sbjct: 174 AMKTKEPVKKIFVGGLSPDTPEEKI 198



 Score = 53.2 bits (122), Expect = 1e-06
 Identities = 22/53 (41%), Positives = 36/53 (67%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           ++ L++YFS FG +V  ++  D  TG+ RGFGFV F + + VD+V  Q+ H++
Sbjct: 110 KKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKL 162



 Score = 49.6 bits (113), Expect = 1e-05
 Identities = 18/51 (35%), Positives = 33/51 (64%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           ++REYF  FG + S+ +  D +T K+RGF F+ F + +PV ++  ++ H +
Sbjct: 197 KIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNV 247



 Score = 35.5 bits (78), Expect = 0.21
 Identities = 17/70 (24%), Positives = 35/70 (50%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           I+     +GE+  + +  D KT + +GF FIT+ +   V +    + H +     E K A
Sbjct: 198 IREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVA 257

Query: 414 VPREEIKRPE 443
           + +E+ ++ +
Sbjct: 258 MSKEQYQQQQ 267


>D55671-1|BAA09522.1|  267|Homo sapiens heterogeneous nuclear
           ribonucleoprotein D (hnRNP D) protein.
          Length = 267

 Score = 73.7 bits (173), Expect = 6e-13
 Identities = 33/85 (38%), Positives = 53/85 (62%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GE+VD  +  DP T RS+GFGF+ + ++  VD+  + + HK++G++++PKRA      K
Sbjct: 32  FGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKLNGKVIDPKRA------K 85

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
             +    VKK+FV GL  D  EE +
Sbjct: 86  AMKTKEPVKKIFVGGLSPDTPEEKI 110



 Score = 53.2 bits (122), Expect = 1e-06
 Identities = 22/53 (41%), Positives = 36/53 (67%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           ++ L++YFS FG +V  ++  D  TG+ RGFGFV F + + VD+V  Q+ H++
Sbjct: 22  KKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKL 74



 Score = 49.6 bits (113), Expect = 1e-05
 Identities = 18/51 (35%), Positives = 33/51 (64%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           ++REYF  FG + S+ +  D +T K+RGF F+ F + +PV ++  ++ H +
Sbjct: 109 KIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNV 159



 Score = 35.5 bits (78), Expect = 0.21
 Identities = 17/70 (24%), Positives = 35/70 (50%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           I+     +GE+  + +  D KT + +GF FIT+ +   V +    + H +     E K A
Sbjct: 110 IREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVA 169

Query: 414 VPREEIKRPE 443
           + +E+ ++ +
Sbjct: 170 MSKEQYQQQQ 179


>BC026015-1|AAH26015.1|  306|Homo sapiens heterogeneous nuclear
           ribonucleoprotein D (AU-rich element RNA binding protein
            protein.
          Length = 306

 Score = 73.7 bits (173), Expect = 6e-13
 Identities = 33/85 (38%), Positives = 53/85 (62%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GE+VD  +  DP T RS+GFGF+ + ++  VD+  + + HK++G++++PKRA      K
Sbjct: 120 FGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKLNGKVIDPKRA------K 173

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
             +    VKK+FV GL  D  EE +
Sbjct: 174 AMKTKEPVKKIFVGGLSPDTPEEKI 198



 Score = 53.2 bits (122), Expect = 1e-06
 Identities = 22/53 (41%), Positives = 36/53 (67%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           ++ L++YFS FG +V  ++  D  TG+ RGFGFV F + + VD+V  Q+ H++
Sbjct: 110 KKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKL 162



 Score = 49.6 bits (113), Expect = 1e-05
 Identities = 18/51 (35%), Positives = 33/51 (64%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           ++REYF  FG + S+ +  D +T K+RGF F+ F + +PV ++  ++ H +
Sbjct: 197 KIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNV 247



 Score = 35.5 bits (78), Expect = 0.21
 Identities = 17/70 (24%), Positives = 35/70 (50%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           I+     +GE+  + +  D KT + +GF FIT+ +   V +    + H +     E K A
Sbjct: 198 IREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVA 257

Query: 414 VPREEIKRPE 443
           + +E+ ++ +
Sbjct: 258 MSKEQYQQQQ 267


>BC023977-1|AAH23977.1|  306|Homo sapiens heterogeneous nuclear
           ribonucleoprotein D (AU-rich element RNA binding protein
            protein.
          Length = 306

 Score = 73.7 bits (173), Expect = 6e-13
 Identities = 33/85 (38%), Positives = 53/85 (62%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GE+VD  +  DP T RS+GFGF+ + ++  VD+  + + HK++G++++PKRA      K
Sbjct: 120 FGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKLNGKVIDPKRA------K 173

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
             +    VKK+FV GL  D  EE +
Sbjct: 174 AMKTKEPVKKIFVGGLSPDTPEEKI 198



 Score = 53.2 bits (122), Expect = 1e-06
 Identities = 22/53 (41%), Positives = 36/53 (67%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           ++ L++YFS FG +V  ++  D  TG+ RGFGFV F + + VD+V  Q+ H++
Sbjct: 110 KKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKL 162



 Score = 49.6 bits (113), Expect = 1e-05
 Identities = 18/51 (35%), Positives = 33/51 (64%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           ++REYF  FG + S+ +  D +T K+RGF F+ F + +PV ++  ++ H +
Sbjct: 197 KIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNV 247



 Score = 35.5 bits (78), Expect = 0.21
 Identities = 17/70 (24%), Positives = 35/70 (50%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           I+     +GE+  + +  D KT + +GF FIT+ +   V +    + H +     E K A
Sbjct: 198 IREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVA 257

Query: 414 VPREEIKRPE 443
           + +E+ ++ +
Sbjct: 258 MSKEQYQQQQ 267


>BC002401-1|AAH02401.1|  355|Homo sapiens heterogeneous nuclear
           ribonucleoprotein D (AU-rich element RNA binding protein
            protein.
          Length = 355

 Score = 73.7 bits (173), Expect = 6e-13
 Identities = 33/85 (38%), Positives = 53/85 (62%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GE+VD  +  DP T RS+GFGF+ + ++  VD+  + + HK++G++++PKRA      K
Sbjct: 120 FGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKLNGKVIDPKRA------K 173

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
             +    VKK+FV GL  D  EE +
Sbjct: 174 AMKTKEPVKKIFVGGLSPDTPEEKI 198



 Score = 53.2 bits (122), Expect = 1e-06
 Identities = 22/53 (41%), Positives = 36/53 (67%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           ++ L++YFS FG +V  ++  D  TG+ RGFGFV F + + VD+V  Q+ H++
Sbjct: 110 KKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKL 162



 Score = 49.6 bits (113), Expect = 1e-05
 Identities = 18/51 (35%), Positives = 33/51 (64%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           ++REYF  FG + S+ +  D +T K+RGF F+ F + +PV ++  ++ H +
Sbjct: 197 KIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNV 247



 Score = 35.5 bits (78), Expect = 0.21
 Identities = 17/70 (24%), Positives = 35/70 (50%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           I+     +GE+  + +  D KT + +GF FIT+ +   V +    + H +     E K A
Sbjct: 198 IREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVA 257

Query: 414 VPREEIKRPE 443
           + +E+ ++ +
Sbjct: 258 MSKEQYQQQQ 267


>AF039575-1|AAB96683.1|  298|Homo sapiens heterogeneous nuclear
           ribonucleoprotein D0B protein.
          Length = 298

 Score = 73.7 bits (173), Expect = 6e-13
 Identities = 33/85 (38%), Positives = 53/85 (62%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GE+VD  +  DP T RS+GFGF+ + ++  VD+  + + HK++G++++PKRA      K
Sbjct: 112 FGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKLNGKVIDPKRA------K 165

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
             +    VKK+FV GL  D  EE +
Sbjct: 166 AMKTKEPVKKIFVGGLSPDTPEEKI 190



 Score = 53.2 bits (122), Expect = 1e-06
 Identities = 22/53 (41%), Positives = 36/53 (67%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           ++ L++YFS FG +V  ++  D  TG+ RGFGFV F + + VD+V  Q+ H++
Sbjct: 102 KKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKL 154



 Score = 49.6 bits (113), Expect = 1e-05
 Identities = 18/51 (35%), Positives = 33/51 (64%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           ++REYF  FG + S+ +  D +T K+RGF F+ F + +PV ++  ++ H +
Sbjct: 189 KIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNV 239



 Score = 35.5 bits (78), Expect = 0.21
 Identities = 17/70 (24%), Positives = 35/70 (50%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           I+     +GE+  + +  D KT + +GF FIT+ +   V +    + H +     E K A
Sbjct: 190 IREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVA 249

Query: 414 VPREEIKRPE 443
           + +E+ ++ +
Sbjct: 250 MSKEQYQQQQ 259


>AF026126-3|AAC23476.1|  336|Homo sapiens heterogeneous nuclear
           ribonucleoprotein D protein.
          Length = 336

 Score = 73.7 bits (173), Expect = 6e-13
 Identities = 33/85 (38%), Positives = 53/85 (62%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GE+VD  +  DP T RS+GFGF+ + ++  VD+  + + HK++G++++PKRA      K
Sbjct: 101 FGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKLNGKVIDPKRA------K 154

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
             +    VKK+FV GL  D  EE +
Sbjct: 155 AMKTKEPVKKIFVGGLSPDTPEEKI 179



 Score = 53.2 bits (122), Expect = 1e-06
 Identities = 22/53 (41%), Positives = 36/53 (67%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           ++ L++YFS FG +V  ++  D  TG+ RGFGFV F + + VD+V  Q+ H++
Sbjct: 91  KKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKL 143



 Score = 49.6 bits (113), Expect = 1e-05
 Identities = 18/51 (35%), Positives = 33/51 (64%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           ++REYF  FG + S+ +  D +T K+RGF F+ F + +PV ++  ++ H +
Sbjct: 178 KIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNV 228



 Score = 35.5 bits (78), Expect = 0.21
 Identities = 17/70 (24%), Positives = 35/70 (50%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           I+     +GE+  + +  D KT + +GF FIT+ +   V +    + H +     E K A
Sbjct: 179 IREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVA 238

Query: 414 VPREEIKRPE 443
           + +E+ ++ +
Sbjct: 239 MSKEQYQQQQ 248


>AF026126-2|AAC23475.1|  306|Homo sapiens heterogeneous nuclear
           ribonucleoprotein D protein.
          Length = 306

 Score = 73.7 bits (173), Expect = 6e-13
 Identities = 33/85 (38%), Positives = 53/85 (62%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GE+VD  +  DP T RS+GFGF+ + ++  VD+  + + HK++G++++PKRA      K
Sbjct: 120 FGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKLNGKVIDPKRA------K 173

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
             +    VKK+FV GL  D  EE +
Sbjct: 174 AMKTKEPVKKIFVGGLSPDTPEEKI 198



 Score = 53.2 bits (122), Expect = 1e-06
 Identities = 22/53 (41%), Positives = 36/53 (67%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           ++ L++YFS FG +V  ++  D  TG+ RGFGFV F + + VD+V  Q+ H++
Sbjct: 110 KKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKL 162



 Score = 49.6 bits (113), Expect = 1e-05
 Identities = 18/51 (35%), Positives = 33/51 (64%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           ++REYF  FG + S+ +  D +T K+RGF F+ F + +PV ++  ++ H +
Sbjct: 197 KIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNV 247



 Score = 35.5 bits (78), Expect = 0.21
 Identities = 17/70 (24%), Positives = 35/70 (50%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           I+     +GE+  + +  D KT + +GF FIT+ +   V +    + H +     E K A
Sbjct: 198 IREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVA 257

Query: 414 VPREEIKRPE 443
           + +E+ ++ +
Sbjct: 258 MSKEQYQQQQ 267


>AF026126-1|AAC23474.1|  355|Homo sapiens heterogeneous nuclear
           ribonucleoprotein D protein.
          Length = 355

 Score = 73.7 bits (173), Expect = 6e-13
 Identities = 33/85 (38%), Positives = 53/85 (62%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GE+VD  +  DP T RS+GFGF+ + ++  VD+  + + HK++G++++PKRA      K
Sbjct: 120 FGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKLNGKVIDPKRA------K 173

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
             +    VKK+FV GL  D  EE +
Sbjct: 174 AMKTKEPVKKIFVGGLSPDTPEEKI 198



 Score = 53.2 bits (122), Expect = 1e-06
 Identities = 22/53 (41%), Positives = 36/53 (67%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           ++ L++YFS FG +V  ++  D  TG+ RGFGFV F + + VD+V  Q+ H++
Sbjct: 110 KKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKL 162



 Score = 49.6 bits (113), Expect = 1e-05
 Identities = 18/51 (35%), Positives = 33/51 (64%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           ++REYF  FG + S+ +  D +T K+RGF F+ F + +PV ++  ++ H +
Sbjct: 197 KIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNV 247



 Score = 35.5 bits (78), Expect = 0.21
 Identities = 17/70 (24%), Positives = 35/70 (50%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           I+     +GE+  + +  D KT + +GF FIT+ +   V +    + H +     E K A
Sbjct: 198 IREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVA 257

Query: 414 VPREEIKRPE 443
           + +E+ ++ +
Sbjct: 258 MSKEQYQQQQ 267


>AC124016-1|AAY40913.1|  355|Homo sapiens unknown protein.
          Length = 355

 Score = 73.7 bits (173), Expect = 6e-13
 Identities = 33/85 (38%), Positives = 53/85 (62%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GE+VD  +  DP T RS+GFGF+ + ++  VD+  + + HK++G++++PKRA      K
Sbjct: 120 FGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKLNGKVIDPKRA------K 173

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
             +    VKK+FV GL  D  EE +
Sbjct: 174 AMKTKEPVKKIFVGGLSPDTPEEKI 198



 Score = 53.2 bits (122), Expect = 1e-06
 Identities = 22/53 (41%), Positives = 36/53 (67%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           ++ L++YFS FG +V  ++  D  TG+ RGFGFV F + + VD+V  Q+ H++
Sbjct: 110 KKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKL 162



 Score = 49.6 bits (113), Expect = 1e-05
 Identities = 18/51 (35%), Positives = 33/51 (64%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           ++REYF  FG + S+ +  D +T K+RGF F+ F + +PV ++  ++ H +
Sbjct: 197 KIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNV 247



 Score = 35.5 bits (78), Expect = 0.21
 Identities = 17/70 (24%), Positives = 35/70 (50%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           I+     +GE+  + +  D KT + +GF FIT+ +   V +    + H +     E K A
Sbjct: 198 IREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVA 257

Query: 414 VPREEIKRPE 443
           + +E+ ++ +
Sbjct: 258 MSKEQYQQQQ 267


>D89678-1|BAA22860.1|  271|Homo sapiens A+U-rich element RNA binding
           factor protein.
          Length = 271

 Score = 72.1 bits (169), Expect = 2e-12
 Identities = 34/86 (39%), Positives = 51/86 (59%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GE+VD  +  DP T RS+GFGF+ +  A  VD+    + HK+DG++++PKRA      K
Sbjct: 22  FGEVVDCTIKTDPVTGRSRGFGFVLFKDAASVDKVLELKEHKLDGKLIDPKRA------K 75

Query: 435 RPEASATVKKLFVAGLKQDIEEEDLE 512
             +     KK+FV GL  D  EE ++
Sbjct: 76  ALKGKEPPKKVFVGGLSPDTSEEQIK 101



 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 23/53 (43%), Positives = 33/53 (62%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           ++ L EY S FG +V  ++ TD  TG+ RGFGFV F D   VD+V   + H++
Sbjct: 12  KKDLTEYLSRFGEVVDCTIKTDPVTGRSRGFGFVLFKDAASVDKVLELKEHKL 64



 Score = 47.6 bits (108), Expect = 5e-05
 Identities = 18/51 (35%), Positives = 33/51 (64%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           +++EYF  FG I ++ +  D +T ++RGF F+ + D +PV ++   + HQI
Sbjct: 99  QIKEYFGAFGEIENIELPMDTKTNERRGFCFITYTDEEPVKKLLESRYHQI 149



 Score = 43.6 bits (98), Expect = 8e-04
 Identities = 24/70 (34%), Positives = 37/70 (52%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           IK    A+GEI ++ +  D KT   +GF FITY+    V +   +R H+I     E K A
Sbjct: 100 IKEYFGAFGEIENIELPMDTKTNERRGFCFITYTDEEPVKKLLESRYHQIGSGKCEIKVA 159

Query: 414 VPREEIKRPE 443
            P+E  ++ +
Sbjct: 160 QPKEVYRQQQ 169


>D89092-1|BAA24361.1|  301|Homo sapiens hnRNP JKTBP protein.
          Length = 301

 Score = 72.1 bits (169), Expect = 2e-12
 Identities = 34/86 (39%), Positives = 51/86 (59%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GE+VD  +  DP T RS+GFGF+ +  A  VD+    + HK+DG++++PKRA      K
Sbjct: 52  FGEVVDCTIKTDPVTGRSRGFGFVLFKDAASVDKVLELKEHKLDGKLIDPKRA------K 105

Query: 435 RPEASATVKKLFVAGLKQDIEEEDLE 512
             +     KK+FV GL  D  EE ++
Sbjct: 106 ALKGKEPPKKVFVGGLSPDTSEEQIK 131



 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 23/53 (43%), Positives = 33/53 (62%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           ++ L EY S FG +V  ++ TD  TG+ RGFGFV F D   VD+V   + H++
Sbjct: 42  KKDLTEYLSRFGEVVDCTIKTDPVTGRSRGFGFVLFKDAASVDKVLELKEHKL 94



 Score = 47.6 bits (108), Expect = 5e-05
 Identities = 18/51 (35%), Positives = 33/51 (64%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           +++EYF  FG I ++ +  D +T ++RGF F+ + D +PV ++   + HQI
Sbjct: 129 QIKEYFGAFGEIENIELPMDTKTNERRGFCFITYTDEEPVKKLLESRYHQI 179



 Score = 43.6 bits (98), Expect = 8e-04
 Identities = 24/70 (34%), Positives = 37/70 (52%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           IK    A+GEI ++ +  D KT   +GF FITY+    V +   +R H+I     E K A
Sbjct: 130 IKEYFGAFGEIENIELPMDTKTNERRGFCFITYTDEEPVKKLLESRYHQIGSGKCEIKVA 189

Query: 414 VPREEIKRPE 443
            P+E  ++ +
Sbjct: 190 QPKEVYRQQQ 199


>CR407623-1|CAG28551.1|  420|Homo sapiens HNRPDL protein.
          Length = 420

 Score = 72.1 bits (169), Expect = 2e-12
 Identities = 34/86 (39%), Positives = 51/86 (59%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GE+VD  +  DP T RS+GFGF+ +  A  VD+    + HK+DG++++PKRA      K
Sbjct: 171 FGEVVDCTIKTDPVTGRSRGFGFVLFKDAASVDKVLELKEHKLDGKLIDPKRA------K 224

Query: 435 RPEASATVKKLFVAGLKQDIEEEDLE 512
             +     KK+FV GL  D  EE ++
Sbjct: 225 ALKGKEPPKKVFVGGLSPDTSEEQIK 250



 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 23/53 (43%), Positives = 33/53 (62%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           ++ L EY S FG +V  ++ TD  TG+ RGFGFV F D   VD+V   + H++
Sbjct: 161 KKDLTEYLSRFGEVVDCTIKTDPVTGRSRGFGFVLFKDAASVDKVLELKEHKL 213



 Score = 47.6 bits (108), Expect = 5e-05
 Identities = 18/51 (35%), Positives = 33/51 (64%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           +++EYF  FG I ++ +  D +T ++RGF F+ + D +PV ++   + HQI
Sbjct: 248 QIKEYFGAFGEIENIELPMDTKTNERRGFCFITYTDEEPVKKLLESRYHQI 298



 Score = 43.6 bits (98), Expect = 8e-04
 Identities = 24/70 (34%), Positives = 37/70 (52%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           IK    A+GEI ++ +  D KT   +GF FITY+    V +   +R H+I     E K A
Sbjct: 249 IKEYFGAFGEIENIELPMDTKTNERRGFCFITYTDEEPVKKLLESRYHQIGSGKCEIKVA 308

Query: 414 VPREEIKRPE 443
            P+E  ++ +
Sbjct: 309 QPKEVYRQQQ 318


>BC071944-1|AAH71944.1|  420|Homo sapiens heterogeneous nuclear
           ribonucleoprotein D-like protein.
          Length = 420

 Score = 72.1 bits (169), Expect = 2e-12
 Identities = 34/86 (39%), Positives = 51/86 (59%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GE+VD  +  DP T RS+GFGF+ +  A  VD+    + HK+DG++++PKRA      K
Sbjct: 171 FGEVVDCTIKTDPVTGRSRGFGFVLFKDAASVDKVLELKEHKLDGKLIDPKRA------K 224

Query: 435 RPEASATVKKLFVAGLKQDIEEEDLE 512
             +     KK+FV GL  D  EE ++
Sbjct: 225 ALKGKEPPKKVFVGGLSPDTSEEQIK 250



 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 23/53 (43%), Positives = 33/53 (62%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           ++ L EY S FG +V  ++ TD  TG+ RGFGFV F D   VD+V   + H++
Sbjct: 161 KKDLTEYLSRFGEVVDCTIKTDPVTGRSRGFGFVLFKDAASVDKVLELKEHKL 213



 Score = 47.6 bits (108), Expect = 5e-05
 Identities = 18/51 (35%), Positives = 33/51 (64%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           +++EYF  FG I ++ +  D +T ++RGF F+ + D +PV ++   + HQI
Sbjct: 248 QIKEYFGAFGEIENIELPMDTKTNERRGFCFITYTDEEPVKKLLESRYHQI 298



 Score = 43.6 bits (98), Expect = 8e-04
 Identities = 24/70 (34%), Positives = 37/70 (52%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           IK    A+GEI ++ +  D KT   +GF FITY+    V +   +R H+I     E K A
Sbjct: 249 IKEYFGAFGEIENIELPMDTKTNERRGFCFITYTDEEPVKKLLESRYHQIGSGKCEIKVA 308

Query: 414 VPREEIKRPE 443
            P+E  ++ +
Sbjct: 309 QPKEVYRQQQ 318


>BC036708-1|AAH36708.1|  332|Homo sapiens heterogeneous nuclear
           ribonucleoprotein A/B protein.
          Length = 332

 Score = 72.1 bits (169), Expect = 2e-12
 Identities = 34/85 (40%), Positives = 54/85 (63%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GE+VD  +  DP T RS+GFGFI +  A  V++  + + H++DGR+++PK+A+  +  K
Sbjct: 93  FGEVVDCTIKMDPNTGRSRGFGFILFKDAASVEKVLDQKEHRLDGRVIDPKKAMAMK--K 150

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
            P     VKK+FV GL  +  EE +
Sbjct: 151 DP-----VKKIFVGGLNPEATEEKI 170



 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 20/53 (37%), Positives = 35/53 (66%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           ++ L++YF+ FG +V  ++  D  TG+ RGFGF+ F D   V++V  Q+ H++
Sbjct: 83  KKDLKDYFTKFGEVVDCTIKMDPNTGRSRGFGFILFKDAASVEKVLDQKEHRL 135



 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 18/51 (35%), Positives = 32/51 (62%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           ++REYF  FG I ++ +  D +  K+RGF F+ F + +PV +V  ++ H +
Sbjct: 169 KIREYFGEFGEIEAIELPMDPKLNKRRGFVFITFKEEEPVKKVLEKKFHTV 219



 Score = 39.5 bits (88), Expect = 0.013
 Identities = 19/57 (33%), Positives = 30/57 (52%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPRE 425
           +GEI  + +  DPK  + +GF FIT+ +   V +    + H + G   E K A P+E
Sbjct: 177 FGEIEAIELPMDPKLNKRRGFVFITFKEEEPVKKVLEKKFHTVSGSKCEIKVAQPKE 233


>BC011714-1|AAH11714.1|  420|Homo sapiens heterogeneous nuclear
           ribonucleoprotein D-like protein.
          Length = 420

 Score = 72.1 bits (169), Expect = 2e-12
 Identities = 34/86 (39%), Positives = 51/86 (59%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GE+VD  +  DP T RS+GFGF+ +  A  VD+    + HK+DG++++PKRA      K
Sbjct: 171 FGEVVDCTIKTDPVTGRSRGFGFVLFKDAASVDKVLELKEHKLDGKLIDPKRA------K 224

Query: 435 RPEASATVKKLFVAGLKQDIEEEDLE 512
             +     KK+FV GL  D  EE ++
Sbjct: 225 ALKGKEPPKKVFVGGLSPDTSEEQIK 250



 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 23/53 (43%), Positives = 33/53 (62%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           ++ L EY S FG +V  ++ TD  TG+ RGFGFV F D   VD+V   + H++
Sbjct: 161 KKDLTEYLSRFGEVVDCTIKTDPVTGRSRGFGFVLFKDAASVDKVLELKEHKL 213



 Score = 47.6 bits (108), Expect = 5e-05
 Identities = 18/51 (35%), Positives = 33/51 (64%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           +++EYF  FG I ++ +  D +T ++RGF F+ + D +PV ++   + HQI
Sbjct: 248 QIKEYFGAFGEIENIELPMDTKTNERRGFCFITYTDEEPVKKLLESRYHQI 298



 Score = 43.6 bits (98), Expect = 8e-04
 Identities = 24/70 (34%), Positives = 37/70 (52%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           IK    A+GEI ++ +  D KT   +GF FITY+    V +   +R H+I     E K A
Sbjct: 249 IKEYFGAFGEIENIELPMDTKTNERRGFCFITYTDEEPVKKLLESRYHQIGSGKCEIKVA 308

Query: 414 VPREEIKRPE 443
            P+E  ++ +
Sbjct: 309 QPKEVYRQQQ 318


>BC009359-1|AAH09359.1|  285|Homo sapiens heterogeneous nuclear
           ribonucleoprotein A/B protein.
          Length = 285

 Score = 72.1 bits (169), Expect = 2e-12
 Identities = 34/85 (40%), Positives = 54/85 (63%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GE+VD  +  DP T RS+GFGFI +  A  V++  + + H++DGR+++PK+A+  +  K
Sbjct: 93  FGEVVDCTIKMDPNTGRSRGFGFILFKDAASVEKVLDQKEHRLDGRVIDPKKAMAMK--K 150

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
            P     VKK+FV GL  +  EE +
Sbjct: 151 DP-----VKKIFVGGLNPEATEEKI 170



 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 20/53 (37%), Positives = 35/53 (66%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           ++ L++YF+ FG +V  ++  D  TG+ RGFGF+ F D   V++V  Q+ H++
Sbjct: 83  KKDLKDYFTKFGEVVDCTIKMDPNTGRSRGFGFILFKDAASVEKVLDQKEHRL 135



 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 18/51 (35%), Positives = 32/51 (62%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           ++REYF  FG I ++ +  D +  K+RGF F+ F + +PV +V  ++ H +
Sbjct: 169 KIREYFGEFGEIEAIELPMDPKLNKRRGFVFITFKEEEPVKKVLEKKFHTV 219



 Score = 39.5 bits (88), Expect = 0.013
 Identities = 19/57 (33%), Positives = 30/57 (52%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPRE 425
           +GEI  + +  DPK  + +GF FIT+ +   V +    + H + G   E K A P+E
Sbjct: 177 FGEIEAIELPMDPKLNKRRGFVFITFKEEEPVKKVLEKKFHTVSGSKCEIKVAQPKE 233


>BC007392-1|AAH07392.2|  415|Homo sapiens HNRPDL protein protein.
          Length = 415

 Score = 72.1 bits (169), Expect = 2e-12
 Identities = 34/86 (39%), Positives = 51/86 (59%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GE+VD  +  DP T RS+GFGF+ +  A  VD+    + HK+DG++++PKRA      K
Sbjct: 166 FGEVVDCTIKTDPVTGRSRGFGFVLFKDAASVDKVLELKEHKLDGKLIDPKRA------K 219

Query: 435 RPEASATVKKLFVAGLKQDIEEEDLE 512
             +     KK+FV GL  D  EE ++
Sbjct: 220 ALKGKEPPKKVFVGGLSPDTSEEQIK 245



 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 23/53 (43%), Positives = 33/53 (62%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           ++ L EY S FG +V  ++ TD  TG+ RGFGFV F D   VD+V   + H++
Sbjct: 156 KKDLTEYLSRFGEVVDCTIKTDPVTGRSRGFGFVLFKDAASVDKVLELKEHKL 208



 Score = 47.6 bits (108), Expect = 5e-05
 Identities = 18/51 (35%), Positives = 33/51 (64%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           +++EYF  FG I ++ +  D +T ++RGF F+ + D +PV ++   + HQI
Sbjct: 243 QIKEYFGAFGEIENIELPMDTKTNERRGFCFITYTDEEPVKKLLESRYHQI 293



 Score = 43.6 bits (98), Expect = 8e-04
 Identities = 24/70 (34%), Positives = 37/70 (52%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           IK    A+GEI ++ +  D KT   +GF FITY+    V +   +R H+I     E K A
Sbjct: 244 IKEYFGAFGEIENIELPMDTKTNERRGFCFITYTDEEPVKKLLESRYHQIGSGKCEIKVA 303

Query: 414 VPREEIKRPE 443
            P+E  ++ +
Sbjct: 304 QPKEVYRQQQ 313


>BC004561-1|AAH04561.1|  285|Homo sapiens heterogeneous nuclear
           ribonucleoprotein A/B protein.
          Length = 285

 Score = 72.1 bits (169), Expect = 2e-12
 Identities = 34/85 (40%), Positives = 54/85 (63%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GE+VD  +  DP T RS+GFGFI +  A  V++  + + H++DGR+++PK+A+  +  K
Sbjct: 93  FGEVVDCTIKMDPNTGRSRGFGFILFKDAASVEKVLDQKEHRLDGRVIDPKKAMAMK--K 150

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
            P     VKK+FV GL  +  EE +
Sbjct: 151 DP-----VKKIFVGGLNPEATEEKI 170



 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 20/53 (37%), Positives = 35/53 (66%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           ++ L++YF+ FG +V  ++  D  TG+ RGFGF+ F D   V++V  Q+ H++
Sbjct: 83  KKDLKDYFTKFGEVVDCTIKMDPNTGRSRGFGFILFKDAASVEKVLDQKEHRL 135



 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 18/51 (35%), Positives = 32/51 (62%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           ++REYF  FG I ++ +  D +  K+RGF F+ F + +PV +V  ++ H +
Sbjct: 169 KIREYFGEFGEIEAIELPMDPKLNKRRGFVFITFKEEEPVKKVLEKKFHTV 219



 Score = 39.5 bits (88), Expect = 0.013
 Identities = 19/57 (33%), Positives = 30/57 (52%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPRE 425
           +GEI  + +  DPK  + +GF FIT+ +   V +    + H + G   E K A P+E
Sbjct: 177 FGEIEAIELPMDPKLNKRRGFVFITFKEEEPVKKVLEKKFHTVSGSKCEIKVAQPKE 233


>BC002625-1|AAH02625.1|  285|Homo sapiens heterogeneous nuclear
           ribonucleoprotein A/B protein.
          Length = 285

 Score = 72.1 bits (169), Expect = 2e-12
 Identities = 34/85 (40%), Positives = 54/85 (63%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GE+VD  +  DP T RS+GFGFI +  A  V++  + + H++DGR+++PK+A+  +  K
Sbjct: 93  FGEVVDCTIKMDPNTGRSRGFGFILFKDAASVEKVLDQKEHRLDGRVIDPKKAMAMK--K 150

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
            P     VKK+FV GL  +  EE +
Sbjct: 151 DP-----VKKIFVGGLNPEATEEKI 170



 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 20/53 (37%), Positives = 35/53 (66%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           ++ L++YF+ FG +V  ++  D  TG+ RGFGF+ F D   V++V  Q+ H++
Sbjct: 83  KKDLKDYFTKFGEVVDCTIKMDPNTGRSRGFGFILFKDAASVEKVLDQKEHRL 135



 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 18/51 (35%), Positives = 32/51 (62%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           ++REYF  FG I ++ +  D +  K+RGF F+ F + +PV +V  ++ H +
Sbjct: 169 KIREYFGEFGEIEAIELPMDPKLNKRRGFVFITFKEEEPVKKVLEKKFHTV 219



 Score = 39.5 bits (88), Expect = 0.013
 Identities = 19/57 (33%), Positives = 30/57 (52%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPRE 425
           +GEI  + +  DPK  + +GF FIT+ +   V +    + H + G   E K A P+E
Sbjct: 177 FGEIEAIELPMDPKLNKRRGFVFITFKEEEPVKKVLEKKFHTVSGSKCEIKVAQPKE 233


>BC001616-1|AAH01616.1|  285|Homo sapiens heterogeneous nuclear
           ribonucleoprotein A/B protein.
          Length = 285

 Score = 72.1 bits (169), Expect = 2e-12
 Identities = 34/85 (40%), Positives = 54/85 (63%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GE+VD  +  DP T RS+GFGFI +  A  V++  + + H++DGR+++PK+A+  +  K
Sbjct: 93  FGEVVDCTIKMDPNTGRSRGFGFILFKDAASVEKVLDQKEHRLDGRVIDPKKAMAMK--K 150

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
            P     VKK+FV GL  +  EE +
Sbjct: 151 DP-----VKKIFVGGLNPEATEEKI 170



 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 20/53 (37%), Positives = 35/53 (66%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           ++ L++YF+ FG +V  ++  D  TG+ RGFGF+ F D   V++V  Q+ H++
Sbjct: 83  KKDLKDYFTKFGEVVDCTIKMDPNTGRSRGFGFILFKDAASVEKVLDQKEHRL 135



 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 18/51 (35%), Positives = 32/51 (62%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           ++REYF  FG I ++ +  D +  K+RGF F+ F + +PV +V  ++ H +
Sbjct: 169 KIREYFGEFGEIEAIELPMDPKLNKRRGFVFITFKEEEPVKKVLEKKFHTV 219



 Score = 39.5 bits (88), Expect = 0.013
 Identities = 19/57 (33%), Positives = 30/57 (52%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPRE 425
           +GEI  + +  DPK  + +GF FIT+ +   V +    + H + G   E K A P+E
Sbjct: 177 FGEIEAIELPMDPKLNKRRGFVFITFKEEEPVKKVLEKKFHTVSGSKCEIKVAQPKE 233


>AY453824-1|AAR17782.1|  298|Homo sapiens CArG binding factor
           protein.
          Length = 298

 Score = 72.1 bits (169), Expect = 2e-12
 Identities = 34/86 (39%), Positives = 51/86 (59%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GE+VD  +  DP T RS+GFGF+ +  A  VD+    + HK+DG++++PKRA      K
Sbjct: 49  FGEVVDCTIKTDPVTGRSRGFGFVLFKDAASVDKVLELKEHKLDGKLIDPKRA------K 102

Query: 435 RPEASATVKKLFVAGLKQDIEEEDLE 512
             +     KK+FV GL  D  EE ++
Sbjct: 103 ALKGKEPPKKVFVGGLSPDTSEEQIK 128



 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 23/53 (43%), Positives = 33/53 (62%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           ++ L EY S FG +V  ++ TD  TG+ RGFGFV F D   VD+V   + H++
Sbjct: 39  KKDLTEYLSRFGEVVDCTIKTDPVTGRSRGFGFVLFKDAASVDKVLELKEHKL 91



 Score = 47.6 bits (108), Expect = 5e-05
 Identities = 18/51 (35%), Positives = 33/51 (64%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           +++EYF  FG I ++ +  D +T ++RGF F+ + D +PV ++   + HQI
Sbjct: 126 QIKEYFGAFGEIENIELPMDTKTNERRGFCFITYTDEEPVKKLLESRYHQI 176



 Score = 43.6 bits (98), Expect = 8e-04
 Identities = 24/70 (34%), Positives = 37/70 (52%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           IK    A+GEI ++ +  D KT   +GF FITY+    V +   +R H+I     E K A
Sbjct: 127 IKEYFGAFGEIENIELPMDTKTNERRGFCFITYTDEEPVKKLLESRYHQIGSGKCEIKVA 186

Query: 414 VPREEIKRPE 443
            P+E  ++ +
Sbjct: 187 QPKEVYRQQQ 196


>AK223425-1|BAD97145.1|  332|Homo sapiens heterogeneous nuclear
           ribonucleoprotein AB isoform a variant protein.
          Length = 332

 Score = 72.1 bits (169), Expect = 2e-12
 Identities = 34/85 (40%), Positives = 54/85 (63%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GE+VD  +  DP T RS+GFGFI +  A  V++  + + H++DGR+++PK+A+  +  K
Sbjct: 93  FGEVVDCTIKMDPNTGRSRGFGFILFKDAASVEKVLDQKEHRLDGRVIDPKKAMAMK--K 150

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
            P     VKK+FV GL  +  EE +
Sbjct: 151 DP-----VKKIFVGGLNPEATEEKI 170



 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 20/53 (37%), Positives = 35/53 (66%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           ++ L++YF+ FG +V  ++  D  TG+ RGFGF+ F D   V++V  Q+ H++
Sbjct: 83  KKDLKDYFTKFGEVVDCTIKMDPNTGRSRGFGFILFKDAASVEKVLDQKEHRL 135



 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 18/51 (35%), Positives = 32/51 (62%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           ++REYF  FG I ++ +  D +  K+RGF F+ F + +PV +V  ++ H +
Sbjct: 169 KIREYFGEFGEIEAIELPMDPKLNKRRGFVFITFKEEEPVKKVLEKKFHTV 219



 Score = 39.5 bits (88), Expect = 0.013
 Identities = 19/57 (33%), Positives = 30/57 (52%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPRE 425
           +GEI  + +  DPK  + +GF FIT+ +   V +    + H + G   E K A P+E
Sbjct: 177 FGEIEAIELPMDPKLNKRRGFVFITFKEEEPVKKVLEKKFHTVSGSKCEIKVAQPKE 233


>AK097657-1|BAC05134.1|  332|Homo sapiens protein ( Homo sapiens
           cDNA FLJ40338 fis, clone TESTI2032067, highly similar to
           Rattus norvegicus mRNA for type A/B hnRNP protein p40.
           ).
          Length = 332

 Score = 72.1 bits (169), Expect = 2e-12
 Identities = 34/85 (40%), Positives = 54/85 (63%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GE+VD  +  DP T RS+GFGFI +  A  V++  + + H++DGR+++PK+A+  +  K
Sbjct: 93  FGEVVDCTIKMDPNTGRSRGFGFILFKDAASVEKVLDQKEHRLDGRVIDPKKAMAMK--K 150

Query: 435 RPEASATVKKLFVAGLKQDIEEEDL 509
            P     VKK+FV GL  +  EE +
Sbjct: 151 DP-----VKKIFVGGLNPEATEEKI 170



 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 20/53 (37%), Positives = 35/53 (66%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           ++ L++YF+ FG +V  ++  D  TG+ RGFGF+ F D   V++V  Q+ H++
Sbjct: 83  KKDLKDYFTKFGEVVDCTIKMDPNTGRSRGFGFILFKDAASVEKVLDQKEHRL 135



 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 18/51 (35%), Positives = 32/51 (62%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           ++REYF  FG I ++ +  D +  K+RGF F+ F + +PV +V  ++ H +
Sbjct: 169 KIREYFGEFGEIEAIELPMDPKLNKRRGFVFITFKEEEPVKKVLEKKFHTV 219



 Score = 39.5 bits (88), Expect = 0.013
 Identities = 19/57 (33%), Positives = 30/57 (52%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPRE 425
           +GEI  + +  DPK  + +GF FIT+ +   V +    + H + G   E K A P+E
Sbjct: 177 FGEIEAIELPMDPKLNKRRGFVFITFKEEEPVKKVLEKKFHTVSGSKCEIKVAQPKE 233


>AC124016-2|AAY40914.1|  420|Homo sapiens unknown protein.
          Length = 420

 Score = 72.1 bits (169), Expect = 2e-12
 Identities = 34/86 (39%), Positives = 51/86 (59%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GE+VD  +  DP T RS+GFGF+ +  A  VD+    + HK+DG++++PKRA      K
Sbjct: 171 FGEVVDCTIKTDPVTGRSRGFGFVLFKDAASVDKVLELKEHKLDGKLIDPKRA------K 224

Query: 435 RPEASATVKKLFVAGLKQDIEEEDLE 512
             +     KK+FV GL  D  EE ++
Sbjct: 225 ALKGKEPPKKVFVGGLSPDTSEEQIK 250



 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 23/53 (43%), Positives = 33/53 (62%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           ++ L EY S FG +V  ++ TD  TG+ RGFGFV F D   VD+V   + H++
Sbjct: 161 KKDLTEYLSRFGEVVDCTIKTDPVTGRSRGFGFVLFKDAASVDKVLELKEHKL 213



 Score = 47.6 bits (108), Expect = 5e-05
 Identities = 18/51 (35%), Positives = 33/51 (64%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           +++EYF  FG I ++ +  D +T ++RGF F+ + D +PV ++   + HQI
Sbjct: 248 QIKEYFGAFGEIENIELPMDTKTNERRGFCFITYTDEEPVKKLLESRYHQI 298



 Score = 43.6 bits (98), Expect = 8e-04
 Identities = 24/70 (34%), Positives = 37/70 (52%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           IK    A+GEI ++ +  D KT   +GF FITY+    V +   +R H+I     E K A
Sbjct: 249 IKEYFGAFGEIENIELPMDTKTNERRGFCFITYTDEEPVKKLLESRYHQIGSGKCEIKVA 308

Query: 414 VPREEIKRPE 443
            P+E  ++ +
Sbjct: 309 QPKEVYRQQQ 318


>AB066484-1|BAB62188.1|  244|Homo sapiens JKTBP1delta6 protein.
          Length = 244

 Score = 72.1 bits (169), Expect = 2e-12
 Identities = 34/86 (39%), Positives = 51/86 (59%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GE+VD  +  DP T RS+GFGF+ +  A  VD+    + HK+DG++++PKRA      K
Sbjct: 52  FGEVVDCTIKTDPVTGRSRGFGFVLFKDAASVDKVLELKEHKLDGKLIDPKRA------K 105

Query: 435 RPEASATVKKLFVAGLKQDIEEEDLE 512
             +     KK+FV GL  D  EE ++
Sbjct: 106 ALKGKEPPKKVFVGGLSPDTSEEQIK 131



 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 23/53 (43%), Positives = 33/53 (62%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           ++ L EY S FG +V  ++ TD  TG+ RGFGFV F D   VD+V   + H++
Sbjct: 42  KKDLTEYLSRFGEVVDCTIKTDPVTGRSRGFGFVLFKDAASVDKVLELKEHKL 94



 Score = 47.6 bits (108), Expect = 5e-05
 Identities = 18/51 (35%), Positives = 33/51 (64%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           +++EYF  FG I ++ +  D +T ++RGF F+ + D +PV ++   + HQI
Sbjct: 129 QIKEYFGAFGEIENIELPMDTKTNERRGFCFITYTDEEPVKKLLESRYHQI 179



 Score = 43.6 bits (98), Expect = 8e-04
 Identities = 24/70 (34%), Positives = 37/70 (52%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           IK    A+GEI ++ +  D KT   +GF FITY+    V +   +R H+I     E K A
Sbjct: 130 IKEYFGAFGEIENIELPMDTKTNERRGFCFITYTDEEPVKKLLESRYHQIGSGKCEIKVA 189

Query: 414 VPREEIKRPE 443
            P+E  ++ +
Sbjct: 190 QPKEVYRQQQ 199


>AB017019-1|BAA75241.1|  420|Homo sapiens JKTBP2 protein.
          Length = 420

 Score = 72.1 bits (169), Expect = 2e-12
 Identities = 34/86 (39%), Positives = 51/86 (59%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GE+VD  +  DP T RS+GFGF+ +  A  VD+    + HK+DG++++PKRA      K
Sbjct: 171 FGEVVDCTIKTDPVTGRSRGFGFVLFKDAASVDKVLELKEHKLDGKLIDPKRA------K 224

Query: 435 RPEASATVKKLFVAGLKQDIEEEDLE 512
             +     KK+FV GL  D  EE ++
Sbjct: 225 ALKGKEPPKKVFVGGLSPDTSEEQIK 250



 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 23/53 (43%), Positives = 33/53 (62%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           ++ L EY S FG +V  ++ TD  TG+ RGFGFV F D   VD+V   + H++
Sbjct: 161 KKDLTEYLSRFGEVVDCTIKTDPVTGRSRGFGFVLFKDAASVDKVLELKEHKL 213



 Score = 47.6 bits (108), Expect = 5e-05
 Identities = 18/51 (35%), Positives = 33/51 (64%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           +++EYF  FG I ++ +  D +T ++RGF F+ + D +PV ++   + HQI
Sbjct: 248 QIKEYFGAFGEIENIELPMDTKTNERRGFCFITYTDEEPVKKLLESRYHQI 298



 Score = 43.6 bits (98), Expect = 8e-04
 Identities = 24/70 (34%), Positives = 37/70 (52%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           IK    A+GEI ++ +  D KT   +GF FITY+    V +   +R H+I     E K A
Sbjct: 249 IKEYFGAFGEIENIELPMDTKTNERRGFCFITYTDEEPVKKLLESRYHQIGSGKCEIKVA 308

Query: 414 VPREEIKRPE 443
            P+E  ++ +
Sbjct: 309 QPKEVYRQQQ 318


>AB017018-2|BAA75240.1|  301|Homo sapiens JKTBP1 protein.
          Length = 301

 Score = 72.1 bits (169), Expect = 2e-12
 Identities = 34/86 (39%), Positives = 51/86 (59%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GE+VD  +  DP T RS+GFGF+ +  A  VD+    + HK+DG++++PKRA      K
Sbjct: 52  FGEVVDCTIKTDPVTGRSRGFGFVLFKDAASVDKVLELKEHKLDGKLIDPKRA------K 105

Query: 435 RPEASATVKKLFVAGLKQDIEEEDLE 512
             +     KK+FV GL  D  EE ++
Sbjct: 106 ALKGKEPPKKVFVGGLSPDTSEEQIK 131



 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 23/53 (43%), Positives = 33/53 (62%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           ++ L EY S FG +V  ++ TD  TG+ RGFGFV F D   VD+V   + H++
Sbjct: 42  KKDLTEYLSRFGEVVDCTIKTDPVTGRSRGFGFVLFKDAASVDKVLELKEHKL 94



 Score = 47.6 bits (108), Expect = 5e-05
 Identities = 18/51 (35%), Positives = 33/51 (64%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           +++EYF  FG I ++ +  D +T ++RGF F+ + D +PV ++   + HQI
Sbjct: 129 QIKEYFGAFGEIENIELPMDTKTNERRGFCFITYTDEEPVKKLLESRYHQI 179



 Score = 43.6 bits (98), Expect = 8e-04
 Identities = 24/70 (34%), Positives = 37/70 (52%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           IK    A+GEI ++ +  D KT   +GF FITY+    V +   +R H+I     E K A
Sbjct: 130 IKEYFGAFGEIENIELPMDTKTNERRGFCFITYTDEEPVKKLLESRYHQIGSGKCEIKVA 189

Query: 414 VPREEIKRPE 443
            P+E  ++ +
Sbjct: 190 QPKEVYRQQQ 199


>AB017018-1|BAA75239.1|  420|Homo sapiens JKTBP2 protein.
          Length = 420

 Score = 72.1 bits (169), Expect = 2e-12
 Identities = 34/86 (39%), Positives = 51/86 (59%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GE+VD  +  DP T RS+GFGF+ +  A  VD+    + HK+DG++++PKRA      K
Sbjct: 171 FGEVVDCTIKTDPVTGRSRGFGFVLFKDAASVDKVLELKEHKLDGKLIDPKRA------K 224

Query: 435 RPEASATVKKLFVAGLKQDIEEEDLE 512
             +     KK+FV GL  D  EE ++
Sbjct: 225 ALKGKEPPKKVFVGGLSPDTSEEQIK 250



 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 23/53 (43%), Positives = 33/53 (62%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           ++ L EY S FG +V  ++ TD  TG+ RGFGFV F D   VD+V   + H++
Sbjct: 161 KKDLTEYLSRFGEVVDCTIKTDPVTGRSRGFGFVLFKDAASVDKVLELKEHKL 213



 Score = 47.6 bits (108), Expect = 5e-05
 Identities = 18/51 (35%), Positives = 33/51 (64%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           +++EYF  FG I ++ +  D +T ++RGF F+ + D +PV ++   + HQI
Sbjct: 248 QIKEYFGAFGEIENIELPMDTKTNERRGFCFITYTDEEPVKKLLESRYHQI 298



 Score = 43.6 bits (98), Expect = 8e-04
 Identities = 24/70 (34%), Positives = 37/70 (52%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           IK    A+GEI ++ +  D KT   +GF FITY+    V +   +R H+I     E K A
Sbjct: 249 IKEYFGAFGEIENIELPMDTKTNERRGFCFITYTDEEPVKKLLESRYHQIGSGKCEIKVA 308

Query: 414 VPREEIKRPE 443
            P+E  ++ +
Sbjct: 309 QPKEVYRQQQ 318


>AC003982-3|AAB95636.1|  362|Homo sapiens WUGSC:H_166H1.2 protein.
          Length = 362

 Score = 71.7 bits (168), Expect = 3e-12
 Identities = 33/86 (38%), Positives = 53/86 (61%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GE+ + +VM+DP TKRS+GFGF+T+     VD+      H++D + ++PK A PR    
Sbjct: 43  FGEVKECLVMRDPLTKRSRGFGFVTFMDQAGVDKVLAQSRHELDSKTIDPKVAFPRR--A 100

Query: 435 RPEASATVKKLFVAGLKQDIEEEDLE 512
           +P+     KK+FV GL  +   ED++
Sbjct: 101 QPKMVTRTKKIFVGGLSVNTTVEDVK 126



 Score = 51.2 bits (117), Expect = 4e-06
 Identities = 24/73 (32%), Positives = 44/73 (60%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           +K+    +G++ D ++M D  T R +GFGF+T+    +V++      H+I+ ++VE K+A
Sbjct: 125 VKQYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFESEDIVEKVCEIHFHEINNKMVECKKA 184

Query: 414 VPREEIKRPEASA 452
            P+ E+  P  SA
Sbjct: 185 QPK-EVMSPTGSA 196



 Score = 50.0 bits (114), Expect = 9e-06
 Identities = 23/50 (46%), Positives = 29/50 (58%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           LREYF  FG +    V+ D  T + RGFGFV F D   VD+V  Q  H++
Sbjct: 36  LREYFGQFGEVKECLVMRDPLTKRSRGFGFVTFMDQAGVDKVLAQSRHEL 85



 Score = 48.8 bits (111), Expect = 2e-05
 Identities = 20/50 (40%), Positives = 31/50 (62%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           +++YF  FG +    ++ DK T + RGFGFV F+  D V++VC    H+I
Sbjct: 125 VKQYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFESEDIVEKVCEIHFHEI 174



 Score = 31.5 bits (68), Expect = 3.4
 Identities = 13/32 (40%), Positives = 21/32 (65%), Gaps = 1/32 (3%)
 Frame = +1

Query: 169 EEPEHTRKLFIGGLDYRTTDSSLKEFY-EHGE 261
           + P    K+FIGGL ++TT   L+E++ + GE
Sbjct: 14  DSPHDPCKMFIGGLSWQTTQEGLREYFGQFGE 45



 Score = 30.3 bits (65), Expect = 7.9
 Identities = 11/28 (39%), Positives = 19/28 (67%)
 Frame = +1

Query: 184 TRKLFIGGLDYRTTDSSLKEFYEHGEKL 267
           T+K+F+GGL   TT   +K+++E   K+
Sbjct: 108 TKKIFVGGLSVNTTVEDVKQYFEQFGKV 135


>AB012851-1|BAA33962.1|  362|Homo sapiens Musashi protein.
          Length = 362

 Score = 71.7 bits (168), Expect = 3e-12
 Identities = 33/86 (38%), Positives = 53/86 (61%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GE+ + +VM+DP TKRS+GFGF+T+     VD+      H++D + ++PK A PR    
Sbjct: 43  FGEVKECLVMRDPLTKRSRGFGFVTFMDQAGVDKVLAQSRHELDSKTIDPKVAFPRR--A 100

Query: 435 RPEASATVKKLFVAGLKQDIEEEDLE 512
           +P+     KK+FV GL  +   ED++
Sbjct: 101 QPKMVTRTKKIFVGGLSVNTTVEDVK 126



 Score = 51.2 bits (117), Expect = 4e-06
 Identities = 24/73 (32%), Positives = 44/73 (60%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           +K+    +G++ D ++M D  T R +GFGF+T+    +V++      H+I+ ++VE K+A
Sbjct: 125 VKQYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFESEDIVEKVCEIHFHEINNKMVECKKA 184

Query: 414 VPREEIKRPEASA 452
            P+ E+  P  SA
Sbjct: 185 QPK-EVMSPTGSA 196



 Score = 50.0 bits (114), Expect = 9e-06
 Identities = 23/50 (46%), Positives = 29/50 (58%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           LREYF  FG +    V+ D  T + RGFGFV F D   VD+V  Q  H++
Sbjct: 36  LREYFGQFGEVKECLVMRDPLTKRSRGFGFVTFMDQAGVDKVLAQSRHEL 85



 Score = 48.8 bits (111), Expect = 2e-05
 Identities = 20/50 (40%), Positives = 31/50 (62%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           +++YF  FG +    ++ DK T + RGFGFV F+  D V++VC    H+I
Sbjct: 125 VKQYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFESEDIVEKVCEIHFHEI 174



 Score = 31.5 bits (68), Expect = 3.4
 Identities = 13/32 (40%), Positives = 21/32 (65%), Gaps = 1/32 (3%)
 Frame = +1

Query: 169 EEPEHTRKLFIGGLDYRTTDSSLKEFY-EHGE 261
           + P    K+FIGGL ++TT   L+E++ + GE
Sbjct: 14  DSPHDPCKMFIGGLSWQTTQEGLREYFGQFGE 45



 Score = 30.3 bits (65), Expect = 7.9
 Identities = 11/28 (39%), Positives = 19/28 (67%)
 Frame = +1

Query: 184 TRKLFIGGLDYRTTDSSLKEFYEHGEKL 267
           T+K+F+GGL   TT   +K+++E   K+
Sbjct: 108 TKKIFVGGLSVNTTVEDVKQYFEQFGKV 135


>U76713-1|AAC50956.1|  331|Homo sapiens ABBP-1 protein.
          Length = 331

 Score = 69.7 bits (163), Expect = 1e-11
 Identities = 33/84 (39%), Positives = 53/84 (63%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GE+VD  +  DP T RS+GFGFI +  A  V++  + + H++DGR+++PK+A+  +  K
Sbjct: 91  FGEVVDCTIKMDPNTGRSRGFGFILFKDAASVEKVLDQKEHRLDGRVIDPKKAMAMK--K 148

Query: 435 RPEASATVKKLFVAGLKQDIEEED 506
            P     VKK+FV GL  +   E+
Sbjct: 149 DP-----VKKIFVGGLNPESPTEE 167



 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 20/53 (37%), Positives = 35/53 (66%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           ++ L++YF+ FG +V  ++  D  TG+ RGFGF+ F D   V++V  Q+ H++
Sbjct: 81  KKDLKDYFTKFGEVVDCTIKMDPNTGRSRGFGFILFKDAASVEKVLDQKEHRL 133



 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 18/51 (35%), Positives = 32/51 (62%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           ++REYF  FG I ++ +  D +  K+RGF F+ F + +PV +V  ++ H +
Sbjct: 168 KIREYFGEFGEIEAIELPMDPKLNKRRGFVFITFKEEEPVKKVLEKKFHTV 218



 Score = 39.5 bits (88), Expect = 0.013
 Identities = 19/57 (33%), Positives = 30/57 (52%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPRE 425
           +GEI  + +  DPK  + +GF FIT+ +   V +    + H + G   E K A P+E
Sbjct: 176 FGEIEAIELPMDPKLNKRRGFVFITFKEEEPVKKVLEKKFHTVSGSKCEIKVAQPKE 232


>M65028-1|AAA36575.1|  284|Homo sapiens hnRNP type A/B protein
           protein.
          Length = 284

 Score = 69.7 bits (163), Expect = 1e-11
 Identities = 33/84 (39%), Positives = 53/84 (63%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GE+VD  +  DP T RS+GFGFI +  A  V++  + + H++DGR+++PK+A+  +  K
Sbjct: 91  FGEVVDCTIKMDPNTGRSRGFGFILFKDAASVEKVLDQKEHRLDGRVIDPKKAMAMK--K 148

Query: 435 RPEASATVKKLFVAGLKQDIEEED 506
            P     VKK+FV GL  +   E+
Sbjct: 149 DP-----VKKIFVGGLNPESPTEE 167



 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 20/53 (37%), Positives = 35/53 (66%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           ++ L++YF+ FG +V  ++  D  TG+ RGFGF+ F D   V++V  Q+ H++
Sbjct: 81  KKDLKDYFTKFGEVVDCTIKMDPNTGRSRGFGFILFKDAASVEKVLDQKEHRL 133



 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 18/51 (35%), Positives = 32/51 (62%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           ++REYF  FG I ++ +  D +  K+RGF F+ F + +PV +V  ++ H +
Sbjct: 168 KIREYFGEFGEIEAIELPMDPKLNKRRGFVFITFKEEEPVKKVLEKKFHTV 218



 Score = 39.5 bits (88), Expect = 0.013
 Identities = 19/57 (33%), Positives = 30/57 (52%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPRE 425
           +GEI  + +  DPK  + +GF FIT+ +   V +    + H + G   E K A P+E
Sbjct: 176 FGEIEAIELPMDPKLNKRRGFVFITFKEEEPVKKVLEKKFHTVSGSKCEIKVAQPKE 232


>BC012062-1|AAH12062.1|  407|Homo sapiens DAZ associated protein 1
           protein.
          Length = 407

 Score = 63.7 bits (148), Expect = 7e-10
 Identities = 34/97 (35%), Positives = 53/97 (54%), Gaps = 12/97 (12%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPR---E 425
           +GE+VD V+MKD  T +S+GFGF+ +   + V     +RPH +DGR ++PK   PR    
Sbjct: 33  YGEVVDCVIMKDKTTNQSRGFGFVKFKDPNCVGTVLASRPHTLDGRNIDPKPCTPRGMQP 92

Query: 426 EIKRPEA---------SATVKKLFVAGLKQDIEEEDL 509
           E  RP+          ++   K+FV G+  +  E +L
Sbjct: 93  ERTRPKEGWQKGPRSDNSKSNKIFVGGIPHNCGETEL 129



 Score = 54.0 bits (124), Expect = 6e-07
 Identities = 25/57 (43%), Positives = 37/57 (64%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPRE 425
           +G + +VV++ D + +R +GFGFIT+     VD+A N   H I G+ VE KRA PR+
Sbjct: 136 FGVVTEVVMIYDAEKQRPRGFGFITFEDEQSVDQAVNMHFHDIMGKKVEVKRAEPRD 192



 Score = 49.6 bits (113), Expect = 1e-05
 Identities = 23/55 (41%), Positives = 32/55 (58%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFNI 670
           LR YFS +G +V   ++ DK T + RGFGFV+F D + V  V   + H +   NI
Sbjct: 26  LRSYFSQYGEVVDCVIMKDKTTNQSRGFGFVKFKDPNCVGTVLASRPHTLDGRNI 80



 Score = 47.6 bits (108), Expect = 5e-05
 Identities = 21/50 (42%), Positives = 28/50 (56%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           LREYF  FG +  V ++ D E  + RGFGF+ F+D   VD+      H I
Sbjct: 129 LREYFKKFGVVTEVVMIYDAEKQRPRGFGFITFEDEQSVDQAVNMHFHDI 178



 Score = 31.5 bits (68), Expect = 3.4
 Identities = 12/25 (48%), Positives = 20/25 (80%), Gaps = 1/25 (4%)
 Frame = +1

Query: 190 KLFIGGLDYRTTDSSLKEFY-EHGE 261
           KLF+GGLD+ TT  +L+ ++ ++GE
Sbjct: 11  KLFVGGLDWSTTQETLRSYFSQYGE 35


>AY678451-1|AAV97647.1|  454|Homo sapiens DAZAP1/MEF2D fusion
           protein protein.
          Length = 454

 Score = 63.7 bits (148), Expect = 7e-10
 Identities = 34/97 (35%), Positives = 53/97 (54%), Gaps = 12/97 (12%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPR---E 425
           +GE+VD V+MKD  T +S+GFGF+ +   + V     +RPH +DGR ++PK   PR    
Sbjct: 33  YGEVVDCVIMKDKTTNQSRGFGFVKFKDPNCVGTVLASRPHTLDGRNIDPKPCTPRGMQP 92

Query: 426 EIKRPEA---------SATVKKLFVAGLKQDIEEEDL 509
           E  RP+          ++   K+FV G+  +  E +L
Sbjct: 93  ERTRPKEGWQKGPRSDNSKSNKIFVGGIPHNCGETEL 129



 Score = 49.6 bits (113), Expect = 1e-05
 Identities = 23/55 (41%), Positives = 32/55 (58%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFNI 670
           LR YFS +G +V   ++ DK T + RGFGFV+F D + V  V   + H +   NI
Sbjct: 26  LRSYFSQYGEVVDCVIMKDKTTNQSRGFGFVKFKDPNCVGTVLASRPHTLDGRNI 80



 Score = 32.7 bits (71), Expect = 1.5
 Identities = 14/31 (45%), Positives = 19/31 (61%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFV 598
           LREYF  FG +  V ++ D E  + RG G+V
Sbjct: 129 LREYFKKFGVVTEVVMIYDAEKQRPRGNGYV 159



 Score = 31.5 bits (68), Expect = 3.4
 Identities = 12/25 (48%), Positives = 20/25 (80%), Gaps = 1/25 (4%)
 Frame = +1

Query: 190 KLFIGGLDYRTTDSSLKEFY-EHGE 261
           KLF+GGLD+ TT  +L+ ++ ++GE
Sbjct: 11  KLFVGGLDWSTTQETLRSYFSQYGE 35


>AF181719-1|AAF78364.1|  407|Homo sapiens DAZ associated protein 1
           protein.
          Length = 407

 Score = 63.3 bits (147), Expect = 9e-10
 Identities = 25/56 (44%), Positives = 37/56 (66%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPR 422
           +GE+VD V+MKD  T +S+GFGF+ +   + V     +RPH +DGR ++PK   PR
Sbjct: 33  YGEVVDCVIMKDKTTNQSRGFGFVKFKDPNCVGTVLASRPHTLDGRNIDPKPCTPR 88



 Score = 54.0 bits (124), Expect = 6e-07
 Identities = 25/57 (43%), Positives = 37/57 (64%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPRE 425
           +G + +VV++ D + +R +GFGFIT+     VD+A N   H I G+ VE KRA PR+
Sbjct: 136 FGVVTEVVMIYDAEKQRPRGFGFITFEDEQSVDQAVNMHFHDIMGKKVEVKRAEPRD 192



 Score = 49.6 bits (113), Expect = 1e-05
 Identities = 23/55 (41%), Positives = 32/55 (58%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFNI 670
           LR YFS +G +V   ++ DK T + RGFGFV+F D + V  V   + H +   NI
Sbjct: 26  LRSYFSQYGEVVDCVIMKDKTTNQSRGFGFVKFKDPNCVGTVLASRPHTLDGRNI 80



 Score = 47.6 bits (108), Expect = 5e-05
 Identities = 21/50 (42%), Positives = 28/50 (56%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           LREYF  FG +  V ++ D E  + RGFGF+ F+D   VD+      H I
Sbjct: 129 LREYFKKFGVVTEVVMIYDAEKQRPRGFGFITFEDEQSVDQAVNMHFHDI 178



 Score = 31.5 bits (68), Expect = 3.4
 Identities = 12/25 (48%), Positives = 20/25 (80%), Gaps = 1/25 (4%)
 Frame = +1

Query: 190 KLFIGGLDYRTTDSSLKEFY-EHGE 261
           KLF+GGLD+ TT  +L+ ++ ++GE
Sbjct: 11  KLFVGGLDWSTTQETLRSYFSQYGE 35


>AL354775-1|CAI12730.1|  276|Homo sapiens protein ( Human DNA
           sequence from clone RP11-223F20 on chromosome 13
           Contains a novel heterogeneous nuclear ribonucleoprotein
           family A protein and).
          Length = 276

 Score = 60.9 bits (141), Expect = 5e-09
 Identities = 27/64 (42%), Positives = 43/64 (67%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFNIWM*KK 685
           LR+YF     I ++ V+ D+++GKKRGF FV FDD+D +D++ +Q+ H I   N  + KK
Sbjct: 39  LRDYFEKCSKIETIEVMEDRQSGKKRGFAFVTFDDHDIIDKIVVQKYHTINGHNCEV-KK 97

Query: 686 PISE 697
            +S+
Sbjct: 98  ALSK 101



 Score = 51.2 bits (117), Expect = 4e-06
 Identities = 23/39 (58%), Positives = 30/39 (76%)
 Frame = +3

Query: 393 IVEPKRAVPREEIKRPEASATVKKLFVAGLKQDIEEEDL 509
           +VEPKRAV RE+  +P A  TVKK+FV G+K+D EE +L
Sbjct: 1   VVEPKRAVSREDSVKPVAHLTVKKIFVGGIKEDTEEYNL 39



 Score = 40.3 bits (90), Expect = 0.007
 Identities = 16/58 (27%), Positives = 36/58 (62%)
 Frame = +3

Query: 261 EIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +I  + VM+D ++ + +GF F+T+    ++D+    + H I+G   E K+A+ ++E++
Sbjct: 48  KIETIEVMEDRQSGKKRGFAFVTFDDHDIIDKIVVQKYHTINGHNCEVKKALSKQEMQ 105


>X04347-1|CAA27874.1|  196|Homo sapiens protein ( Human liver mRNA
           fragment DNA binding protein UPI homologue
           (C-terminus).  ).
          Length = 196

 Score = 56.4 bits (130), Expect = 1e-07
 Identities = 22/50 (44%), Positives = 33/50 (66%)
 Frame = +2

Query: 518 FSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIKRFN 667
           F  +G I  + ++TD  +GKKRGF FV FDD+D VD++ +Q+ H +   N
Sbjct: 1   FEQYGKIEVIEIMTDPGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHN 50



 Score = 42.3 bits (95), Expect = 0.002
 Identities = 17/65 (26%), Positives = 37/65 (56%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +G+I  + +M DP + + +GF F+T+     VD+    + H ++G   E ++A+ ++E+ 
Sbjct: 4   YGKIEVIEIMTDPGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMA 63

Query: 435 RPEAS 449
              +S
Sbjct: 64  SASSS 68


>AK056850-1|BAB71295.1|  289|Homo sapiens protein ( Homo sapiens
           cDNA FLJ32288 fis, clone PROST2000325, highly similar to
           Homo sapiens DAZ associated protein 1 (DAZAP1) mRNA. ).
          Length = 289

 Score = 54.0 bits (124), Expect = 6e-07
 Identities = 25/57 (43%), Positives = 37/57 (64%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPRE 425
           +G + +VV++ D + +R +GFGFIT+     VD+A N   H I G+ VE KRA PR+
Sbjct: 47  FGVVTEVVMIYDAEKQRPRGFGFITFEDEQSVDQAVNMHFHDIMGKKVEVKRAEPRD 103



 Score = 47.6 bits (108), Expect = 5e-05
 Identities = 21/50 (42%), Positives = 28/50 (56%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           LREYF  FG +  V ++ D E  + RGFGF+ F+D   VD+      H I
Sbjct: 40  LREYFKKFGVVTEVVMIYDAEKQRPRGFGFITFEDEQSVDQAVNMHFHDI 89


>U23731-1|AAA70033.1|  414|Homo sapiens TAR DNA-binding protein-43
           protein.
          Length = 414

 Score = 53.2 bits (122), Expect = 1e-06
 Identities = 24/50 (48%), Positives = 33/50 (66%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           L+EYFSTFG ++ V V  D +TG  +GFGFV F +Y+   +V + Q H I
Sbjct: 120 LKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKV-MSQRHMI 168



 Score = 49.6 bits (113), Expect = 1e-05
 Identities = 30/92 (32%), Positives = 49/92 (53%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           +K     +GE++ V V KD KT  SKGFGF+ +++     +  + R H IDGR  + K  
Sbjct: 120 LKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQR-HMIDGRWCDCKLP 178

Query: 414 VPREEIKRPEASATVKKLFVAGLKQDIEEEDL 509
             ++    P  S   +K+FV    +D+ E++L
Sbjct: 179 NSKQSQDEPLRS---RKVFVGRCTEDMTEDEL 207


>EF434182-1|ABO32291.1|  414|Homo sapiens TDP43 splice variant 1
           protein.
          Length = 414

 Score = 53.2 bits (122), Expect = 1e-06
 Identities = 24/50 (48%), Positives = 33/50 (66%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           L+EYFSTFG ++ V V  D +TG  +GFGFV F +Y+   +V + Q H I
Sbjct: 120 LKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKV-MSQRHMI 168



 Score = 49.6 bits (113), Expect = 1e-05
 Identities = 30/92 (32%), Positives = 49/92 (53%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           +K     +GE++ V V KD KT  SKGFGF+ +++     +  + R H IDGR  + K  
Sbjct: 120 LKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQR-HMIDGRWCDCKLP 178

Query: 414 VPREEIKRPEASATVKKLFVAGLKQDIEEEDL 509
             ++    P  S   +K+FV    +D+ E++L
Sbjct: 179 NSKQSQDEPLRS---RKVFVGRCTEDMTEDEL 207


>EF434181-1|ABO32290.1|  416|Homo sapiens TDP43 protein.
          Length = 416

 Score = 53.2 bits (122), Expect = 1e-06
 Identities = 24/50 (48%), Positives = 33/50 (66%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           L+EYFSTFG ++ V V  D +TG  +GFGFV F +Y+   +V + Q H I
Sbjct: 120 LKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKV-MSQRHMI 168



 Score = 49.6 bits (113), Expect = 1e-05
 Identities = 30/92 (32%), Positives = 49/92 (53%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           +K     +GE++ V V KD KT  SKGFGF+ +++     +  + R H IDGR  + K  
Sbjct: 120 LKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQR-HMIDGRWCDCKLP 178

Query: 414 VPREEIKRPEASATVKKLFVAGLKQDIEEEDL 509
             ++    P  S   +K+FV    +D+ E++L
Sbjct: 179 NSKQSQDEPLRS---RKVFVGRCTEDMTEDEL 207


>CR533534-1|CAG38565.1|  414|Homo sapiens TARDBP protein.
          Length = 414

 Score = 53.2 bits (122), Expect = 1e-06
 Identities = 24/50 (48%), Positives = 33/50 (66%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           L+EYFSTFG ++ V V  D +TG  +GFGFV F +Y+   +V + Q H I
Sbjct: 120 LKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKV-MSQRHMI 168



 Score = 49.6 bits (113), Expect = 1e-05
 Identities = 30/92 (32%), Positives = 49/92 (53%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           +K     +GE++ V V KD KT  SKGFGF+ +++     +  + R H IDGR  + K  
Sbjct: 120 LKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQR-HMIDGRWCDCKLP 178

Query: 414 VPREEIKRPEASATVKKLFVAGLKQDIEEEDL 509
             ++    P  S   +K+FV    +D+ E++L
Sbjct: 179 NSKQSQDEPLRS---RKVFVGRCTEDMTEDEL 207


>BC095435-1|AAH95435.1|  414|Homo sapiens TAR DNA binding protein
           protein.
          Length = 414

 Score = 53.2 bits (122), Expect = 1e-06
 Identities = 24/50 (48%), Positives = 33/50 (66%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           L+EYFSTFG ++ V V  D +TG  +GFGFV F +Y+   +V + Q H I
Sbjct: 120 LKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKV-MSQRHMI 168



 Score = 49.6 bits (113), Expect = 1e-05
 Identities = 30/92 (32%), Positives = 49/92 (53%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           +K     +GE++ V V KD KT  SKGFGF+ +++     +  + R H IDGR  + K  
Sbjct: 120 LKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQR-HMIDGRWCDCKLP 178

Query: 414 VPREEIKRPEASATVKKLFVAGLKQDIEEEDL 509
             ++    P  S   +K+FV    +D+ E++L
Sbjct: 179 NSKQSQDEPLRS---RKVFVGRCTEDMTEDEL 207


>BC071657-1|AAH71657.1|  414|Homo sapiens TARDBP protein protein.
          Length = 414

 Score = 53.2 bits (122), Expect = 1e-06
 Identities = 24/50 (48%), Positives = 33/50 (66%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           L+EYFSTFG ++ V V  D +TG  +GFGFV F +Y+   +V + Q H I
Sbjct: 120 LKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKV-MSQRHMI 168



 Score = 49.6 bits (113), Expect = 1e-05
 Identities = 30/92 (32%), Positives = 49/92 (53%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           +K     +GE++ V V KD KT  SKGFGF+ +++     +  + R H IDGR  + K  
Sbjct: 120 LKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQR-HMIDGRWCDCKLP 178

Query: 414 VPREEIKRPEASATVKKLFVAGLKQDIEEEDL 509
             ++    P  S   +K+FV    +D+ E++L
Sbjct: 179 NSKQSQDEPLRS---RKVFVGRCTEDMTEDEL 207


>AL109811-2|CAI22099.1|  295|Homo sapiens TAR DNA binding protein
           protein.
          Length = 295

 Score = 53.2 bits (122), Expect = 1e-06
 Identities = 24/50 (48%), Positives = 33/50 (66%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           L+EYFSTFG ++ V V  D +TG  +GFGFV F +Y+   +V + Q H I
Sbjct: 120 LKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKV-MSQRHMI 168



 Score = 49.6 bits (113), Expect = 1e-05
 Identities = 30/92 (32%), Positives = 49/92 (53%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           +K     +GE++ V V KD KT  SKGFGF+ +++     +  + R H IDGR  + K  
Sbjct: 120 LKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQR-HMIDGRWCDCKLP 178

Query: 414 VPREEIKRPEASATVKKLFVAGLKQDIEEEDL 509
             ++    P  S   +K+FV    +D+ E++L
Sbjct: 179 NSKQSQDEPLRS---RKVFVGRCTEDMTEDEL 207


>AL109811-1|CAI22098.1|  414|Homo sapiens TAR DNA binding protein
           protein.
          Length = 414

 Score = 53.2 bits (122), Expect = 1e-06
 Identities = 24/50 (48%), Positives = 33/50 (66%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           L+EYFSTFG ++ V V  D +TG  +GFGFV F +Y+   +V + Q H I
Sbjct: 120 LKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKV-MSQRHMI 168



 Score = 49.6 bits (113), Expect = 1e-05
 Identities = 30/92 (32%), Positives = 49/92 (53%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           +K     +GE++ V V KD KT  SKGFGF+ +++     +  + R H IDGR  + K  
Sbjct: 120 LKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQR-HMIDGRWCDCKLP 178

Query: 414 VPREEIKRPEASATVKKLFVAGLKQDIEEEDL 509
             ++    P  S   +K+FV    +D+ E++L
Sbjct: 179 NSKQSQDEPLRS---RKVFVGRCTEDMTEDEL 207


>AK222754-1|BAD96474.1|  414|Homo sapiens TAR DNA binding protein
           variant protein.
          Length = 414

 Score = 53.2 bits (122), Expect = 1e-06
 Identities = 24/50 (48%), Positives = 33/50 (66%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           L+EYFSTFG ++ V V  D +TG  +GFGFV F +Y+   +V + Q H I
Sbjct: 120 LKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKV-MSQRHMI 168



 Score = 48.0 bits (109), Expect = 4e-05
 Identities = 30/92 (32%), Positives = 48/92 (52%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           +K     +GE++ V V KD KT  SKGFGF+ +++     +  + R H IDGR  + K  
Sbjct: 120 LKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQR-HMIDGRWCDCKLP 178

Query: 414 VPREEIKRPEASATVKKLFVAGLKQDIEEEDL 509
             ++    P  S   +K+FV     D+ E++L
Sbjct: 179 NSKQSQDEPLRS---RKVFVGRCTGDMTEDEL 207


>AY547318-1|AAS55633.1|  236|Homo sapiens unknown protein.
          Length = 236

 Score = 52.4 bits (120), Expect = 2e-06
 Identities = 22/47 (46%), Positives = 28/47 (59%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           LR+YF  FG I    V+TD++TGK RG+GFV   D    +R C   N
Sbjct: 27  LRKYFEVFGEIEEAVVITDRQTGKSRGYGFVTMADRAAAERACKDPN 73



 Score = 37.1 bits (82), Expect = 0.069
 Identities = 17/53 (32%), Positives = 31/53 (58%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGR 392
           +++    +GEI + VV+ D +T +S+G+GF+T +     + A  +    IDGR
Sbjct: 27  LRKYFEVFGEIEEAVVITDRQTGKSRGYGFVTMADRAAAERACKDPNPIIDGR 79



 Score = 35.1 bits (77), Expect = 0.28
 Identities = 12/21 (57%), Positives = 19/21 (90%)
 Frame = +1

Query: 190 KLFIGGLDYRTTDSSLKEFYE 252
           K+F+GGL Y TTD+SL++++E
Sbjct: 12  KIFVGGLPYHTTDASLRKYFE 32


>AL136305-1|CAC36889.1|  236|Homo sapiens protein ( Human DNA
           sequence from clone RP1-259A10 on chromosome 6p22.1-23
           Contains the gene for an ssDNA binding protein and a CpG
           island.  ).
          Length = 236

 Score = 52.4 bits (120), Expect = 2e-06
 Identities = 22/47 (46%), Positives = 28/47 (59%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           LR+YF  FG I    V+TD++TGK RG+GFV   D    +R C   N
Sbjct: 27  LRKYFEVFGEIEEAVVITDRQTGKSRGYGFVTMADRAAAERACKDPN 73



 Score = 37.1 bits (82), Expect = 0.069
 Identities = 17/53 (32%), Positives = 31/53 (58%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGR 392
           +++    +GEI + VV+ D +T +S+G+GF+T +     + A  +    IDGR
Sbjct: 27  LRKYFEVFGEIEEAVVITDRQTGKSRGYGFVTMADRAAAERACKDPNPIIDGR 79



 Score = 35.1 bits (77), Expect = 0.28
 Identities = 12/21 (57%), Positives = 19/21 (90%)
 Frame = +1

Query: 190 KLFIGGLDYRTTDSSLKEFYE 252
           K+F+GGL Y TTD+SL++++E
Sbjct: 12  KIFVGGLPYHTTDASLRKYFE 32


>AK095016-1|BAC04474.1|  211|Homo sapiens protein ( Homo sapiens
           cDNA FLJ37697 fis, clone BRHIP2015360, highly similar to
           Xenopus laevis RRM-containing protein SEB-4 mRNA. ).
          Length = 211

 Score = 52.4 bits (120), Expect = 2e-06
 Identities = 22/47 (46%), Positives = 28/47 (59%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           LR+YF  FG I    V+TD++TGK RG+GFV   D    +R C   N
Sbjct: 27  LRKYFEVFGEIEEAVVITDRQTGKSRGYGFVTMADRAAAERACKDPN 73



 Score = 37.1 bits (82), Expect = 0.069
 Identities = 17/53 (32%), Positives = 31/53 (58%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGR 392
           +++    +GEI + VV+ D +T +S+G+GF+T +     + A  +    IDGR
Sbjct: 27  LRKYFEVFGEIEEAVVITDRQTGKSRGYGFVTMADRAAAERACKDPNPIIDGR 79



 Score = 35.1 bits (77), Expect = 0.28
 Identities = 12/21 (57%), Positives = 19/21 (90%)
 Frame = +1

Query: 190 KLFIGGLDYRTTDSSLKEFYE 252
           K+F+GGL Y TTD+SL++++E
Sbjct: 12  KIFVGGLPYHTTDASLRKYFE 32


>X75315-1|CAA53064.1|  230|Homo sapiens SEB4B protein.
          Length = 230

 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 22/47 (46%), Positives = 29/47 (61%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           LR+YF  FG+I    V+TD++TGK RG+GFV   D    +R C   N
Sbjct: 41  LRKYFEGFGDIEEAVVITDRQTGKSRGYGFVTMADRAAAERACKDPN 87



 Score = 35.9 bits (79), Expect = 0.16
 Identities = 16/53 (30%), Positives = 31/53 (58%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGR 392
           +++    +G+I + VV+ D +T +S+G+GF+T +     + A  +    IDGR
Sbjct: 41  LRKYFEGFGDIEEAVVITDRQTGKSRGYGFVTMADRAAAERACKDPNPIIDGR 93



 Score = 35.1 bits (77), Expect = 0.28
 Identities = 12/21 (57%), Positives = 19/21 (90%)
 Frame = +1

Query: 190 KLFIGGLDYRTTDSSLKEFYE 252
           K+F+GGL Y TTD+SL++++E
Sbjct: 26  KIFVGGLPYHTTDASLRKYFE 46


>X75314-1|CAA53063.1|  229|Homo sapiens SEB4D protein.
          Length = 229

 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 22/47 (46%), Positives = 29/47 (61%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           LR+YF  FG+I    V+TD++TGK RG+GFV   D    +R C   N
Sbjct: 40  LRKYFEGFGDIEEAVVITDRQTGKSRGYGFVTMADRAAAERACKDPN 86



 Score = 35.9 bits (79), Expect = 0.16
 Identities = 16/53 (30%), Positives = 31/53 (58%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGR 392
           +++    +G+I + VV+ D +T +S+G+GF+T +     + A  +    IDGR
Sbjct: 40  LRKYFEGFGDIEEAVVITDRQTGKSRGYGFVTMADRAAAERACKDPNPIIDGR 92



 Score = 35.1 bits (77), Expect = 0.28
 Identities = 12/21 (57%), Positives = 19/21 (90%)
 Frame = +1

Query: 190 KLFIGGLDYRTTDSSLKEFYE 252
           K+F+GGL Y TTD+SL++++E
Sbjct: 25  KIFVGGLPYHTTDASLRKYFE 45


>BC018711-1|AAH18711.1|  216|Homo sapiens RBM38 protein protein.
          Length = 216

 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 22/47 (46%), Positives = 29/47 (61%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           LR+YF  FG+I    V+TD++TGK RG+GFV   D    +R C   N
Sbjct: 27  LRKYFEGFGDIEEAVVITDRQTGKSRGYGFVTMADRAAAERACKDPN 73



 Score = 35.9 bits (79), Expect = 0.16
 Identities = 16/53 (30%), Positives = 31/53 (58%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGR 392
           +++    +G+I + VV+ D +T +S+G+GF+T +     + A  +    IDGR
Sbjct: 27  LRKYFEGFGDIEEAVVITDRQTGKSRGYGFVTMADRAAAERACKDPNPIIDGR 79



 Score = 35.1 bits (77), Expect = 0.28
 Identities = 12/21 (57%), Positives = 19/21 (90%)
 Frame = +1

Query: 190 KLFIGGLDYRTTDSSLKEFYE 252
           K+F+GGL Y TTD+SL++++E
Sbjct: 12  KIFVGGLPYHTTDASLRKYFE 32


>AF432218-1|AAL99924.1|  216|Homo sapiens CLL-associated antigen
           KW-5 protein.
          Length = 216

 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 22/47 (46%), Positives = 29/47 (61%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           LR+YF  FG+I    V+TD++TGK RG+GFV   D    +R C   N
Sbjct: 27  LRKYFEGFGDIEEAVVITDRQTGKSRGYGFVTMADRAAAERACKDPN 73



 Score = 35.9 bits (79), Expect = 0.16
 Identities = 16/53 (30%), Positives = 31/53 (58%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGR 392
           +++    +G+I + VV+ D +T +S+G+GF+T +     + A  +    IDGR
Sbjct: 27  LRKYFEGFGDIEEAVVITDRQTGKSRGYGFVTMADRAAAERACKDPNPIIDGR 79



 Score = 35.1 bits (77), Expect = 0.28
 Identities = 12/21 (57%), Positives = 19/21 (90%)
 Frame = +1

Query: 190 KLFIGGLDYRTTDSSLKEFYE 252
           K+F+GGL Y TTD+SL++++E
Sbjct: 12  KIFVGGLPYHTTDASLRKYFE 32


>AB073212-1|BAB70469.1|  179|Homo sapiens Musashi1 protein.
          Length = 179

 Score = 51.2 bits (117), Expect = 4e-06
 Identities = 24/73 (32%), Positives = 44/73 (60%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           +K+    +G++ D ++M D  T R +GFGF+T+    +V++      H+I+ ++VE K+A
Sbjct: 59  VKQYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFESEDIVEKVCEIHFHEINNKMVECKKA 118

Query: 414 VPREEIKRPEASA 452
            P+ E+  P  SA
Sbjct: 119 QPK-EVMSPTGSA 130



 Score = 48.8 bits (111), Expect = 2e-05
 Identities = 20/50 (40%), Positives = 31/50 (62%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           +++YF  FG +    ++ DK T + RGFGFV F+  D V++VC    H+I
Sbjct: 59  VKQYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFESEDIVEKVCEIHFHEI 108



 Score = 37.5 bits (83), Expect = 0.052
 Identities = 19/62 (30%), Positives = 32/62 (51%)
 Frame = +3

Query: 327 TYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIKRPEASATVKKLFVAGLKQDIEEED 506
           T+     VD+      H++D + ++PK A PR    +P+     KK+FV GL  +   ED
Sbjct: 1   TFMDQAGVDKVLAQSRHELDSKTIDPKVAFPRR--AQPKMVTRTKKIFVGGLSVNTTVED 58

Query: 507 LE 512
           ++
Sbjct: 59  VK 60



 Score = 30.3 bits (65), Expect = 7.9
 Identities = 11/28 (39%), Positives = 19/28 (67%)
 Frame = +1

Query: 184 TRKLFIGGLDYRTTDSSLKEFYEHGEKL 267
           T+K+F+GGL   TT   +K+++E   K+
Sbjct: 42  TKKIFVGGLSVNTTVEDVKQYFEQFGKV 69


>AB072592-1|BAB69769.1|  181|Homo sapiens Musashi1 protein.
          Length = 181

 Score = 51.2 bits (117), Expect = 4e-06
 Identities = 24/73 (32%), Positives = 44/73 (60%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           +K+    +G++ D ++M D  T R +GFGF+T+    +V++      H+I+ ++VE K+A
Sbjct: 62  VKQYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFESEDIVEKVCEIHFHEINNKMVECKKA 121

Query: 414 VPREEIKRPEASA 452
            P+ E+  P  SA
Sbjct: 122 QPK-EVMSPTGSA 133



 Score = 48.8 bits (111), Expect = 2e-05
 Identities = 20/50 (40%), Positives = 31/50 (62%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           +++YF  FG +    ++ DK T + RGFGFV F+  D V++VC    H+I
Sbjct: 62  VKQYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFESEDIVEKVCEIHFHEI 111



 Score = 43.6 bits (98), Expect = 8e-04
 Identities = 21/65 (32%), Positives = 35/65 (53%)
 Frame = +3

Query: 318 GFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIKRPEASATVKKLFVAGLKQDIE 497
           GF+T+     VD+      H++D + ++PK A PR    +P+     KK+FV GL  +  
Sbjct: 1   GFVTFMDQAGVDKVLAQSRHELDSKTIDPKVAFPRR--AQPKMVTRTKKIFVGGLSVNTT 58

Query: 498 EEDLE 512
            ED++
Sbjct: 59  VEDVK 63



 Score = 30.3 bits (65), Expect = 7.9
 Identities = 11/28 (39%), Positives = 19/28 (67%)
 Frame = +1

Query: 184 TRKLFIGGLDYRTTDSSLKEFYEHGEKL 267
           T+K+F+GGL   TT   +K+++E   K+
Sbjct: 45  TKKIFVGGLSVNTTVEDVKQYFEQFGKV 72


>AB072591-1|BAB69768.1|  181|Homo sapiens Musashi1 protein.
          Length = 181

 Score = 51.2 bits (117), Expect = 4e-06
 Identities = 24/73 (32%), Positives = 44/73 (60%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           +K+    +G++ D ++M D  T R +GFGF+T+    +V++      H+I+ ++VE K+A
Sbjct: 62  VKQYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFESEDIVEKVCEIHFHEINNKMVECKKA 121

Query: 414 VPREEIKRPEASA 452
            P+ E+  P  SA
Sbjct: 122 QPK-EVMSPTGSA 133



 Score = 48.8 bits (111), Expect = 2e-05
 Identities = 20/50 (40%), Positives = 31/50 (62%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           +++YF  FG +    ++ DK T + RGFGFV F+  D V++VC    H+I
Sbjct: 62  VKQYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFESEDIVEKVCEIHFHEI 111



 Score = 43.6 bits (98), Expect = 8e-04
 Identities = 21/65 (32%), Positives = 35/65 (53%)
 Frame = +3

Query: 318 GFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIKRPEASATVKKLFVAGLKQDIE 497
           GF+T+     VD+      H++D + ++PK A PR    +P+     KK+FV GL  +  
Sbjct: 1   GFVTFMDQAGVDKVLAQSRHELDSKTIDPKVAFPRR--AQPKMVTRTKKIFVGGLSVNTT 58

Query: 498 EEDLE 512
            ED++
Sbjct: 59  VEDVK 63



 Score = 30.3 bits (65), Expect = 7.9
 Identities = 11/28 (39%), Positives = 19/28 (67%)
 Frame = +1

Query: 184 TRKLFIGGLDYRTTDSSLKEFYEHGEKL 267
           T+K+F+GGL   TT   +K+++E   K+
Sbjct: 45  TKKIFVGGLSVNTTVEDVKQYFEQFGKV 72


>AB072590-1|BAB69767.1|  180|Homo sapiens Musashi1 protein.
          Length = 180

 Score = 51.2 bits (117), Expect = 4e-06
 Identities = 24/73 (32%), Positives = 44/73 (60%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           +K+    +G++ D ++M D  T R +GFGF+T+    +V++      H+I+ ++VE K+A
Sbjct: 62  VKQYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFESEDIVEKVCEIHFHEINNKMVECKKA 121

Query: 414 VPREEIKRPEASA 452
            P+ E+  P  SA
Sbjct: 122 QPK-EVMSPTGSA 133



 Score = 48.8 bits (111), Expect = 2e-05
 Identities = 20/50 (40%), Positives = 31/50 (62%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           +++YF  FG +    ++ DK T + RGFGFV F+  D V++VC    H+I
Sbjct: 62  VKQYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFESEDIVEKVCEIHFHEI 111



 Score = 43.6 bits (98), Expect = 8e-04
 Identities = 21/65 (32%), Positives = 35/65 (53%)
 Frame = +3

Query: 318 GFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIKRPEASATVKKLFVAGLKQDIE 497
           GF+T+     VD+      H++D + ++PK A PR    +P+     KK+FV GL  +  
Sbjct: 1   GFVTFMDQAGVDKVLAQSRHELDSKTIDPKVAFPRR--AQPKMVTRTKKIFVGGLSVNTT 58

Query: 498 EEDLE 512
            ED++
Sbjct: 59  VEDVK 63



 Score = 30.3 bits (65), Expect = 7.9
 Identities = 11/28 (39%), Positives = 19/28 (67%)
 Frame = +1

Query: 184 TRKLFIGGLDYRTTDSSLKEFYEHGEKL 267
           T+K+F+GGL   TT   +K+++E   K+
Sbjct: 45  TKKIFVGGLSVNTTVEDVKQYFEQFGKV 72


>BC017560-1|AAH17560.1|  151|Homo sapiens MSI2 protein protein.
          Length = 151

 Score = 50.4 bits (115), Expect = 7e-06
 Identities = 22/69 (31%), Positives = 42/69 (60%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           +K+    +G++ D ++M D  T R +GFGF+T+    +V++      H+I+ ++VE K+A
Sbjct: 22  VKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFENEDVVEKVCEIHFHEINNKMVECKKA 81

Query: 414 VPREEIKRP 440
            P+E +  P
Sbjct: 82  QPKEVMFPP 90



 Score = 50.0 bits (114), Expect = 9e-06
 Identities = 20/50 (40%), Positives = 32/50 (64%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           +++YF  FG +    ++ DK T + RGFGFV F++ D V++VC    H+I
Sbjct: 22  VKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFENEDVVEKVCEIHFHEI 71


>BC011731-1|AAH11731.1|  449|Homo sapiens GTPase activating protein
           (SH3 domain) binding protein 2 protein.
          Length = 449

 Score = 47.6 bits (108), Expect = 5e-05
 Identities = 20/44 (45%), Positives = 29/44 (65%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCL 637
           L+E+F +FGN+V + + T    GK   FGFV FDD +PV R+ +
Sbjct: 314 LKEFFMSFGNVVELRINTKGVGGKLPNFGFVVFDDSEPVQRILI 357


>AF145284-1|AAD51932.1|  482|Homo sapiens RNA-binding protein
           isoform G3BP-2a protein.
          Length = 482

 Score = 47.6 bits (108), Expect = 5e-05
 Identities = 20/44 (45%), Positives = 29/44 (65%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCL 637
           L+E+F +FGN+V + + T    GK   FGFV FDD +PV R+ +
Sbjct: 347 LKEFFMSFGNVVELRINTKGVGGKLPNFGFVVFDDSEPVQRILI 390


>AF053535-1|AAC95292.1|  449|Homo sapiens ras-GAP/RNA binding
           protein G3BP2 protein.
          Length = 449

 Score = 47.6 bits (108), Expect = 5e-05
 Identities = 20/44 (45%), Positives = 29/44 (65%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCL 637
           L+E+F +FGN+V + + T    GK   FGFV FDD +PV R+ +
Sbjct: 314 LKEFFMSFGNVVELRINTKGVGGKLPNFGFVVFDDSEPVQRILI 357


>AB014560-1|BAA31635.2|  490|Homo sapiens KIAA0660 protein protein.
          Length = 490

 Score = 47.6 bits (108), Expect = 5e-05
 Identities = 20/44 (45%), Positives = 29/44 (65%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCL 637
           L+E+F +FGN+V + + T    GK   FGFV FDD +PV R+ +
Sbjct: 355 LKEFFMSFGNVVELRINTKGVGGKLPNFGFVVFDDSEPVQRILI 398


>AF051311-1|AAC15705.1|  449|Homo sapiens Ras-GAP SH3 binding
           protein protein.
          Length = 449

 Score = 46.8 bits (106), Expect = 8e-05
 Identities = 20/44 (45%), Positives = 29/44 (65%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCL 637
           L+E+F +FGN+V + + T    GK   FGFV FDD +PV R+ +
Sbjct: 314 LKEFFMSFGNVVVLRINTKGVGGKLPNFGFVVFDDSEPVQRILI 357


>AK128423-1|BAC87434.1|  135|Homo sapiens protein ( Homo sapiens
           cDNA FLJ46566 fis, clone THYMU3040829, moderately
           similar to Cold-inducible RNA-binding protein. ).
          Length = 135

 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 20/51 (39%), Positives = 30/51 (58%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQIK 658
           L + FS +G I  V VV D+ET + RGFGFV F++ D      +  N +++
Sbjct: 22  LEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKVR 72



 Score = 41.5 bits (93), Expect = 0.003
 Identities = 17/44 (38%), Positives = 34/44 (77%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQN 365
           ++++   +G+I +VVV+KD +T+RS+GFGF+T+     +D+A++
Sbjct: 22  LEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFEN---IDDAKD 62


>Z23064-1|CAA80599.1|  391|Homo sapiens hnRNP G protein protein.
          Length = 391

 Score = 45.2 bits (102), Expect = 3e-04
 Identities = 20/54 (37%), Positives = 37/54 (68%), Gaps = 1/54 (1%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITY-SQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           +G IV+V++MKD +T +S+GF F+T+ S A   D A++     +DG+ ++ ++A
Sbjct: 31  YGRIVEVLLMKDRETNKSRGFAFVTFESPADAKDAARDMNGKSLDGKAIKVEQA 84



 Score = 38.3 bits (85), Expect = 0.030
 Identities = 16/36 (44%), Positives = 22/36 (61%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           + L   F  +G IV V ++ D+ET K RGF FV F+
Sbjct: 22  KALEAVFGKYGRIVEVLLMKDRETNKSRGFAFVTFE 57


>BC007435-1|AAH07435.1|  391|Homo sapiens RNA binding motif protein,
           X-linked protein.
          Length = 391

 Score = 45.2 bits (102), Expect = 3e-04
 Identities = 20/54 (37%), Positives = 37/54 (68%), Gaps = 1/54 (1%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITY-SQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           +G IV+V++MKD +T +S+GF F+T+ S A   D A++     +DG+ ++ ++A
Sbjct: 31  YGRIVEVLLMKDRETNKSRGFAFVTFESPADAKDAARDMNGKSLDGKAIKVEQA 84



 Score = 38.3 bits (85), Expect = 0.030
 Identities = 16/36 (44%), Positives = 22/36 (61%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           + L   F  +G IV V ++ D+ET K RGF FV F+
Sbjct: 22  KALEAVFGKYGRIVEVLLMKDRETNKSRGFAFVTFE 57


>BC006550-1|AAH06550.1|  391|Homo sapiens RNA binding motif protein,
           X-linked protein.
          Length = 391

 Score = 45.2 bits (102), Expect = 3e-04
 Identities = 20/54 (37%), Positives = 37/54 (68%), Gaps = 1/54 (1%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITY-SQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           +G IV+V++MKD +T +S+GF F+T+ S A   D A++     +DG+ ++ ++A
Sbjct: 31  YGRIVEVLLMKDRETNKSRGFAFVTFESPADAKDAARDMNGKSLDGKAIKVEQA 84



 Score = 38.3 bits (85), Expect = 0.030
 Identities = 16/36 (44%), Positives = 22/36 (61%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           + L   F  +G IV V ++ D+ET K RGF FV F+
Sbjct: 22  KALEAVFGKYGRIVEVLLMKDRETNKSRGFAFVTFE 57


>AY464692-1|AAR28036.1|  391|Homo sapiens heterogeneous nuclear
           ribonucleoprotein G protein.
          Length = 391

 Score = 45.2 bits (102), Expect = 3e-04
 Identities = 20/54 (37%), Positives = 37/54 (68%), Gaps = 1/54 (1%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITY-SQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           +G IV+V++MKD +T +S+GF F+T+ S A   D A++     +DG+ ++ ++A
Sbjct: 31  YGRIVEVLLMKDRETNKSRGFAFVTFESPADAKDAARDMNGKSLDGKAIKVEQA 84



 Score = 38.3 bits (85), Expect = 0.030
 Identities = 16/36 (44%), Positives = 22/36 (61%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           + L   F  +G IV V ++ D+ET K RGF FV F+
Sbjct: 22  KALEAVFGKYGRIVEVLLMKDRETNKSRGFAFVTFE 57


>AL683813-6|CAI39448.1|  391|Homo sapiens RNA binding motif protein,
           X-linked protein.
          Length = 391

 Score = 45.2 bits (102), Expect = 3e-04
 Identities = 20/54 (37%), Positives = 37/54 (68%), Gaps = 1/54 (1%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITY-SQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           +G IV+V++MKD +T +S+GF F+T+ S A   D A++     +DG+ ++ ++A
Sbjct: 31  YGRIVEVLLMKDRETNKSRGFAFVTFESPADAKDAARDMNGKSLDGKAIKVEQA 84



 Score = 38.3 bits (85), Expect = 0.030
 Identities = 16/36 (44%), Positives = 22/36 (61%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           + L   F  +G IV V ++ D+ET K RGF FV F+
Sbjct: 22  KALEAVFGKYGRIVEVLLMKDRETNKSRGFAFVTFE 57


>AF266723-1|AAK58567.1|  391|Homo sapiens RBMX protein.
          Length = 391

 Score = 45.2 bits (102), Expect = 3e-04
 Identities = 20/54 (37%), Positives = 37/54 (68%), Gaps = 1/54 (1%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITY-SQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           +G IV+V++MKD +T +S+GF F+T+ S A   D A++     +DG+ ++ ++A
Sbjct: 31  YGRIVEVLLMKDRETNKSRGFAFVTFESPADAKDAARDMNGKSLDGKAIKVEQA 84



 Score = 38.3 bits (85), Expect = 0.030
 Identities = 16/36 (44%), Positives = 22/36 (61%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           + L   F  +G IV V ++ D+ET K RGF FV F+
Sbjct: 22  KALEAVFGKYGRIVEVLLMKDRETNKSRGFAFVTFE 57


>Z48501-1|CAA88401.1|  522|Homo sapiens polyadenylate binding
           protein II protein.
          Length = 522

 Score = 44.8 bits (101), Expect = 3e-04
 Identities = 20/48 (41%), Positives = 31/48 (64%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           RL++ F  FG  +SV V+TD E+GK +GFGFV F+ ++   +   + N
Sbjct: 181 RLKDLFGKFGPALSVKVMTD-ESGKSKGFGFVSFERHEDAQKAVDEMN 227



 Score = 37.9 bits (84), Expect = 0.039
 Identities = 20/51 (39%), Positives = 28/51 (54%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           RLR+ FS FG I S  V+   E G+ +GFGFV F   +   +   + N +I
Sbjct: 284 RLRKEFSPFGTITSAKVM--MEGGRSKGFGFVCFSSPEEATKAVTEMNGRI 332



 Score = 30.3 bits (65), Expect = 7.9
 Identities = 25/86 (29%), Positives = 45/86 (52%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           +K +   +G  + V VM D   K SKGFGF+++ + H  ++AQ     +++G+ +  K+ 
Sbjct: 182 LKDLFGKFGPALSVKVMTDESGK-SKGFGFVSF-ERH--EDAQ-KAVDEMNGKELNGKQI 236

Query: 414 VPREEIKRPEASATVKKLFVAGLKQD 491
                 K+ E    +K+ F   +KQD
Sbjct: 237 YVGRAQKKVERQTELKRKF-EQMKQD 261


>U68104-1|AAD08718.1|  636|Homo sapiens poly(A)-binding protein
           protein.
          Length = 636

 Score = 44.8 bits (101), Expect = 3e-04
 Identities = 20/48 (41%), Positives = 31/48 (64%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           RL++ F  FG  +SV V+TD E+GK +GFGFV F+ ++   +   + N
Sbjct: 206 RLKDLFGKFGPALSVKVMTD-ESGKSKGFGFVSFERHEDAQKAVDEMN 252



 Score = 37.9 bits (84), Expect = 0.039
 Identities = 20/51 (39%), Positives = 28/51 (54%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           RLR+ FS FG I S  V+   E G+ +GFGFV F   +   +   + N +I
Sbjct: 309 RLRKEFSPFGTITSAKVM--MEGGRSKGFGFVCFSSPEEATKAVTEMNGRI 357



 Score = 30.3 bits (65), Expect = 7.9
 Identities = 25/86 (29%), Positives = 45/86 (52%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           +K +   +G  + V VM D   K SKGFGF+++ + H  ++AQ     +++G+ +  K+ 
Sbjct: 207 LKDLFGKFGPALSVKVMTDESGK-SKGFGFVSF-ERH--EDAQ-KAVDEMNGKELNGKQI 261

Query: 414 VPREEIKRPEASATVKKLFVAGLKQD 491
                 K+ E    +K+ F   +KQD
Sbjct: 262 YVGRAQKKVERQTELKRKF-EQMKQD 286


>DQ120640-1|ABB92425.1|  630|Homo sapiens PABP3 protein.
          Length = 630

 Score = 44.8 bits (101), Expect = 3e-04
 Identities = 20/48 (41%), Positives = 31/48 (64%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           RL++ F  FG  +SV V+TD E+GK +GFGFV F+ ++   +   + N
Sbjct: 206 RLKDLFGKFGPALSVKVMTD-ESGKSKGFGFVSFERHEDAQKAVDEMN 252



 Score = 37.9 bits (84), Expect = 0.039
 Identities = 20/51 (39%), Positives = 28/51 (54%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           RLR+ FS FG I S  V+   E G+ +GFGFV F   +   +   + N +I
Sbjct: 309 RLRKAFSPFGTITSAKVM--MEGGRSKGFGFVCFSSPEEATKAVTEMNGRI 357



 Score = 30.7 bits (66), Expect = 6.0
 Identities = 25/86 (29%), Positives = 45/86 (52%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           +K +   +G  + V VM D   K SKGFGF+++ + H  ++AQ     +++G+ +  K+ 
Sbjct: 207 LKDLFGKFGPALSVKVMTDESGK-SKGFGFVSF-ERH--EDAQ-KAVDEMNGKELNGKQI 261

Query: 414 VPREEIKRPEASATVKKLFVAGLKQD 491
                 K+ E    +K+ F   +KQD
Sbjct: 262 YVGRAQKKVERQTELKRTF-EQMKQD 286


>BC045608-1|AAH45608.1|  631|Homo sapiens poly(A) binding protein,
           cytoplasmic 3 protein.
          Length = 631

 Score = 44.8 bits (101), Expect = 3e-04
 Identities = 20/48 (41%), Positives = 31/48 (64%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           RL++ F  FG  +SV V+TD E+GK +GFGFV F+ ++   +   + N
Sbjct: 206 RLKDLFGKFGPALSVKVMTD-ESGKSKGFGFVSFERHEDAQKAVDEMN 252



 Score = 37.9 bits (84), Expect = 0.039
 Identities = 20/51 (39%), Positives = 28/51 (54%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           RLR+ FS FG I S  V+   E G+ +GFGFV F   +   +   + N +I
Sbjct: 309 RLRKAFSPFGTITSAKVM--MEGGRSKGFGFVCFSSPEEATKAVTEMNGRI 357



 Score = 30.7 bits (66), Expect = 6.0
 Identities = 25/86 (29%), Positives = 45/86 (52%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           +K +   +G  + V VM D   K SKGFGF+++ + H  ++AQ     +++G+ +  K+ 
Sbjct: 207 LKDLFGKFGPALSVKVMTDESGK-SKGFGFVSF-ERH--EDAQ-KAVDEMNGKELNGKQI 261

Query: 414 VPREEIKRPEASATVKKLFVAGLKQD 491
                 K+ E    +K+ F   +KQD
Sbjct: 262 YVGRAQKKVERQTELKRTF-EQMKQD 286


>BC041863-1|AAH41863.1|  636|Homo sapiens poly(A) binding protein,
           cytoplasmic 1 protein.
          Length = 636

 Score = 44.8 bits (101), Expect = 3e-04
 Identities = 20/48 (41%), Positives = 31/48 (64%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           RL++ F  FG  +SV V+TD E+GK +GFGFV F+ ++   +   + N
Sbjct: 206 RLKDLFGKFGPALSVKVMTD-ESGKSKGFGFVSFERHEDAQKAVDEMN 252



 Score = 37.9 bits (84), Expect = 0.039
 Identities = 20/51 (39%), Positives = 28/51 (54%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           RLR+ FS FG I S  V+   E G+ +GFGFV F   +   +   + N +I
Sbjct: 309 RLRKEFSPFGTITSAKVM--MEGGRSKGFGFVCFSSPEEATKAVTEMNGRI 357



 Score = 30.3 bits (65), Expect = 7.9
 Identities = 25/86 (29%), Positives = 45/86 (52%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           +K +   +G  + V VM D   K SKGFGF+++ + H  ++AQ     +++G+ +  K+ 
Sbjct: 207 LKDLFGKFGPALSVKVMTDESGK-SKGFGFVSF-ERH--EDAQ-KAVDEMNGKELNGKQI 261

Query: 414 VPREEIKRPEASATVKKLFVAGLKQD 491
                 K+ E    +K+ F   +KQD
Sbjct: 262 YVGRAQKKVERQTELKRKF-EQMKQD 286


>BC027617-1|AAH27617.1|  631|Homo sapiens poly(A) binding protein,
           cytoplasmic 3 protein.
          Length = 631

 Score = 44.8 bits (101), Expect = 3e-04
 Identities = 20/48 (41%), Positives = 31/48 (64%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           RL++ F  FG  +SV V+TD E+GK +GFGFV F+ ++   +   + N
Sbjct: 206 RLKDLFGKFGPALSVKVMTD-ESGKSKGFGFVSFERHEDAQKAVDEMN 252



 Score = 37.9 bits (84), Expect = 0.039
 Identities = 20/51 (39%), Positives = 28/51 (54%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           RLR+ FS FG I S  V+   E G+ +GFGFV F   +   +   + N +I
Sbjct: 309 RLRKAFSPFGTITSAKVM--MEGGRSKGFGFVCFSSPEEATKAVTEMNGRI 357



 Score = 30.7 bits (66), Expect = 6.0
 Identities = 25/86 (29%), Positives = 45/86 (52%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           +K +   +G  + V VM D   K SKGFGF+++ + H  ++AQ     +++G+ +  K+ 
Sbjct: 207 LKDLFGKFGPALSVKVMTDESGK-SKGFGFVSF-ERH--EDAQ-KAVDEMNGKELNGKQI 261

Query: 414 VPREEIKRPEASATVKKLFVAGLKQD 491
                 K+ E    +K+ F   +KQD
Sbjct: 262 YVGRAQKKVERQTELKRTF-EQMKQD 286


>BC023520-1|AAH23520.1|  636|Homo sapiens poly(A) binding protein,
           cytoplasmic 1 protein.
          Length = 636

 Score = 44.8 bits (101), Expect = 3e-04
 Identities = 20/48 (41%), Positives = 31/48 (64%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           RL++ F  FG  +SV V+TD E+GK +GFGFV F+ ++   +   + N
Sbjct: 206 RLKDLFGKFGPALSVKVMTD-ESGKSKGFGFVSFERHEDAQKAVDEMN 252



 Score = 37.9 bits (84), Expect = 0.039
 Identities = 20/51 (39%), Positives = 28/51 (54%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           RLR+ FS FG I S  V+   E G+ +GFGFV F   +   +   + N +I
Sbjct: 309 RLRKEFSPFGTITSAKVM--MEGGRSKGFGFVCFSSPEEATKAVTEMNGRI 357



 Score = 30.3 bits (65), Expect = 7.9
 Identities = 25/86 (29%), Positives = 45/86 (52%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           +K +   +G  + V VM D   K SKGFGF+++ + H  ++AQ     +++G+ +  K+ 
Sbjct: 207 LKDLFGKFGPALSVKVMTDESGK-SKGFGFVSF-ERH--EDAQ-KAVDEMNGKELNGKQI 261

Query: 414 VPREEIKRPEASATVKKLFVAGLKQD 491
                 K+ E    +K+ F   +KQD
Sbjct: 262 YVGRAQKKVERQTELKRKF-EQMKQD 286


>BC015958-1|AAH15958.1|  636|Homo sapiens PABPC1 protein protein.
          Length = 636

 Score = 44.8 bits (101), Expect = 3e-04
 Identities = 20/48 (41%), Positives = 31/48 (64%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           RL++ F  FG  +SV V+TD E+GK +GFGFV F+ ++   +   + N
Sbjct: 206 RLKDLFGKFGPALSVKVMTD-ESGKSKGFGFVSFERHEDAQKAVDEMN 252



 Score = 37.9 bits (84), Expect = 0.039
 Identities = 20/51 (39%), Positives = 28/51 (54%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           RLR+ FS FG I S  V+   E G+ +GFGFV F   +   +   + N +I
Sbjct: 309 RLRKEFSPFGTITSAKVM--MEGGRSKGFGFVCFSSPEEATKAVTEMNGRI 357



 Score = 30.3 bits (65), Expect = 7.9
 Identities = 25/86 (29%), Positives = 45/86 (52%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           +K +   +G  + V VM D   K SKGFGF+++ + H  ++AQ     +++G+ +  K+ 
Sbjct: 207 LKDLFGKFGPALSVKVMTDESGK-SKGFGFVSF-ERH--EDAQ-KAVDEMNGKELNGKQI 261

Query: 414 VPREEIKRPEASATVKKLFVAGLKQD 491
                 K+ E    +K+ F   +KQD
Sbjct: 262 YVGRAQKKVERQTELKRKF-EQMKQD 286


>AL359757-1|CAH70805.1|  631|Homo sapiens poly(A) binding protein,
           cytoplasmic 3 protein.
          Length = 631

 Score = 44.8 bits (101), Expect = 3e-04
 Identities = 20/48 (41%), Positives = 31/48 (64%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           RL++ F  FG  +SV V+TD E+GK +GFGFV F+ ++   +   + N
Sbjct: 206 RLKDLFGKFGPALSVKVMTD-ESGKSKGFGFVSFERHEDAQKAVDEMN 252



 Score = 37.9 bits (84), Expect = 0.039
 Identities = 20/51 (39%), Positives = 28/51 (54%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           RLR+ FS FG I S  V+   E G+ +GFGFV F   +   +   + N +I
Sbjct: 309 RLRKAFSPFGTITSAKVM--MEGGRSKGFGFVCFSSPEEATKAVTEMNGRI 357



 Score = 30.7 bits (66), Expect = 6.0
 Identities = 25/86 (29%), Positives = 45/86 (52%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           +K +   +G  + V VM D   K SKGFGF+++ + H  ++AQ     +++G+ +  K+ 
Sbjct: 207 LKDLFGKFGPALSVKVMTDESGK-SKGFGFVSF-ERH--EDAQ-KAVDEMNGKELNGKQI 261

Query: 414 VPREEIKRPEASATVKKLFVAGLKQD 491
                 K+ E    +K+ F   +KQD
Sbjct: 262 YVGRAQKKVERQTELKRTF-EQMKQD 286


>AF132026-1|AAG38953.1|  631|Homo sapiens testis-specific
           poly(A)-binding protein protein.
          Length = 631

 Score = 44.8 bits (101), Expect = 3e-04
 Identities = 20/48 (41%), Positives = 31/48 (64%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           RL++ F  FG  +SV V+TD E+GK +GFGFV F+ ++   +   + N
Sbjct: 206 RLKDLFGKFGPALSVKVMTD-ESGKSKGFGFVSFERHEDAQKAVDEMN 252



 Score = 37.9 bits (84), Expect = 0.039
 Identities = 20/51 (39%), Positives = 28/51 (54%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           RLR+ FS FG I S  V+   E G+ +GFGFV F   +   +   + N +I
Sbjct: 309 RLRKAFSPFGTITSAKVM--MEGGRSKGFGFVCFSSPEEATKAVTEMNGRI 357



 Score = 30.7 bits (66), Expect = 6.0
 Identities = 25/86 (29%), Positives = 45/86 (52%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           +K +   +G  + V VM D   K SKGFGF+++ + H  ++AQ     +++G+ +  K+ 
Sbjct: 207 LKDLFGKFGPALSVKVMTDESGK-SKGFGFVSF-ERH--EDAQ-KAVDEMNGKELNGKQI 261

Query: 414 VPREEIKRPEASATVKKLFVAGLKQD 491
                 K+ E    +K+ F   +KQD
Sbjct: 262 YVGRAQKKVERQTELKRTF-EQMKQD 286


>D78134-1|BAA11212.1|  172|Homo sapiens CIRP protein.
          Length = 172

 Score = 44.4 bits (100), Expect = 5e-04
 Identities = 20/47 (42%), Positives = 27/47 (57%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           L + FS +G I  V VV D+ET + RGFGFV F++ D      +  N
Sbjct: 22  LEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMN 68



 Score = 43.6 bits (98), Expect = 8e-04
 Identities = 21/61 (34%), Positives = 38/61 (62%), Gaps = 1/61 (1%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHK-IDGRIVEPKR 410
           ++++   +G+I +VVV+KD +T+RS+GFGF+T+       +A      K +DGR +   +
Sbjct: 22  LEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVDQ 81

Query: 411 A 413
           A
Sbjct: 82  A 82


>BT007210-1|AAP35874.1|  172|Homo sapiens cold inducible RNA binding
           protein protein.
          Length = 172

 Score = 44.4 bits (100), Expect = 5e-04
 Identities = 20/47 (42%), Positives = 27/47 (57%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           L + FS +G I  V VV D+ET + RGFGFV F++ D      +  N
Sbjct: 22  LEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMN 68



 Score = 43.6 bits (98), Expect = 8e-04
 Identities = 21/61 (34%), Positives = 38/61 (62%), Gaps = 1/61 (1%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHK-IDGRIVEPKR 410
           ++++   +G+I +VVV+KD +T+RS+GFGF+T+       +A      K +DGR +   +
Sbjct: 22  LEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVDQ 81

Query: 411 A 413
           A
Sbjct: 82  A 82


>BC028239-1|AAH28239.1|  616|Homo sapiens cleavage stimulation
           factor, 3' pre-RNA, subunit 2, 64kDa, tau variant
           protein.
          Length = 616

 Score = 44.4 bits (100), Expect = 5e-04
 Identities = 17/38 (44%), Positives = 28/38 (73%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           +L++ FS  G++VS  +V D+ETGK +G+GF E+ D +
Sbjct: 31  QLKDIFSEVGSVVSFRLVYDRETGKPKGYGFCEYQDQE 68


>BC000901-1|AAH00901.1|  172|Homo sapiens cold inducible RNA binding
           protein protein.
          Length = 172

 Score = 44.4 bits (100), Expect = 5e-04
 Identities = 20/47 (42%), Positives = 27/47 (57%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           L + FS +G I  V VV D+ET + RGFGFV F++ D      +  N
Sbjct: 22  LEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMN 68



 Score = 43.6 bits (98), Expect = 8e-04
 Identities = 21/61 (34%), Positives = 38/61 (62%), Gaps = 1/61 (1%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHK-IDGRIVEPKR 410
           ++++   +G+I +VVV+KD +T+RS+GFGF+T+       +A      K +DGR +   +
Sbjct: 22  LEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVDQ 81

Query: 411 A 413
           A
Sbjct: 82  A 82


>BC000403-1|AAH00403.1|  172|Homo sapiens cold inducible RNA binding
           protein protein.
          Length = 172

 Score = 44.4 bits (100), Expect = 5e-04
 Identities = 20/47 (42%), Positives = 27/47 (57%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           L + FS +G I  V VV D+ET + RGFGFV F++ D      +  N
Sbjct: 22  LEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMN 68



 Score = 43.6 bits (98), Expect = 8e-04
 Identities = 21/61 (34%), Positives = 38/61 (62%), Gaps = 1/61 (1%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHK-IDGRIVEPKR 410
           ++++   +G+I +VVV+KD +T+RS+GFGF+T+       +A      K +DGR +   +
Sbjct: 22  LEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVDQ 81

Query: 411 A 413
           A
Sbjct: 82  A 82


>AY130299-1|AAN05429.1|  616|Homo sapiens tCstF-64 protein.
          Length = 616

 Score = 44.4 bits (100), Expect = 5e-04
 Identities = 17/38 (44%), Positives = 28/38 (73%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           +L++ FS  G++VS  +V D+ETGK +G+GF E+ D +
Sbjct: 31  QLKDIFSEVGSVVSFRLVYDRETGKPKGYGFCEYQDQE 68


>AK222574-1|BAD96294.1|  616|Homo sapiens cleavage stimulation
           factor, 3' pre-RNA, subunit 2, 64kDa, tau variant
           variant protein.
          Length = 616

 Score = 44.4 bits (100), Expect = 5e-04
 Identities = 17/38 (44%), Positives = 28/38 (73%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           +L++ FS  G++VS  +V D+ETGK +G+GF E+ D +
Sbjct: 31  QLKDIFSEVGSVVSFRLVYDRETGKPKGYGFCEYQDQE 68


>AF021336-1|AAC51787.1|  172|Homo sapiens DNA damage-inducible RNA
           binding protein protein.
          Length = 172

 Score = 44.4 bits (100), Expect = 5e-04
 Identities = 20/47 (42%), Positives = 27/47 (57%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           L + FS +G I  V VV D+ET + RGFGFV F++ D      +  N
Sbjct: 22  LEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMN 68



 Score = 43.6 bits (98), Expect = 8e-04
 Identities = 21/61 (34%), Positives = 38/61 (62%), Gaps = 1/61 (1%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHK-IDGRIVEPKR 410
           ++++   +G+I +VVV+KD +T+RS+GFGF+T+       +A      K +DGR +   +
Sbjct: 22  LEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVDQ 81

Query: 411 A 413
           A
Sbjct: 82  A 82


>AC004258-1|AAC04895.1|  172|Homo sapiens CIRP protein.
          Length = 172

 Score = 44.4 bits (100), Expect = 5e-04
 Identities = 20/47 (42%), Positives = 27/47 (57%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           L + FS +G I  V VV D+ET + RGFGFV F++ D      +  N
Sbjct: 22  LEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMN 68



 Score = 43.6 bits (98), Expect = 8e-04
 Identities = 21/61 (34%), Positives = 38/61 (62%), Gaps = 1/61 (1%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHK-IDGRIVEPKR 410
           ++++   +G+I +VVV+KD +T+RS+GFGF+T+       +A      K +DGR +   +
Sbjct: 22  LEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVDQ 81

Query: 411 A 413
           A
Sbjct: 82  A 82


>U53209-1|AAC50658.1|  282|Homo sapiens transformer-2 alpha protein.
          Length = 282

 Score = 44.0 bits (99), Expect = 6e-04
 Identities = 20/39 (51%), Positives = 26/39 (66%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           R LRE FS +G +  V+VV D+ TG+ RGF FV F+  D
Sbjct: 133 RDLREVFSRYGPLSGVNVVYDQRTGRSRGFAFVYFERID 171


>BC017094-1|AAH17094.1|  282|Homo sapiens transformer-2 alpha
           protein.
          Length = 282

 Score = 44.0 bits (99), Expect = 6e-04
 Identities = 20/39 (51%), Positives = 26/39 (66%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           R LRE FS +G +  V+VV D+ TG+ RGF FV F+  D
Sbjct: 133 RDLREVFSRYGPLSGVNVVYDQRTGRSRGFAFVYFERID 171


>AC023105-1|AAQ96870.1|  282|Homo sapiens unknown protein.
          Length = 282

 Score = 44.0 bits (99), Expect = 6e-04
 Identities = 20/39 (51%), Positives = 26/39 (66%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           R LRE FS +G +  V+VV D+ TG+ RGF FV F+  D
Sbjct: 133 RDLREVFSRYGPLSGVNVVYDQRTGRSRGFAFVYFERID 171


>AB097048-1|BAC77401.1|  282|Homo sapiens putative MAPK activating
           protein protein.
          Length = 282

 Score = 44.0 bits (99), Expect = 6e-04
 Identities = 20/39 (51%), Positives = 26/39 (66%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           R LRE FS +G +  V+VV D+ TG+ RGF FV F+  D
Sbjct: 133 RDLREVFSRYGPLSGVNVVYDQRTGRSRGFAFVYFERID 171


>X03910-1|CAA27544.1|  225|Homo sapiens protein ( Human mRNA for
           hnRNP C protein cross-reacting with C1 and C2 hnRNP
           core proteins.  ).
          Length = 225

 Score = 43.6 bits (98), Expect = 8e-04
 Identities = 16/39 (41%), Positives = 26/39 (66%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDP 619
           ++REYF  FG + S+ +  D +T K+RGF F+ F+  +P
Sbjct: 187 KIREYFGGFGEVESIELPMDNKTNKRRGFCFITFNQEEP 225


>U68063-1|AAB08701.1|  288|Homo sapiens transformer-2 beta protein.
          Length = 288

 Score = 43.6 bits (98), Expect = 8e-04
 Identities = 19/39 (48%), Positives = 27/39 (69%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           R LRE FS +G I  VS+V D+++ + RGF FV F++ D
Sbjct: 132 RDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVD 170



 Score = 34.3 bits (75), Expect = 0.48
 Identities = 15/54 (27%), Positives = 30/54 (55%), Gaps = 1/54 (1%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNN-RPHKIDGR 392
           ++ +   +G I DV ++ D +++RS+GF F+ +       EA+      ++DGR
Sbjct: 134 LREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVDDAKEAKERANGMELDGR 187


>U61267-1|AAC28242.1|  288|Homo sapiens htra2-beta protein.
          Length = 288

 Score = 43.6 bits (98), Expect = 8e-04
 Identities = 19/39 (48%), Positives = 27/39 (69%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           R LRE FS +G I  VS+V D+++ + RGF FV F++ D
Sbjct: 132 RDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVD 170



 Score = 34.3 bits (75), Expect = 0.48
 Identities = 15/54 (27%), Positives = 30/54 (55%), Gaps = 1/54 (1%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNN-RPHKIDGR 392
           ++ +   +G I DV ++ D +++RS+GF F+ +       EA+      ++DGR
Sbjct: 134 LREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVDDAKEAKERANGMELDGR 187


>DQ120650-1|ABB92435.1|  384|Homo sapiens RBM1 protein.
          Length = 384

 Score = 43.6 bits (98), Expect = 8e-04
 Identities = 19/54 (35%), Positives = 37/54 (68%), Gaps = 1/54 (1%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITY-SQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           +G IV+V+++KD +T +S+GF F+T+ S A   D A++     +DG+ ++ ++A
Sbjct: 31  YGRIVEVLLIKDRETNKSRGFAFVTFESPADAKDAARDMNGKSLDGKAIKVEQA 84



 Score = 39.1 bits (87), Expect = 0.017
 Identities = 16/36 (44%), Positives = 22/36 (61%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           + L   F  +G IV V ++ D+ET K RGF FV F+
Sbjct: 22  KALETVFGKYGRIVEVLLIKDRETNKSRGFAFVTFE 57


>BC012942-1|AAH12942.1|  390|Homo sapiens RNA binding motif protein,
           X-linked-like 1 protein.
          Length = 390

 Score = 43.6 bits (98), Expect = 8e-04
 Identities = 19/54 (35%), Positives = 37/54 (68%), Gaps = 1/54 (1%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITY-SQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           +G IV+V+++KD +T +S+GF F+T+ S A   D A++     +DG+ ++ ++A
Sbjct: 31  YGRIVEVLLIKDRETNKSRGFAFVTFESPADAKDAARDMNGKSLDGKAIKVEQA 84



 Score = 39.1 bits (87), Expect = 0.017
 Identities = 16/36 (44%), Positives = 22/36 (61%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           + L   F  +G IV V ++ D+ET K RGF FV F+
Sbjct: 22  KALETVFGKYGRIVEVLLIKDRETNKSRGFAFVTFE 57


>BC005898-1|AAH05898.1|  288|Homo sapiens splicing factor,
           arginine/serine-rich 10 (transformer 2 homolog,
           Drosophila) protein.
          Length = 288

 Score = 43.6 bits (98), Expect = 8e-04
 Identities = 19/39 (48%), Positives = 27/39 (69%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           R LRE FS +G I  VS+V D+++ + RGF FV F++ D
Sbjct: 132 RDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVD 170



 Score = 34.3 bits (75), Expect = 0.48
 Identities = 15/54 (27%), Positives = 30/54 (55%), Gaps = 1/54 (1%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNN-RPHKIDGR 392
           ++ +   +G I DV ++ D +++RS+GF F+ +       EA+      ++DGR
Sbjct: 134 LREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVDDAKEAKERANGMELDGR 187


>BC000451-1|AAH00451.1|  288|Homo sapiens splicing factor,
           arginine/serine-rich 10 (transformer 2 homolog,
           Drosophila) protein.
          Length = 288

 Score = 43.6 bits (98), Expect = 8e-04
 Identities = 19/39 (48%), Positives = 27/39 (69%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           R LRE FS +G I  VS+V D+++ + RGF FV F++ D
Sbjct: 132 RDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVD 170



 Score = 34.3 bits (75), Expect = 0.48
 Identities = 15/54 (27%), Positives = 30/54 (55%), Gaps = 1/54 (1%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNN-RPHKIDGR 392
           ++ +   +G I DV ++ D +++RS+GF F+ +       EA+      ++DGR
Sbjct: 134 LREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVDDAKEAKERANGMELDGR 187


>BC000160-1|AAH00160.1|  288|Homo sapiens splicing factor,
           arginine/serine-rich 10 (transformer 2 homolog,
           Drosophila) protein.
          Length = 288

 Score = 43.6 bits (98), Expect = 8e-04
 Identities = 19/39 (48%), Positives = 27/39 (69%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           R LRE FS +G I  VS+V D+++ + RGF FV F++ D
Sbjct: 132 RDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVD 170



 Score = 34.3 bits (75), Expect = 0.48
 Identities = 15/54 (27%), Positives = 30/54 (55%), Gaps = 1/54 (1%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNN-RPHKIDGR 392
           ++ +   +G I DV ++ D +++RS+GF F+ +       EA+      ++DGR
Sbjct: 134 LREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVDDAKEAKERANGMELDGR 187


>AL139416-3|CAI21694.1|  159|Homo sapiens RNA binding motif protein,
           X-linked-like 1 protein.
          Length = 159

 Score = 43.6 bits (98), Expect = 8e-04
 Identities = 19/54 (35%), Positives = 37/54 (68%), Gaps = 1/54 (1%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITY-SQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           +G IV+V+++KD +T +S+GF F+T+ S A   D A++     +DG+ ++ ++A
Sbjct: 31  YGRIVEVLLIKDRETNKSRGFAFVTFESPADAKDAARDMNGKSLDGKAIKVEQA 84



 Score = 39.1 bits (87), Expect = 0.017
 Identities = 16/36 (44%), Positives = 22/36 (61%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           + L   F  +G IV V ++ D+ET K RGF FV F+
Sbjct: 22  KALETVFGKYGRIVEVLLIKDRETNKSRGFAFVTFE 57


>AL139416-2|CAI21693.1|  390|Homo sapiens RNA binding motif protein,
           X-linked-like 1 protein.
          Length = 390

 Score = 43.6 bits (98), Expect = 8e-04
 Identities = 19/54 (35%), Positives = 37/54 (68%), Gaps = 1/54 (1%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITY-SQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           +G IV+V+++KD +T +S+GF F+T+ S A   D A++     +DG+ ++ ++A
Sbjct: 31  YGRIVEVLLIKDRETNKSRGFAFVTFESPADAKDAARDMNGKSLDGKAIKVEQA 84



 Score = 39.1 bits (87), Expect = 0.017
 Identities = 16/36 (44%), Positives = 22/36 (61%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           + L   F  +G IV V ++ D+ET K RGF FV F+
Sbjct: 22  KALETVFGKYGRIVEVLLIKDRETNKSRGFAFVTFE 57


>AK098191-1|BAC05256.1|  252|Homo sapiens protein ( Homo sapiens
           cDNA FLJ40872 fis, clone TUTER2000283, highly similar to
           Homo sapiens transformer-2-beta (SFRS10) gene. ).
          Length = 252

 Score = 43.6 bits (98), Expect = 8e-04
 Identities = 19/39 (48%), Positives = 27/39 (69%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           R LRE FS +G I  VS+V D+++ + RGF FV F++ D
Sbjct: 96  RDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVD 134



 Score = 34.3 bits (75), Expect = 0.48
 Identities = 15/54 (27%), Positives = 30/54 (55%), Gaps = 1/54 (1%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNN-RPHKIDGR 392
           ++ +   +G I DV ++ D +++RS+GF F+ +       EA+      ++DGR
Sbjct: 98  LREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVDDAKEAKERANGMELDGR 151


>AF057159-3|AAD19278.1|  188|Homo sapiens transformer-2-beta isoform
           3 protein.
          Length = 188

 Score = 43.6 bits (98), Expect = 8e-04
 Identities = 19/39 (48%), Positives = 27/39 (69%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           R LRE FS +G I  VS+V D+++ + RGF FV F++ D
Sbjct: 32  RDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVD 70



 Score = 34.3 bits (75), Expect = 0.48
 Identities = 15/54 (27%), Positives = 30/54 (55%), Gaps = 1/54 (1%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNN-RPHKIDGR 392
           ++ +   +G I DV ++ D +++RS+GF F+ +       EA+      ++DGR
Sbjct: 34  LREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVDDAKEAKERANGMELDGR 87


>AF057159-1|AAD19277.1|  288|Homo sapiens transformer-2-beta isoform
           1 protein.
          Length = 288

 Score = 43.6 bits (98), Expect = 8e-04
 Identities = 19/39 (48%), Positives = 27/39 (69%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           R LRE FS +G I  VS+V D+++ + RGF FV F++ D
Sbjct: 132 RDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVD 170



 Score = 34.3 bits (75), Expect = 0.48
 Identities = 15/54 (27%), Positives = 30/54 (55%), Gaps = 1/54 (1%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNN-RPHKIDGR 392
           ++ +   +G I DV ++ D +++RS+GF F+ +       EA+      ++DGR
Sbjct: 134 LREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVDDAKEAKERANGMELDGR 187


>AB209208-1|BAD92445.1|  278|Homo sapiens splicing factor,
           arginine/serine-rich 10 (transformer 2 homolog,
           Drosophila) va protein.
          Length = 278

 Score = 43.6 bits (98), Expect = 8e-04
 Identities = 19/39 (48%), Positives = 27/39 (69%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           R LRE FS +G I  VS+V D+++ + RGF FV F++ D
Sbjct: 120 RDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVD 158



 Score = 34.3 bits (75), Expect = 0.48
 Identities = 15/54 (27%), Positives = 30/54 (55%), Gaps = 1/54 (1%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNN-RPHKIDGR 392
           ++ +   +G I DV ++ D +++RS+GF F+ +       EA+      ++DGR
Sbjct: 122 LREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVDDAKEAKERANGMELDGR 175


>Z95327-4|CAI42681.1|  225|Homo sapiens cleavage stimulation factor,
           3' pre-RNA, subunit 2, 64kDa protein.
          Length = 225

 Score = 43.2 bits (97), Expect = 0.001
 Identities = 17/38 (44%), Positives = 27/38 (71%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           +L++ FS  G +VS  +V D+ETGK +G+GF E+ D +
Sbjct: 22  QLKDIFSEVGPVVSFRLVYDRETGKPKGYGFCEYQDQE 59


>Z95327-3|CAI42680.1|  577|Homo sapiens cleavage stimulation factor,
           3' pre-RNA, subunit 2, 64kDa protein.
          Length = 577

 Score = 43.2 bits (97), Expect = 0.001
 Identities = 17/38 (44%), Positives = 27/38 (71%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           +L++ FS  G +VS  +V D+ETGK +G+GF E+ D +
Sbjct: 31  QLKDIFSEVGPVVSFRLVYDRETGKPKGYGFCEYQDQE 68


>Z83819-6|CAB06072.2|  577|Homo sapiens cleavage stimulation factor,
           3' pre-RNA, subunit 2, 64kDa protein.
          Length = 577

 Score = 43.2 bits (97), Expect = 0.001
 Identities = 17/38 (44%), Positives = 27/38 (71%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           +L++ FS  G +VS  +V D+ETGK +G+GF E+ D +
Sbjct: 31  QLKDIFSEVGPVVSFRLVYDRETGKPKGYGFCEYQDQE 68


>M85085-1|AAA35724.1|  577|Homo sapiens cleavage stimulation factor
           protein.
          Length = 577

 Score = 43.2 bits (97), Expect = 0.001
 Identities = 17/38 (44%), Positives = 27/38 (71%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           +L++ FS  G +VS  +V D+ETGK +G+GF E+ D +
Sbjct: 31  QLKDIFSEVGPVVSFRLVYDRETGKPKGYGFCEYQDQE 68


>L10911-1|AAA16347.1|  530|Homo sapiens splicing factor protein.
          Length = 530

 Score = 43.2 bits (97), Expect = 0.001
 Identities = 18/47 (38%), Positives = 27/47 (57%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           LR  F  FG I S+ ++ D ETG+ +G+GF+ F D +   +   Q N
Sbjct: 266 LRGIFEPFGRIESIQLMMDSETGRSKGYGFITFSDSECAKKALEQLN 312



 Score = 40.3 bits (90), Expect = 0.007
 Identities = 19/53 (35%), Positives = 29/53 (54%)
 Frame = +2

Query: 464 VVCSWTEARH*RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPV 622
           V C    AR   R L E+FST G +  V +++D+ + + +G  +VEF D   V
Sbjct: 155 VFCMQLAARIRPRDLEEFFSTVGKVRDVRMISDRNSRRSKGIAYVEFVDVSSV 207



 Score = 36.3 bits (80), Expect = 0.12
 Identities = 16/42 (38%), Positives = 26/42 (61%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA 359
           ++ I   +G I  + +M D +T RSKG+GFIT+S +    +A
Sbjct: 266 LRGIFEPFGRIESIQLMMDSETGRSKGYGFITFSDSECAKKA 307


>L10910-1|AAA16346.1|  524|Homo sapiens splicing factor protein.
          Length = 524

 Score = 43.2 bits (97), Expect = 0.001
 Identities = 18/47 (38%), Positives = 27/47 (57%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           LR  F  FG I S+ ++ D ETG+ +G+GF+ F D +   +   Q N
Sbjct: 266 LRGIFEPFGRIESIQLMMDSETGRSKGYGFITFSDSECAKKALEQLN 312



 Score = 40.3 bits (90), Expect = 0.007
 Identities = 19/53 (35%), Positives = 29/53 (54%)
 Frame = +2

Query: 464 VVCSWTEARH*RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPV 622
           V C    AR   R L E+FST G +  V +++D+ + + +G  +VEF D   V
Sbjct: 155 VFCMQLAARIRPRDLEEFFSTVGKVRDVRMISDRNSRRSKGIAYVEFVDVSSV 207



 Score = 36.3 bits (80), Expect = 0.12
 Identities = 16/42 (38%), Positives = 26/42 (61%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA 359
           ++ I   +G I  + +M D +T RSKG+GFIT+S +    +A
Sbjct: 266 LRGIFEPFGRIESIQLMMDSETGRSKGYGFITFSDSECAKKA 307


>BX537770-1|CAD97833.1|  373|Homo sapiens hypothetical protein
           protein.
          Length = 373

 Score = 43.2 bits (97), Expect = 0.001
 Identities = 18/47 (38%), Positives = 27/47 (57%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           LR  F  FG I S+ ++ D ETG+ +G+GF+ F D +   +   Q N
Sbjct: 109 LRGIFEPFGRIESIQLMMDSETGRSKGYGFITFSDSECAKKALEQLN 155



 Score = 37.5 bits (83), Expect = 0.052
 Identities = 15/41 (36%), Positives = 25/41 (60%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPV 622
           R L E+FST G +  V +++D+ + + +G  +VEF D   V
Sbjct: 10  RDLEEFFSTVGKVRDVRMISDRNSRRSKGIAYVEFVDVSSV 50



 Score = 36.3 bits (80), Expect = 0.12
 Identities = 16/42 (38%), Positives = 26/42 (61%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA 359
           ++ I   +G I  + +M D +T RSKG+GFIT+S +    +A
Sbjct: 109 LRGIFEPFGRIESIQLMMDSETGRSKGYGFITFSDSECAKKA 150


>BT009778-1|AAP88780.1|  577|Homo sapiens cleavage stimulation
           factor, 3' pre-RNA, subunit 2, 64kDa protein.
          Length = 577

 Score = 43.2 bits (97), Expect = 0.001
 Identities = 17/38 (44%), Positives = 27/38 (71%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           +L++ FS  G +VS  +V D+ETGK +G+GF E+ D +
Sbjct: 31  QLKDIFSEVGPVVSFRLVYDRETGKPKGYGFCEYQDQE 68


>BC141835-1|AAI41836.1|  530|Homo sapiens RNA binding motif protein
           39 protein.
          Length = 530

 Score = 43.2 bits (97), Expect = 0.001
 Identities = 18/47 (38%), Positives = 27/47 (57%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           LR  F  FG I S+ ++ D ETG+ +G+GF+ F D +   +   Q N
Sbjct: 266 LRGIFEPFGRIESIQLMMDSETGRSKGYGFITFSDSECAKKALEQLN 312



 Score = 40.3 bits (90), Expect = 0.007
 Identities = 19/53 (35%), Positives = 29/53 (54%)
 Frame = +2

Query: 464 VVCSWTEARH*RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPV 622
           V C    AR   R L E+FST G +  V +++D+ + + +G  +VEF D   V
Sbjct: 155 VFCMQLAARIRPRDLEEFFSTVGKVRDVRMISDRNSRRSKGIAYVEFVDVSSV 207



 Score = 36.3 bits (80), Expect = 0.12
 Identities = 16/42 (38%), Positives = 26/42 (61%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA 359
           ++ I   +G I  + +M D +T RSKG+GFIT+S +    +A
Sbjct: 266 LRGIFEPFGRIESIQLMMDSETGRSKGYGFITFSDSECAKKA 307


>BC131543-1|AAI31544.1|  508|Homo sapiens RBM39 protein protein.
          Length = 508

 Score = 43.2 bits (97), Expect = 0.001
 Identities = 18/47 (38%), Positives = 27/47 (57%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           LR  F  FG I S+ ++ D ETG+ +G+GF+ F D +   +   Q N
Sbjct: 244 LRGIFEPFGRIESIQLMMDSETGRSKGYGFITFSDSECAKKALEQLN 290



 Score = 40.3 bits (90), Expect = 0.007
 Identities = 19/53 (35%), Positives = 29/53 (54%)
 Frame = +2

Query: 464 VVCSWTEARH*RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPV 622
           V C    AR   R L E+FST G +  V +++D+ + + +G  +VEF D   V
Sbjct: 133 VFCMQLAARIRPRDLEEFFSTVGKVRDVRMISDRNSRRSKGIAYVEFVDVSSV 185



 Score = 36.3 bits (80), Expect = 0.12
 Identities = 16/42 (38%), Positives = 26/42 (61%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA 359
           ++ I   +G I  + +M D +T RSKG+GFIT+S +    +A
Sbjct: 244 LRGIFEPFGRIESIQLMMDSETGRSKGYGFITFSDSECAKKA 285


>BC033135-1|AAH33135.1|  559|Homo sapiens Similar to cleavage
           stimulation factor, 3' pre-RNA, subunit 2, 64kD protein.
          Length = 559

 Score = 43.2 bits (97), Expect = 0.001
 Identities = 17/38 (44%), Positives = 27/38 (71%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           +L++ FS  G +VS  +V D+ETGK +G+GF E+ D +
Sbjct: 30  QLKDIFSEVGPVVSFRLVYDRETGKPKGYGFCEYQDQE 67


>BC017895-1|AAH17895.1|  109|Homo sapiens chromosome 14 open reading
           frame 156 protein.
          Length = 109

 Score = 43.2 bits (97), Expect = 0.001
 Identities = 22/60 (36%), Positives = 34/60 (56%)
 Frame = +2

Query: 476 WTEARH*RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           WT A     +L+E+F+ FG++    +  DKETG  RG G+V+F   + +     Q+NH I
Sbjct: 28  WTAASS---QLKEHFAQFGHVRRCILPFDKETGFHRGLGWVQFSSEEGLRNALQQENHII 84


>BC017712-1|AAH17712.1|  577|Homo sapiens cleavage stimulation
           factor, 3' pre-RNA, subunit 2, 64kDa protein.
          Length = 577

 Score = 43.2 bits (97), Expect = 0.001
 Identities = 17/38 (44%), Positives = 27/38 (71%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           +L++ FS  G +VS  +V D+ETGK +G+GF E+ D +
Sbjct: 31  QLKDIFSEVGPVVSFRLVYDRETGKPKGYGFCEYQDQE 68


>AY860853-1|AAX58600.1|  109|Homo sapiens SRA stem-loop-interacting
           RNA-binding protein protein.
          Length = 109

 Score = 43.2 bits (97), Expect = 0.001
 Identities = 22/60 (36%), Positives = 34/60 (56%)
 Frame = +2

Query: 476 WTEARH*RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           WT A     +L+E+F+ FG++    +  DKETG  RG G+V+F   + +     Q+NH I
Sbjct: 28  WTAASS---QLKEHFAQFGHVRRCILPFDKETGFHRGLGWVQFSSEEGLRNALQQENHII 84


>AL357374-9|CAC11119.1|  524|Homo sapiens RNA binding motif protein
           39 protein.
          Length = 524

 Score = 43.2 bits (97), Expect = 0.001
 Identities = 18/47 (38%), Positives = 27/47 (57%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           LR  F  FG I S+ ++ D ETG+ +G+GF+ F D +   +   Q N
Sbjct: 266 LRGIFEPFGRIESIQLMMDSETGRSKGYGFITFSDSECAKKALEQLN 312



 Score = 40.3 bits (90), Expect = 0.007
 Identities = 19/53 (35%), Positives = 29/53 (54%)
 Frame = +2

Query: 464 VVCSWTEARH*RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPV 622
           V C    AR   R L E+FST G +  V +++D+ + + +G  +VEF D   V
Sbjct: 155 VFCMQLAARIRPRDLEEFFSTVGKVRDVRMISDRNSRRSKGIAYVEFVDVSSV 207



 Score = 36.3 bits (80), Expect = 0.12
 Identities = 16/42 (38%), Positives = 26/42 (61%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA 359
           ++ I   +G I  + +M D +T RSKG+GFIT+S +    +A
Sbjct: 266 LRGIFEPFGRIESIQLMMDSETGRSKGYGFITFSDSECAKKA 307


>AL357374-8|CAC11118.1|  530|Homo sapiens RNA binding motif protein
           39 protein.
          Length = 530

 Score = 43.2 bits (97), Expect = 0.001
 Identities = 18/47 (38%), Positives = 27/47 (57%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           LR  F  FG I S+ ++ D ETG+ +G+GF+ F D +   +   Q N
Sbjct: 266 LRGIFEPFGRIESIQLMMDSETGRSKGYGFITFSDSECAKKALEQLN 312



 Score = 40.3 bits (90), Expect = 0.007
 Identities = 19/53 (35%), Positives = 29/53 (54%)
 Frame = +2

Query: 464 VVCSWTEARH*RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPV 622
           V C    AR   R L E+FST G +  V +++D+ + + +G  +VEF D   V
Sbjct: 155 VFCMQLAARIRPRDLEEFFSTVGKVRDVRMISDRNSRRSKGIAYVEFVDVSSV 207



 Score = 36.3 bits (80), Expect = 0.12
 Identities = 16/42 (38%), Positives = 26/42 (61%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA 359
           ++ I   +G I  + +M D +T RSKG+GFIT+S +    +A
Sbjct: 266 LRGIFEPFGRIESIQLMMDSETGRSKGYGFITFSDSECAKKA 307


>AJ272055-1|CAC81241.1|  109|Homo sapiens hypothetical protein
           protein.
          Length = 109

 Score = 43.2 bits (97), Expect = 0.001
 Identities = 22/60 (36%), Positives = 34/60 (56%)
 Frame = +2

Query: 476 WTEARH*RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           WT A     +L+E+F+ FG++    +  DKETG  RG G+V+F   + +     Q+NH I
Sbjct: 28  WTAASS---QLKEHFAQFGHVRRCILPFDKETGFHRGLGWVQFSSEEGLRNALQQENHII 84


>AF271779-1|AAG44790.1|  109|Homo sapiens DC50 protein.
          Length = 109

 Score = 43.2 bits (97), Expect = 0.001
 Identities = 22/60 (36%), Positives = 34/60 (56%)
 Frame = +2

Query: 476 WTEARH*RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           WT A     +L+E+F+ FG++    +  DKETG  RG G+V+F   + +     Q+NH I
Sbjct: 28  WTAASS---QLKEHFAQFGHVRRCILPFDKETGFHRGLGWVQFSSEEGLRNALQQENHII 84


>AF253980-1|AAG44629.1|  109|Homo sapiens DC23 protein.
          Length = 109

 Score = 43.2 bits (97), Expect = 0.001
 Identities = 22/60 (36%), Positives = 34/60 (56%)
 Frame = +2

Query: 476 WTEARH*RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           WT A     +L+E+F+ FG++    +  DKETG  RG G+V+F   + +     Q+NH I
Sbjct: 28  WTAASS---QLKEHFAQFGHVRRCILPFDKETGFHRGLGWVQFSSEEGLRNALQQENHII 84


>U28686-1|AAB17212.1|  157|Homo sapiens RNPL protein.
          Length = 157

 Score = 42.3 bits (95), Expect = 0.002
 Identities = 18/33 (54%), Positives = 24/33 (72%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           L ++FS+FG I  V VV D+ET + RGFGF+ F
Sbjct: 22  LEDHFSSFGPISEVVVVKDRETQRSRGFGFITF 54



 Score = 41.1 bits (92), Expect = 0.004
 Identities = 21/55 (38%), Positives = 32/55 (58%), Gaps = 1/55 (1%)
 Frame = +3

Query: 252 AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQN-NRPHKIDGRIVEPKRA 413
           ++G I +VVV+KD +T+RS+GFGFIT++       A        +DGR +    A
Sbjct: 28  SFGPISEVVVVKDRETQRSRGFGFITFTNPEHASVAMRAMNGESLDGRQIRVDHA 82


>BC006825-1|AAH06825.1|  157|Homo sapiens RNA binding motif (RNP1,
           RRM) protein 3 protein.
          Length = 157

 Score = 42.3 bits (95), Expect = 0.002
 Identities = 18/33 (54%), Positives = 24/33 (72%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           L ++FS+FG I  V VV D+ET + RGFGF+ F
Sbjct: 22  LEDHFSSFGPISEVVVVKDRETQRSRGFGFITF 54



 Score = 41.1 bits (92), Expect = 0.004
 Identities = 21/55 (38%), Positives = 32/55 (58%), Gaps = 1/55 (1%)
 Frame = +3

Query: 252 AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQN-NRPHKIDGRIVEPKRA 413
           ++G I +VVV+KD +T+RS+GFGFIT++       A        +DGR +    A
Sbjct: 28  SFGPISEVVVVKDRETQRSRGFGFITFTNPEHASVAMRAMNGESLDGRQIRVDHA 82


>AY675556-1|AAV91783.1|  474|Homo sapiens myocyte enhancer factor
           2D/deleted in azoospermia associated protein 1 fusion p
           protein.
          Length = 474

 Score = 41.9 bits (94), Expect = 0.002
 Identities = 20/38 (52%), Positives = 24/38 (63%)
 Frame = +3

Query: 312 GFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPRE 425
           GFGFIT+     VD+A N   H I G+ VE KRA PR+
Sbjct: 222 GFGFITFEDEQSVDQAVNMHFHDIMGKKVEVKRAEPRD 259


>AF087905-1|AAP97203.1|  425|Homo sapiens splicing factor SF2
           protein.
          Length = 425

 Score = 41.9 bits (94), Expect = 0.002
 Identities = 16/43 (37%), Positives = 26/43 (60%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVC 634
           LR  F  FG I ++ ++ D +TG+ +G+GF+ F D +   R C
Sbjct: 263 LRGIFEPFGKIDNIVLMKDSDTGRSKGYGFITFSDSECARRAC 305



 Score = 39.9 bits (89), Expect = 0.010
 Identities = 18/42 (42%), Positives = 28/42 (66%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA 359
           ++ I   +G+I ++V+MKD  T RSKG+GFIT+S +     A
Sbjct: 263 LRGIFEPFGKIDNIVLMKDSDTGRSKGYGFITFSDSECARRA 304



 Score = 36.3 bits (80), Expect = 0.12
 Identities = 16/53 (30%), Positives = 28/53 (52%)
 Frame = +2

Query: 464 VVCSWTEARH*RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPV 622
           V C    AR   R L ++FS  G +  V +++D+ + + +G  +VEF +   V
Sbjct: 152 VFCMQLAARIRPRDLEDFFSAVGKVRDVRIISDRNSRRSKGIAYVEFCEIQSV 204


>U75686-1|AAB97309.1|  644|Homo sapiens polyadenylate binding
           protein protein.
          Length = 644

 Score = 41.1 bits (92), Expect = 0.004
 Identities = 18/47 (38%), Positives = 29/47 (61%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           L+E FS FG  +SV V+ D   GK +GFGFV ++ ++  ++   + N
Sbjct: 207 LKELFSQFGKTLSVKVMRDPN-GKSKGFGFVSYEKHEDANKAVEEMN 252



 Score = 39.9 bits (89), Expect = 0.010
 Identities = 27/86 (31%), Positives = 45/86 (52%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           +K +   +G+ + V VM+DP  K SKGFGF++Y +     E  N    +++G+ +  K  
Sbjct: 207 LKELFSQFGKTLSVKVMRDPNGK-SKGFGFVSYEK----HEDANKAVEEMNGKEISGKII 261

Query: 414 VPREEIKRPEASATVKKLFVAGLKQD 491
                 K+ E  A +K+ F   LKQ+
Sbjct: 262 FVGRAQKKVERQAELKRKF-EQLKQE 286



 Score = 37.5 bits (83), Expect = 0.052
 Identities = 19/51 (37%), Positives = 29/51 (56%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           +LR+ FS FG+I S  V+   E G+ +GFGFV F   +   +   + N +I
Sbjct: 309 KLRKEFSPFGSITSAKVML--EDGRSKGFGFVCFSSPEEATKAVTEMNGRI 357


>U33818-1|AAC50350.1|  644|Homo sapiens inducible poly(A)-binding
           protein protein.
          Length = 644

 Score = 41.1 bits (92), Expect = 0.004
 Identities = 18/47 (38%), Positives = 29/47 (61%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           L+E FS FG  +SV V+ D   GK +GFGFV ++ ++  ++   + N
Sbjct: 207 LKELFSQFGKTLSVKVMRDPN-GKSKGFGFVSYEKHEDANKAVEEMN 252



 Score = 39.9 bits (89), Expect = 0.010
 Identities = 27/86 (31%), Positives = 45/86 (52%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           +K +   +G+ + V VM+DP  K SKGFGF++Y +     E  N    +++G+ +  K  
Sbjct: 207 LKELFSQFGKTLSVKVMRDPNGK-SKGFGFVSYEK----HEDANKAVEEMNGKEISGKII 261

Query: 414 VPREEIKRPEASATVKKLFVAGLKQD 491
                 K+ E  A +K+ F   LKQ+
Sbjct: 262 FVGRAQKKVERQAELKRKF-EQLKQE 286



 Score = 37.5 bits (83), Expect = 0.052
 Identities = 19/51 (37%), Positives = 29/51 (56%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           +LR+ FS FG+I S  V+   E G+ +GFGFV F   +   +   + N +I
Sbjct: 309 KLRKEFSPFGSITSAKVML--EDGRSKGFGFVCFSSPEEATKAVTEMNGRI 357


>D12799-1|BAA02244.1|  193|Homo sapiens polyadenylate binding
           protein II protein.
          Length = 193

 Score = 41.1 bits (92), Expect = 0.004
 Identities = 18/47 (38%), Positives = 29/47 (61%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           L+E FS FG  +SV V+ D   GK +GFGFV ++ ++  ++   + N
Sbjct: 18  LKELFSQFGKTLSVKVMRDPN-GKSKGFGFVSYEKHEDANKAVEEMN 63



 Score = 39.9 bits (89), Expect = 0.010
 Identities = 27/86 (31%), Positives = 45/86 (52%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           +K +   +G+ + V VM+DP  K SKGFGF++Y +     E  N    +++G+ +  K  
Sbjct: 18  LKELFSQFGKTLSVKVMRDPNGK-SKGFGFVSYEK----HEDANKAVEEMNGKEISGKII 72

Query: 414 VPREEIKRPEASATVKKLFVAGLKQD 491
                 K+ E  A +K+ F   LKQ+
Sbjct: 73  FVGRAQKKVERQAELKRKF-EQLKQE 97



 Score = 37.5 bits (83), Expect = 0.052
 Identities = 19/51 (37%), Positives = 29/51 (56%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           +LR+ FS FG+I S  V+   E G+ +GFGFV F   +   +   + N +I
Sbjct: 120 KLRKEFSPFGSITSAKVML--EDGRSKGFGFVCFSSPEEATKAVTEMNGRI 168


>DQ351905-1|ABC73063.1|  595|Homo sapiens heterogeneous nuclear
           ribonucleoprotein-R2 protein.
          Length = 595

 Score = 41.1 bits (92), Expect = 0.004
 Identities = 30/87 (34%), Positives = 43/87 (49%), Gaps = 4/87 (4%)
 Frame = +3

Query: 264 IVDVVVMKDPKTKR-SKGFGFITYSQAHMVDEAQNNRPH---KIDGRIVEPKRAVPREEI 431
           +VDV++   P  K+ ++GF F+ Y       +A+        K+ G +V  + A P EE 
Sbjct: 235 LVDVILYHQPDDKKKNRGFCFLEYEDHKSAAQARRRLMSGKVKVWGNVVTVEWADPVEE- 293

Query: 432 KRPEASATVKKLFVAGLKQDIEEEDLE 512
             PE  A VK LFV  L   + EE LE
Sbjct: 294 PDPEVMAKVKVLFVRNLATTVTEEILE 320


>BX640912-1|CAE45953.1|  613|Homo sapiens hypothetical protein
           protein.
          Length = 613

 Score = 41.1 bits (92), Expect = 0.004
 Identities = 30/87 (34%), Positives = 43/87 (49%), Gaps = 4/87 (4%)
 Frame = +3

Query: 264 IVDVVVMKDPKTKR-SKGFGFITYSQAHMVDEAQNNRPH---KIDGRIVEPKRAVPREEI 431
           +VDV++   P  K+ ++GF F+ Y       +A+        K+ G +V  + A P EE 
Sbjct: 253 LVDVILYHQPDDKKKNRGFCFLEYEDHKSAAQARRRLMSGKVKVWGNVVTVEWADPVEE- 311

Query: 432 KRPEASATVKKLFVAGLKQDIEEEDLE 512
             PE  A VK LFV  L   + EE LE
Sbjct: 312 PDPEVMAKVKVLFVRNLATTVTEEILE 338


>BC110389-1|AAI10390.1|  607|Homo sapiens HNRPR protein protein.
          Length = 607

 Score = 41.1 bits (92), Expect = 0.004
 Identities = 30/87 (34%), Positives = 43/87 (49%), Gaps = 4/87 (4%)
 Frame = +3

Query: 264 IVDVVVMKDPKTKR-SKGFGFITYSQAHMVDEAQNNRPH---KIDGRIVEPKRAVPREEI 431
           +VDV++   P  K+ ++GF F+ Y       +A+        K+ G +V  + A P EE 
Sbjct: 247 LVDVILYHQPDDKKKNRGFCFLEYEDHKSAAQARRRLMSGKVKVWGNVVTVEWADPVEE- 305

Query: 432 KRPEASATVKKLFVAGLKQDIEEEDLE 512
             PE  A VK LFV  L   + EE LE
Sbjct: 306 PDPEVMAKVKVLFVRNLATTVTEEILE 332


>BC094755-1|AAH94755.1|  660|Homo sapiens PABPC4 protein protein.
          Length = 660

 Score = 41.1 bits (92), Expect = 0.004
 Identities = 18/47 (38%), Positives = 29/47 (61%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           L+E FS FG  +SV V+ D   GK +GFGFV ++ ++  ++   + N
Sbjct: 207 LKELFSQFGKTLSVKVMRDPN-GKSKGFGFVSYEKHEDANKAVEEMN 252



 Score = 39.9 bits (89), Expect = 0.010
 Identities = 27/86 (31%), Positives = 45/86 (52%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           +K +   +G+ + V VM+DP  K SKGFGF++Y +     E  N    +++G+ +  K  
Sbjct: 207 LKELFSQFGKTLSVKVMRDPNGK-SKGFGFVSYEK----HEDANKAVEEMNGKEISGKII 261

Query: 414 VPREEIKRPEASATVKKLFVAGLKQD 491
                 K+ E  A +K+ F   LKQ+
Sbjct: 262 FVGRAQKKVERQAELKRKF-EQLKQE 286



 Score = 37.5 bits (83), Expect = 0.052
 Identities = 19/51 (37%), Positives = 29/51 (56%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           +LR+ FS FG+I S  V+   E G+ +GFGFV F   +   +   + N +I
Sbjct: 309 KLRKEFSPFGSITSAKVML--EDGRSKGFGFVCFSSPEEATKAVTEMNGRI 357


>BC071591-1|AAH71591.1|  660|Homo sapiens PABPC4 protein protein.
          Length = 660

 Score = 41.1 bits (92), Expect = 0.004
 Identities = 18/47 (38%), Positives = 29/47 (61%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           L+E FS FG  +SV V+ D   GK +GFGFV ++ ++  ++   + N
Sbjct: 207 LKELFSQFGKTLSVKVMRDPN-GKSKGFGFVSYEKHEDANKAVEEMN 252



 Score = 39.9 bits (89), Expect = 0.010
 Identities = 27/86 (31%), Positives = 45/86 (52%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           +K +   +G+ + V VM+DP  K SKGFGF++Y +     E  N    +++G+ +  K  
Sbjct: 207 LKELFSQFGKTLSVKVMRDPNGK-SKGFGFVSYEK----HEDANKAVEEMNGKEISGKII 261

Query: 414 VPREEIKRPEASATVKKLFVAGLKQD 491
                 K+ E  A +K+ F   LKQ+
Sbjct: 262 FVGRAQKKVERQAELKRKF-EQLKQE 286



 Score = 37.5 bits (83), Expect = 0.052
 Identities = 19/51 (37%), Positives = 29/51 (56%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           +LR+ FS FG+I S  V+   E G+ +GFGFV F   +   +   + N +I
Sbjct: 309 KLRKEFSPFGSITSAKVML--EDGRSKGFGFVCFSSPEEATKAVTEMNGRI 357


>BC065540-1|AAH65540.1|  631|Homo sapiens PABPC4 protein protein.
          Length = 631

 Score = 41.1 bits (92), Expect = 0.004
 Identities = 18/47 (38%), Positives = 29/47 (61%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           L+E FS FG  +SV V+ D   GK +GFGFV ++ ++  ++   + N
Sbjct: 207 LKELFSQFGKTLSVKVMRDPN-GKSKGFGFVSYEKHEDANKAVEEMN 252



 Score = 39.9 bits (89), Expect = 0.010
 Identities = 27/86 (31%), Positives = 45/86 (52%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           +K +   +G+ + V VM+DP  K SKGFGF++Y +     E  N    +++G+ +  K  
Sbjct: 207 LKELFSQFGKTLSVKVMRDPNGK-SKGFGFVSYEK----HEDANKAVEEMNGKEISGKII 261

Query: 414 VPREEIKRPEASATVKKLFVAGLKQD 491
                 K+ E  A +K+ F   LKQ+
Sbjct: 262 FVGRAQKKVERQAELKRKF-EQLKQE 286



 Score = 37.5 bits (83), Expect = 0.052
 Identities = 19/51 (37%), Positives = 29/51 (56%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           +LR+ FS FG+I S  V+   E G+ +GFGFV F   +   +   + N +I
Sbjct: 309 KLRKEFSPFGSITSAKVML--EDGRSKGFGFVCFSSPEEATKAVTEMNGRI 357


>BC057796-1|AAH57796.1|  392|Homo sapiens RNA binding motif protein,
           X-linked-like 2 protein.
          Length = 392

 Score = 41.1 bits (92), Expect = 0.004
 Identities = 19/54 (35%), Positives = 35/54 (64%), Gaps = 1/54 (1%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITY-SQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           +G IV+V++MKD +T +S+GF F+T+ S A     A++     +DG+ ++  +A
Sbjct: 31  YGRIVEVLLMKDRETNKSRGFAFVTFESPADAKAAARDMNGKSLDGKAIKVAQA 84



 Score = 37.9 bits (84), Expect = 0.039
 Identities = 16/36 (44%), Positives = 22/36 (61%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           + L   F  +G IV V ++ D+ET K RGF FV F+
Sbjct: 22  KALEAEFGKYGRIVEVLLMKDRETNKSRGFAFVTFE 57


>BC001449-1|AAH01449.1|  636|Homo sapiens HNRPR protein protein.
          Length = 636

 Score = 41.1 bits (92), Expect = 0.004
 Identities = 30/87 (34%), Positives = 43/87 (49%), Gaps = 4/87 (4%)
 Frame = +3

Query: 264 IVDVVVMKDPKTKR-SKGFGFITYSQAHMVDEAQNNRPH---KIDGRIVEPKRAVPREEI 431
           +VDV++   P  K+ ++GF F+ Y       +A+        K+ G +V  + A P EE 
Sbjct: 276 LVDVILYHQPDDKKKNRGFCFLEYEDHKSAAQARRRLMSGKVKVWGNVVTVEWADPVEE- 334

Query: 432 KRPEASATVKKLFVAGLKQDIEEEDLE 512
             PE  A VK LFV  L   + EE LE
Sbjct: 335 PDPEVMAKVKVLFVRNLATTVTEEILE 361


>AL845289-3|CAI12300.1|  644|Homo sapiens poly(A) binding protein,
           cytoplasmic 4 (inducibletaining 6 protein.
          Length = 644

 Score = 41.1 bits (92), Expect = 0.004
 Identities = 18/47 (38%), Positives = 29/47 (61%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           L+E FS FG  +SV V+ D   GK +GFGFV ++ ++  ++   + N
Sbjct: 207 LKELFSQFGKTLSVKVMRDPN-GKSKGFGFVSYEKHEDANKAVEEMN 252



 Score = 39.9 bits (89), Expect = 0.010
 Identities = 27/86 (31%), Positives = 45/86 (52%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           +K +   +G+ + V VM+DP  K SKGFGF++Y +     E  N    +++G+ +  K  
Sbjct: 207 LKELFSQFGKTLSVKVMRDPNGK-SKGFGFVSYEK----HEDANKAVEEMNGKEISGKII 261

Query: 414 VPREEIKRPEASATVKKLFVAGLKQD 491
                 K+ E  A +K+ F   LKQ+
Sbjct: 262 FVGRAQKKVERQAELKRKF-EQLKQE 286



 Score = 37.5 bits (83), Expect = 0.052
 Identities = 19/51 (37%), Positives = 29/51 (56%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           +LR+ FS FG+I S  V+   E G+ +GFGFV F   +   +   + N +I
Sbjct: 309 KLRKEFSPFGSITSAKVML--EDGRSKGFGFVCFSSPEEATKAVTEMNGRI 357


>AL845289-2|CAI12298.1|  660|Homo sapiens poly(A) binding protein,
           cytoplasmic 4 (inducibleseudogene protein.
          Length = 660

 Score = 41.1 bits (92), Expect = 0.004
 Identities = 18/47 (38%), Positives = 29/47 (61%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           L+E FS FG  +SV V+ D   GK +GFGFV ++ ++  ++   + N
Sbjct: 207 LKELFSQFGKTLSVKVMRDPN-GKSKGFGFVSYEKHEDANKAVEEMN 252



 Score = 39.9 bits (89), Expect = 0.010
 Identities = 27/86 (31%), Positives = 45/86 (52%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           +K +   +G+ + V VM+DP  K SKGFGF++Y +     E  N    +++G+ +  K  
Sbjct: 207 LKELFSQFGKTLSVKVMRDPNGK-SKGFGFVSYEK----HEDANKAVEEMNGKEISGKII 261

Query: 414 VPREEIKRPEASATVKKLFVAGLKQD 491
                 K+ E  A +K+ F   LKQ+
Sbjct: 262 FVGRAQKKVERQAELKRKF-EQLKQE 286



 Score = 37.5 bits (83), Expect = 0.052
 Identities = 19/51 (37%), Positives = 29/51 (56%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           +LR+ FS FG+I S  V+   E G+ +GFGFV F   +   +   + N +I
Sbjct: 309 KLRKEFSPFGSITSAKVML--EDGRSKGFGFVCFSSPEEATKAVTEMNGRI 357


>AL845289-1|CAI12299.1|  615|Homo sapiens poly(A) binding protein,
           cytoplasmic 4 (inducibleeudogene protein.
          Length = 615

 Score = 41.1 bits (92), Expect = 0.004
 Identities = 18/47 (38%), Positives = 29/47 (61%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           L+E FS FG  +SV V+ D   GK +GFGFV ++ ++  ++   + N
Sbjct: 207 LKELFSQFGKTLSVKVMRDPN-GKSKGFGFVSYEKHEDANKAVEEMN 252



 Score = 39.9 bits (89), Expect = 0.010
 Identities = 27/86 (31%), Positives = 45/86 (52%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           +K +   +G+ + V VM+DP  K SKGFGF++Y +     E  N    +++G+ +  K  
Sbjct: 207 LKELFSQFGKTLSVKVMRDPNGK-SKGFGFVSYEK----HEDANKAVEEMNGKEISGKII 261

Query: 414 VPREEIKRPEASATVKKLFVAGLKQD 491
                 K+ E  A +K+ F   LKQ+
Sbjct: 262 FVGRAQKKVERQAELKRKF-EQLKQE 286



 Score = 37.5 bits (83), Expect = 0.052
 Identities = 19/51 (37%), Positives = 29/51 (56%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           +LR+ FS FG+I S  V+   E G+ +GFGFV F   +   +   + N +I
Sbjct: 309 KLRKEFSPFGSITSAKVML--EDGRSKGFGFVCFSSPEEATKAVTEMNGRI 357


>AL365277-4|CAI16414.1|  644|Homo sapiens poly(A) binding protein,
           cytoplasmic 4 (induciblepeptide, antigen CD29 includes
           protein.
          Length = 644

 Score = 41.1 bits (92), Expect = 0.004
 Identities = 18/47 (38%), Positives = 29/47 (61%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           L+E FS FG  +SV V+ D   GK +GFGFV ++ ++  ++   + N
Sbjct: 207 LKELFSQFGKTLSVKVMRDPN-GKSKGFGFVSYEKHEDANKAVEEMN 252



 Score = 39.9 bits (89), Expect = 0.010
 Identities = 27/86 (31%), Positives = 45/86 (52%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           +K +   +G+ + V VM+DP  K SKGFGF++Y +     E  N    +++G+ +  K  
Sbjct: 207 LKELFSQFGKTLSVKVMRDPNGK-SKGFGFVSYEK----HEDANKAVEEMNGKEISGKII 261

Query: 414 VPREEIKRPEASATVKKLFVAGLKQD 491
                 K+ E  A +K+ F   LKQ+
Sbjct: 262 FVGRAQKKVERQAELKRKF-EQLKQE 286



 Score = 37.5 bits (83), Expect = 0.052
 Identities = 19/51 (37%), Positives = 29/51 (56%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           +LR+ FS FG+I S  V+   E G+ +GFGFV F   +   +   + N +I
Sbjct: 309 KLRKEFSPFGSITSAKVML--EDGRSKGFGFVCFSSPEEATKAVTEMNGRI 357


>AL365277-3|CAI16412.1|  660|Homo sapiens poly(A) binding protein,
           cytoplasmic 4 (inducible) pseudogene protein.
          Length = 660

 Score = 41.1 bits (92), Expect = 0.004
 Identities = 18/47 (38%), Positives = 29/47 (61%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           L+E FS FG  +SV V+ D   GK +GFGFV ++ ++  ++   + N
Sbjct: 207 LKELFSQFGKTLSVKVMRDPN-GKSKGFGFVSYEKHEDANKAVEEMN 252



 Score = 39.9 bits (89), Expect = 0.010
 Identities = 27/86 (31%), Positives = 45/86 (52%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           +K +   +G+ + V VM+DP  K SKGFGF++Y +     E  N    +++G+ +  K  
Sbjct: 207 LKELFSQFGKTLSVKVMRDPNGK-SKGFGFVSYEK----HEDANKAVEEMNGKEISGKII 261

Query: 414 VPREEIKRPEASATVKKLFVAGLKQD 491
                 K+ E  A +K+ F   LKQ+
Sbjct: 262 FVGRAQKKVERQAELKRKF-EQLKQE 286



 Score = 37.5 bits (83), Expect = 0.052
 Identities = 19/51 (37%), Positives = 29/51 (56%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           +LR+ FS FG+I S  V+   E G+ +GFGFV F   +   +   + N +I
Sbjct: 309 KLRKEFSPFGSITSAKVML--EDGRSKGFGFVCFSSPEEATKAVTEMNGRI 357


>AL365277-2|CAI16413.1|  615|Homo sapiens poly(A) binding protein,
           cytoplasmic 4 (induciblely, member 5 protein.
          Length = 615

 Score = 41.1 bits (92), Expect = 0.004
 Identities = 18/47 (38%), Positives = 29/47 (61%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           L+E FS FG  +SV V+ D   GK +GFGFV ++ ++  ++   + N
Sbjct: 207 LKELFSQFGKTLSVKVMRDPN-GKSKGFGFVSYEKHEDANKAVEEMN 252



 Score = 39.9 bits (89), Expect = 0.010
 Identities = 27/86 (31%), Positives = 45/86 (52%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           +K +   +G+ + V VM+DP  K SKGFGF++Y +     E  N    +++G+ +  K  
Sbjct: 207 LKELFSQFGKTLSVKVMRDPNGK-SKGFGFVSYEK----HEDANKAVEEMNGKEISGKII 261

Query: 414 VPREEIKRPEASATVKKLFVAGLKQD 491
                 K+ E  A +K+ F   LKQ+
Sbjct: 262 FVGRAQKKVERQAELKRKF-EQLKQE 286



 Score = 37.5 bits (83), Expect = 0.052
 Identities = 19/51 (37%), Positives = 29/51 (56%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           +LR+ FS FG+I S  V+   E G+ +GFGFV F   +   +   + N +I
Sbjct: 309 KLRKEFSPFGSITSAKVML--EDGRSKGFGFVCFSSPEEATKAVTEMNGRI 357


>AL109936-4|CAI19027.1|  636|Homo sapiens heterogeneous nuclear
           ribonucleoprotein R protein.
          Length = 636

 Score = 41.1 bits (92), Expect = 0.004
 Identities = 30/87 (34%), Positives = 43/87 (49%), Gaps = 4/87 (4%)
 Frame = +3

Query: 264 IVDVVVMKDPKTKR-SKGFGFITYSQAHMVDEAQNNRPH---KIDGRIVEPKRAVPREEI 431
           +VDV++   P  K+ ++GF F+ Y       +A+        K+ G +V  + A P EE 
Sbjct: 276 LVDVILYHQPDDKKKNRGFCFLEYEDHKSAAQARRRLMSGKVKVWGNVVTVEWADPVEE- 334

Query: 432 KRPEASATVKKLFVAGLKQDIEEEDLE 512
             PE  A VK LFV  L   + EE LE
Sbjct: 335 PDPEVMAKVKVLFVRNLATTVTEEILE 361


>AL109936-3|CAI19026.1|  633|Homo sapiens heterogeneous nuclear
           ribonucleoprotein R protein.
          Length = 633

 Score = 41.1 bits (92), Expect = 0.004
 Identities = 30/87 (34%), Positives = 43/87 (49%), Gaps = 4/87 (4%)
 Frame = +3

Query: 264 IVDVVVMKDPKTKR-SKGFGFITYSQAHMVDEAQNNRPH---KIDGRIVEPKRAVPREEI 431
           +VDV++   P  K+ ++GF F+ Y       +A+        K+ G +V  + A P EE 
Sbjct: 273 LVDVILYHQPDDKKKNRGFCFLEYEDHKSAAQARRRLMSGKVKVWGNVVTVEWADPVEE- 331

Query: 432 KRPEASATVKKLFVAGLKQDIEEEDLE 512
             PE  A VK LFV  L   + EE LE
Sbjct: 332 PDPEVMAKVKVLFVRNLATTVTEEILE 358


>AF069682-1|AAC24858.2|  392|Homo sapiens testes specific
           heterogenous nuclear ribonucleoprotein G-T protein.
          Length = 392

 Score = 41.1 bits (92), Expect = 0.004
 Identities = 19/54 (35%), Positives = 35/54 (64%), Gaps = 1/54 (1%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITY-SQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           +G IV+V++MKD +T +S+GF F+T+ S A     A++     +DG+ ++  +A
Sbjct: 31  YGRIVEVLLMKDRETNKSRGFAFVTFESPADAKAAARDMNGKSLDGKAIKVAQA 84



 Score = 37.9 bits (84), Expect = 0.039
 Identities = 16/36 (44%), Positives = 22/36 (61%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           + L   F  +G IV V ++ D+ET K RGF FV F+
Sbjct: 22  KALEAEFGKYGRIVEVLLMKDRETNKSRGFAFVTFE 57


>AF000364-1|AAC39540.1|  633|Homo sapiens heterogeneous nuclear
           ribonucleoprotein R protein.
          Length = 633

 Score = 41.1 bits (92), Expect = 0.004
 Identities = 30/87 (34%), Positives = 43/87 (49%), Gaps = 4/87 (4%)
 Frame = +3

Query: 264 IVDVVVMKDPKTKR-SKGFGFITYSQAHMVDEAQNNRPH---KIDGRIVEPKRAVPREEI 431
           +VDV++   P  K+ ++GF F+ Y       +A+        K+ G +V  + A P EE 
Sbjct: 273 LVDVILYHQPDDKKKNRGFCFLEYEDHKSAAQARRRLMSGKVKVWGNVVTVEWADPVEE- 331

Query: 432 KRPEASATVKKLFVAGLKQDIEEEDLE 512
             PE  A VK LFV  L   + EE LE
Sbjct: 332 PDPEVMAKVKVLFVRNLATTVTEEILE 358


>BC024208-1|AAH24208.1|  423|Homo sapiens RNA binding motif protein
           23 protein.
          Length = 423

 Score = 40.3 bits (90), Expect = 0.007
 Identities = 17/47 (36%), Positives = 27/47 (57%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           LR  F  FG I ++ ++ D +TG+ +G+GF+ F D +   R   Q N
Sbjct: 263 LRGIFEPFGKIDNIVLMKDSDTGRSKGYGFITFSDSECARRALEQLN 309



 Score = 39.9 bits (89), Expect = 0.010
 Identities = 18/42 (42%), Positives = 28/42 (66%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA 359
           ++ I   +G+I ++V+MKD  T RSKG+GFIT+S +     A
Sbjct: 263 LRGIFEPFGKIDNIVLMKDSDTGRSKGYGFITFSDSECARRA 304



 Score = 36.3 bits (80), Expect = 0.12
 Identities = 16/53 (30%), Positives = 28/53 (52%)
 Frame = +2

Query: 464 VVCSWTEARH*RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPV 622
           V C    AR   R L ++FS  G +  V +++D+ + + +G  +VEF +   V
Sbjct: 152 VFCMQLAARIRPRDLEDFFSAVGKVRDVRIISDRNSRRSKGIAYVEFCEIQSV 204


>BC002566-1|AAH02566.1|  424|Homo sapiens RNA binding motif protein
           23 protein.
          Length = 424

 Score = 40.3 bits (90), Expect = 0.007
 Identities = 17/47 (36%), Positives = 27/47 (57%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           LR  F  FG I ++ ++ D +TG+ +G+GF+ F D +   R   Q N
Sbjct: 263 LRGIFEPFGKIDNIVLMKDSDTGRSKGYGFITFSDSECARRALEQLN 309



 Score = 39.9 bits (89), Expect = 0.010
 Identities = 18/42 (42%), Positives = 28/42 (66%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA 359
           ++ I   +G+I ++V+MKD  T RSKG+GFIT+S +     A
Sbjct: 263 LRGIFEPFGKIDNIVLMKDSDTGRSKGYGFITFSDSECARRA 304



 Score = 36.3 bits (80), Expect = 0.12
 Identities = 16/53 (30%), Positives = 28/53 (52%)
 Frame = +2

Query: 464 VVCSWTEARH*RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPV 622
           V C    AR   R L ++FS  G +  V +++D+ + + +G  +VEF +   V
Sbjct: 152 VFCMQLAARIRPRDLEDFFSAVGKVRDVRIISDRNSRRSKGIAYVEFCEIQSV 204


>AL357374-11|CAI13608.1|  202|Homo sapiens RNA binding motif protein
           39 protein.
          Length = 202

 Score = 40.3 bits (90), Expect = 0.007
 Identities = 19/53 (35%), Positives = 29/53 (54%)
 Frame = +2

Query: 464 VVCSWTEARH*RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPV 622
           V C    AR   R L E+FST G +  V +++D+ + + +G  +VEF D   V
Sbjct: 133 VFCMQLAARIRPRDLEEFFSTVGKVRDVRMISDRNSRRSKGIAYVEFVDVSSV 185


>AL357374-10|CAI13606.1|  231|Homo sapiens RNA binding motif protein
           39 protein.
          Length = 231

 Score = 40.3 bits (90), Expect = 0.007
 Identities = 19/53 (35%), Positives = 29/53 (54%)
 Frame = +2

Query: 464 VVCSWTEARH*RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPV 622
           V C    AR   R L E+FST G +  V +++D+ + + +G  +VEF D   V
Sbjct: 154 VFCMQLAARIRPRDLEEFFSTVGKVRDVRMISDRNSRRSKGIAYVEFVDVSSV 206


>AL357374-7|CAI13605.1|  336|Homo sapiens RNA binding motif protein
           39 protein.
          Length = 336

 Score = 40.3 bits (90), Expect = 0.007
 Identities = 19/53 (35%), Positives = 29/53 (54%)
 Frame = +2

Query: 464 VVCSWTEARH*RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPV 622
           V C    AR   R L E+FST G +  V +++D+ + + +G  +VEF D   V
Sbjct: 27  VFCMQLAARIRPRDLEEFFSTVGKVRDVRMISDRNSRRSKGIAYVEFVDVSSV 79


>AK001344-1|BAA91638.1|  406|Homo sapiens protein ( Homo sapiens
           cDNA FLJ10482 fis, clone NT2RP2000153, weakly similar to
           GAR2 PROTEIN. ).
          Length = 406

 Score = 40.3 bits (90), Expect = 0.007
 Identities = 17/47 (36%), Positives = 27/47 (57%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           LR  F  FG I ++ ++ D +TG+ +G+GF+ F D +   R   Q N
Sbjct: 245 LRGIFEPFGKIDNIVLMKDSDTGRSKGYGFITFSDSECARRALEQLN 291



 Score = 39.9 bits (89), Expect = 0.010
 Identities = 18/42 (42%), Positives = 28/42 (66%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA 359
           ++ I   +G+I ++V+MKD  T RSKG+GFIT+S +     A
Sbjct: 245 LRGIFEPFGKIDNIVLMKDSDTGRSKGYGFITFSDSECARRA 286



 Score = 36.3 bits (80), Expect = 0.12
 Identities = 16/53 (30%), Positives = 28/53 (52%)
 Frame = +2

Query: 464 VVCSWTEARH*RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPV 622
           V C    AR   R L ++FS  G +  V +++D+ + + +G  +VEF +   V
Sbjct: 134 VFCMQLAARIRPRDLEDFFSAVGKVRDVRIISDRNSRRSKGIAYVEFCEIQSV 186


>AF275678-1|AAG24388.1|  418|Homo sapiens PP239 protein protein.
          Length = 418

 Score = 40.3 bits (90), Expect = 0.007
 Identities = 17/47 (36%), Positives = 27/47 (57%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           LR  F  FG I ++ ++ D +TG+ +G+GF+ F D +   R   Q N
Sbjct: 257 LRGIFEPFGKIDNIVLMKDSDTGRSKGYGFITFSDSECARRALEQLN 303



 Score = 39.9 bits (89), Expect = 0.010
 Identities = 18/42 (42%), Positives = 28/42 (66%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA 359
           ++ I   +G+I ++V+MKD  T RSKG+GFIT+S +     A
Sbjct: 257 LRGIFEPFGKIDNIVLMKDSDTGRSKGYGFITFSDSECARRA 298



 Score = 36.3 bits (80), Expect = 0.12
 Identities = 16/53 (30%), Positives = 28/53 (52%)
 Frame = +2

Query: 464 VVCSWTEARH*RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPV 622
           V C    AR   R L ++FS  G +  V +++D+ + + +G  +VEF +   V
Sbjct: 146 VFCMQLAARIRPRDLEDFFSAVGKVRDVRIISDRNSRRSKGIAYVEFCEIQSV 198


>U32519-1|AAB07787.1|  466|Homo sapiens GAP SH3 binding protein
           protein.
          Length = 466

 Score = 39.9 bits (89), Expect = 0.010
 Identities = 17/45 (37%), Positives = 28/45 (62%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRV 631
           +  L+++F ++GN+V + +      GK   FGFV FDD +PV +V
Sbjct: 353 KSELKDFFQSYGNVVELRI---NSGGKLPNFGFVVFDDSEPVQKV 394


>CR536535-1|CAG38772.1|  466|Homo sapiens G3BP protein.
          Length = 466

 Score = 39.9 bits (89), Expect = 0.010
 Identities = 17/45 (37%), Positives = 28/45 (62%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRV 631
           +  L+++F ++GN+V + +      GK   FGFV FDD +PV +V
Sbjct: 353 KSELKDFFQSYGNVVELRI---NSGGKLPNFGFVVFDDSEPVQKV 394


>BT019384-1|AAV38191.1|  466|Homo sapiens Ras-GTPase-activating
           protein SH3-domain-binding protein protein.
          Length = 466

 Score = 39.9 bits (89), Expect = 0.010
 Identities = 17/45 (37%), Positives = 28/45 (62%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRV 631
           +  L+++F ++GN+V + +      GK   FGFV FDD +PV +V
Sbjct: 353 KSELKDFFQSYGNVVELRI---NSGGKLPNFGFVVFDDSEPVQKV 394


>BC006997-1|AAH06997.1|  466|Homo sapiens GTPase activating protein
           (SH3 domain) binding protein 1 protein.
          Length = 466

 Score = 39.9 bits (89), Expect = 0.010
 Identities = 17/45 (37%), Positives = 28/45 (62%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRV 631
           +  L+++F ++GN+V + +      GK   FGFV FDD +PV +V
Sbjct: 353 KSELKDFFQSYGNVVELRI---NSGGKLPNFGFVVFDDSEPVQKV 394


>AK222606-1|BAD96326.1|  466|Homo sapiens Ras-GTPase-activating
           protein SH3-domain-binding protein variant protein.
          Length = 466

 Score = 39.9 bits (89), Expect = 0.010
 Identities = 17/45 (37%), Positives = 28/45 (62%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRV 631
           +  L+++F ++GN+V + +      GK   FGFV FDD +PV +V
Sbjct: 353 KSELKDFFQSYGNVVELRI---NSGGKLPNFGFVVFDDSEPVQKV 394


>AK130003-1|BAC85272.1|  307|Homo sapiens protein ( Homo sapiens
           cDNA FLJ26493 fis, clone KDN06317, highly similar to
           Ras-GTPase-activating protein binding protein 1. ).
          Length = 307

 Score = 39.9 bits (89), Expect = 0.010
 Identities = 17/45 (37%), Positives = 28/45 (62%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRV 631
           +  L+++F ++GN+V + +      GK   FGFV FDD +PV +V
Sbjct: 194 KSELKDFFQSYGNVVELRI---NSGGKLPNFGFVVFDDSEPVQKV 235


>BC105582-1|AAI05583.1|  173|Homo sapiens RBMX2 protein protein.
          Length = 173

 Score = 39.5 bits (88), Expect = 0.013
 Identities = 15/31 (48%), Positives = 25/31 (80%)
 Frame = +2

Query: 518 FSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           FS +G IV++++V DK+TGK +GF F+ ++D
Sbjct: 56  FSQYGEIVNINLVRDKKTGKSKGFCFLCYED 86



 Score = 36.7 bits (81), Expect = 0.091
 Identities = 19/49 (38%), Positives = 29/49 (59%), Gaps = 1/49 (2%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITY-SQAHMVDEAQNNRPHKIDGRIV 398
           +GEIV++ +++D KT +SKGF F+ Y  Q   +    N    KI GR +
Sbjct: 59  YGEIVNINLVRDKKTGKSKGFCFLCYEDQRSTILAVDNFNGIKIKGRTI 107


>BC033750-1|AAH33750.1|  322|Homo sapiens RNA binding motif protein,
           X-linked 2 protein.
          Length = 322

 Score = 39.5 bits (88), Expect = 0.013
 Identities = 15/31 (48%), Positives = 25/31 (80%)
 Frame = +2

Query: 518 FSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           FS +G IV++++V DK+TGK +GF F+ ++D
Sbjct: 56  FSQYGEIVNINLVRDKKTGKSKGFCFLCYED 86



 Score = 36.7 bits (81), Expect = 0.091
 Identities = 19/49 (38%), Positives = 29/49 (59%), Gaps = 1/49 (2%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITY-SQAHMVDEAQNNRPHKIDGRIV 398
           +GEIV++ +++D KT +SKGF F+ Y  Q   +    N    KI GR +
Sbjct: 59  YGEIVNINLVRDKKTGKSKGFCFLCYEDQRSTILAVDNFNGIKIKGRTI 107


>BC031682-1|AAH31682.1|  450|Homo sapiens RBM42 protein protein.
          Length = 450

 Score = 39.5 bits (88), Expect = 0.013
 Identities = 18/47 (38%), Positives = 24/47 (51%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           L   FS F + +   V+ DK TGK +G+GFV F D     R   + N
Sbjct: 367 LARAFSRFPSFLKAKVIRDKRTGKTKGYGFVSFKDPSDYVRAMREMN 413


>BC004204-1|AAH04204.1|  480|Homo sapiens hypothetical protein
           MGC10433 protein.
          Length = 480

 Score = 39.5 bits (88), Expect = 0.013
 Identities = 18/47 (38%), Positives = 24/47 (51%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           L   FS F + +   V+ DK TGK +G+GFV F D     R   + N
Sbjct: 397 LARAFSRFPSFLKAKVIRDKRTGKTKGYGFVSFKDPSDYVRAMREMN 443


>BC003676-1|AAH03676.1|  163|Homo sapiens Unknown (protein for
           IMAGE:3686686) protein.
          Length = 163

 Score = 39.5 bits (88), Expect = 0.013
 Identities = 15/31 (48%), Positives = 25/31 (80%)
 Frame = +2

Query: 518 FSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           FS +G IV++++V DK+TGK +GF F+ ++D
Sbjct: 56  FSQYGEIVNINLVRDKKTGKSKGFCFLCYED 86



 Score = 36.7 bits (81), Expect = 0.091
 Identities = 19/49 (38%), Positives = 29/49 (59%), Gaps = 1/49 (2%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITY-SQAHMVDEAQNNRPHKIDGRIV 398
           +GEIV++ +++D KT +SKGF F+ Y  Q   +    N    KI GR +
Sbjct: 59  YGEIVNINLVRDKKTGKSKGFCFLCYEDQRSTILAVDNFNGIKIKGRTI 107


>BC002868-1|AAH02868.1|  451|Homo sapiens MGC10433 protein protein.
          Length = 451

 Score = 39.5 bits (88), Expect = 0.013
 Identities = 18/47 (38%), Positives = 24/47 (51%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           L   FS F + +   V+ DK TGK +G+GFV F D     R   + N
Sbjct: 368 LARAFSRFPSFLKAKVIRDKRTGKTKGYGFVSFKDPSDYVRAMREMN 414


>AL050405-1|CAB43745.1|  322|Homo sapiens hypothetical protein
           protein.
          Length = 322

 Score = 39.5 bits (88), Expect = 0.013
 Identities = 15/31 (48%), Positives = 25/31 (80%)
 Frame = +2

Query: 518 FSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           FS +G IV++++V DK+TGK +GF F+ ++D
Sbjct: 56  FSQYGEIVNINLVRDKKTGKSKGFCFLCYED 86



 Score = 36.7 bits (81), Expect = 0.091
 Identities = 19/49 (38%), Positives = 29/49 (59%), Gaps = 1/49 (2%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITY-SQAHMVDEAQNNRPHKIDGRIV 398
           +GEIV++ +++D KT +SKGF F+ Y  Q   +    N    KI GR +
Sbjct: 59  YGEIVNINLVRDKKTGKSKGFCFLCYEDQRSTILAVDNFNGIKIKGRTI 107


>AL035423-8|CAI42444.1|  322|Homo sapiens RNA binding motif protein,
           X-linked 2 protein.
          Length = 322

 Score = 39.5 bits (88), Expect = 0.013
 Identities = 15/31 (48%), Positives = 25/31 (80%)
 Frame = +2

Query: 518 FSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           FS +G IV++++V DK+TGK +GF F+ ++D
Sbjct: 56  FSQYGEIVNINLVRDKKTGKSKGFCFLCYED 86



 Score = 36.7 bits (81), Expect = 0.091
 Identities = 19/49 (38%), Positives = 29/49 (59%), Gaps = 1/49 (2%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITY-SQAHMVDEAQNNRPHKIDGRIV 398
           +GEIV++ +++D KT +SKGF F+ Y  Q   +    N    KI GR +
Sbjct: 59  YGEIVNINLVRDKKTGKSKGFCFLCYEDQRSTILAVDNFNGIKIKGRTI 107


>AF279289-1|AAF82129.1|  386|Homo sapiens testes-specific
           heterogenous nuclear ribonucleoprotein G-T protein.
          Length = 386

 Score = 39.5 bits (88), Expect = 0.013
 Identities = 18/54 (33%), Positives = 34/54 (62%), Gaps = 1/54 (1%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITY-SQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           +G IV+V++MKD +T +S+GF F+T+ S A      ++     +DG+ ++  +A
Sbjct: 25  YGRIVEVLLMKDRETNKSRGFAFVTFESPADAKAAVRDMNGKSLDGKAIKVAQA 78



 Score = 37.9 bits (84), Expect = 0.039
 Identities = 16/36 (44%), Positives = 22/36 (61%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           + L   F  +G IV V ++ D+ET K RGF FV F+
Sbjct: 16  KALEAEFGKYGRIVEVLLMKDRETNKSRGFAFVTFE 51


>AF151837-1|AAD34074.1|  351|Homo sapiens CGI-79 protein protein.
          Length = 351

 Score = 39.5 bits (88), Expect = 0.013
 Identities = 15/31 (48%), Positives = 25/31 (80%)
 Frame = +2

Query: 518 FSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           FS +G IV++++V DK+TGK +GF F+ ++D
Sbjct: 56  FSQYGEIVNINLVRDKKTGKSKGFCFLCYED 86



 Score = 36.7 bits (81), Expect = 0.091
 Identities = 19/49 (38%), Positives = 29/49 (59%), Gaps = 1/49 (2%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITY-SQAHMVDEAQNNRPHKIDGRIV 398
           +GEIV++ +++D KT +SKGF F+ Y  Q   +    N    KI GR +
Sbjct: 59  YGEIVNINLVRDKKTGKSKGFCFLCYEDQRSTILAVDNFNGIKIKGRTI 107


>AC002115-1|AAB57629.1|  339|Homo sapiens F25451_2 protein.
          Length = 339

 Score = 39.5 bits (88), Expect = 0.013
 Identities = 18/47 (38%), Positives = 24/47 (51%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           L   FS F + +   V+ DK TGK +G+GFV F D     R   + N
Sbjct: 256 LARAFSRFPSFLKAKVIRDKRTGKTKGYGFVSFKDPSDYVRAMREMN 302


>BC047522-1|AAH47522.1|  402|Homo sapiens BRUNOL5 protein protein.
          Length = 402

 Score = 39.1 bits (87), Expect = 0.017
 Identities = 28/93 (30%), Positives = 42/93 (45%), Gaps = 1/93 (1%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNN-RPHKIDGRIVEPKR 410
           +K +L  +G I ++ V+KDP T   KG  F+TY       +AQ      K    +  P +
Sbjct: 61  LKPLLEQFGRIYELTVLKDPYTGMHKGCAFLTYCARDSAIKAQTALHEQKTLPGMARPIQ 120

Query: 411 AVPREEIKRPEASATVKKLFVAGLKQDIEEEDL 509
             P +   R       +KLFV  L +   EED+
Sbjct: 121 VKPADSESR---GGRDRKLFVGMLNKQQSEEDV 150


>M62843-1|AAA58396.1|  380|Homo sapiens brain protein protein.
          Length = 380

 Score = 38.7 bits (86), Expect = 0.023
 Identities = 14/37 (37%), Positives = 24/37 (64%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           ++ L + FS +G I++  ++ D+ TG  RG GF+ FD
Sbjct: 145 QKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFD 181



 Score = 36.3 bits (80), Expect = 0.12
 Identities = 16/37 (43%), Positives = 22/37 (59%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           L + F  FG + +V V+ D  T K +GFGFV   +YD
Sbjct: 313 LWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYD 349



 Score = 34.7 bits (76), Expect = 0.37
 Identities = 15/38 (39%), Positives = 21/38 (55%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           +   R  F + G I S  +V DK TG+  G+GFV + D
Sbjct: 59  QEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYID 96



 Score = 32.7 bits (71), Expect = 1.5
 Identities = 22/85 (25%), Positives = 43/85 (50%)
 Frame = +3

Query: 258 GEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIKR 437
           GEI    +++D  T +S G+GF+ Y      ++A N     ++G  ++ K  +     + 
Sbjct: 70  GEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAINT----LNGLRLQTK-TIKVSYARP 124

Query: 438 PEASATVKKLFVAGLKQDIEEEDLE 512
             AS     L+V+GL + + +++LE
Sbjct: 125 SSASIRDANLYVSGLPKTMTQKELE 149



 Score = 30.3 bits (65), Expect = 7.9
 Identities = 16/52 (30%), Positives = 31/52 (59%), Gaps = 3/52 (5%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFIT---YSQAHMVDEAQNNRPHKIDGRIVE 401
           +G + +V V++D  T + KGFGF+T   Y +A M   + N   +++  R+++
Sbjct: 320 FGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNG--YRLGDRVLQ 369


>AY033998-1|AAK57541.1|  380|Homo sapiens HUDPRO1 protein.
          Length = 380

 Score = 38.7 bits (86), Expect = 0.023
 Identities = 14/37 (37%), Positives = 24/37 (64%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           ++ L + FS +G I++  ++ D+ TG  RG GF+ FD
Sbjct: 145 QKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFD 181



 Score = 36.3 bits (80), Expect = 0.12
 Identities = 16/37 (43%), Positives = 22/37 (59%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           L + F  FG + +V V+ D  T K +GFGFV   +YD
Sbjct: 313 LWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYD 349



 Score = 34.7 bits (76), Expect = 0.37
 Identities = 15/38 (39%), Positives = 21/38 (55%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           +   R  F + G I S  +V DK TG+  G+GFV + D
Sbjct: 59  QEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYID 96



 Score = 32.7 bits (71), Expect = 1.5
 Identities = 22/85 (25%), Positives = 43/85 (50%)
 Frame = +3

Query: 258 GEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIKR 437
           GEI    +++D  T +S G+GF+ Y      ++A N     ++G  ++ K  +     + 
Sbjct: 70  GEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAINT----LNGLRLQTK-TIKVSYARP 124

Query: 438 PEASATVKKLFVAGLKQDIEEEDLE 512
             AS     L+V+GL + + +++LE
Sbjct: 125 SSASIRDANLYVSGLPKTMTQKELE 149



 Score = 30.3 bits (65), Expect = 7.9
 Identities = 16/52 (30%), Positives = 31/52 (59%), Gaps = 3/52 (5%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFIT---YSQAHMVDEAQNNRPHKIDGRIVE 401
           +G + +V V++D  T + KGFGF+T   Y +A M   + N   +++  R+++
Sbjct: 320 FGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNG--YRLGDRVLQ 369


>AY033997-1|AAK57540.1|  366|Homo sapiens HUD1 protein.
          Length = 366

 Score = 38.7 bits (86), Expect = 0.023
 Identities = 14/37 (37%), Positives = 24/37 (64%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           ++ L + FS +G I++  ++ D+ TG  RG GF+ FD
Sbjct: 145 QKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFD 181



 Score = 36.3 bits (80), Expect = 0.12
 Identities = 16/37 (43%), Positives = 22/37 (59%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           L + F  FG + +V V+ D  T K +GFGFV   +YD
Sbjct: 299 LWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYD 335



 Score = 34.7 bits (76), Expect = 0.37
 Identities = 15/38 (39%), Positives = 21/38 (55%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           +   R  F + G I S  +V DK TG+  G+GFV + D
Sbjct: 59  QEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYID 96



 Score = 32.7 bits (71), Expect = 1.5
 Identities = 22/85 (25%), Positives = 43/85 (50%)
 Frame = +3

Query: 258 GEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIKR 437
           GEI    +++D  T +S G+GF+ Y      ++A N     ++G  ++ K  +     + 
Sbjct: 70  GEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAINT----LNGLRLQTK-TIKVSYARP 124

Query: 438 PEASATVKKLFVAGLKQDIEEEDLE 512
             AS     L+V+GL + + +++LE
Sbjct: 125 SSASIRDANLYVSGLPKTMTQKELE 149



 Score = 30.3 bits (65), Expect = 7.9
 Identities = 16/52 (30%), Positives = 31/52 (59%), Gaps = 3/52 (5%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFIT---YSQAHMVDEAQNNRPHKIDGRIVE 401
           +G + +V V++D  T + KGFGF+T   Y +A M   + N   +++  R+++
Sbjct: 306 FGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNG--YRLGDRVLQ 355


>AY033996-1|AAK57539.1|  383|Homo sapiens HUD4 protein.
          Length = 383

 Score = 38.7 bits (86), Expect = 0.023
 Identities = 14/37 (37%), Positives = 24/37 (64%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           ++ L + FS +G I++  ++ D+ TG  RG GF+ FD
Sbjct: 162 QKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFD 198



 Score = 36.3 bits (80), Expect = 0.12
 Identities = 16/37 (43%), Positives = 22/37 (59%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           L + F  FG + +V V+ D  T K +GFGFV   +YD
Sbjct: 316 LWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYD 352



 Score = 34.7 bits (76), Expect = 0.37
 Identities = 15/38 (39%), Positives = 21/38 (55%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           +   R  F + G I S  +V DK TG+  G+GFV + D
Sbjct: 76  QEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYID 113



 Score = 32.7 bits (71), Expect = 1.5
 Identities = 22/85 (25%), Positives = 43/85 (50%)
 Frame = +3

Query: 258 GEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIKR 437
           GEI    +++D  T +S G+GF+ Y      ++A N     ++G  ++ K  +     + 
Sbjct: 87  GEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAINT----LNGLRLQTK-TIKVSYARP 141

Query: 438 PEASATVKKLFVAGLKQDIEEEDLE 512
             AS     L+V+GL + + +++LE
Sbjct: 142 SSASIRDANLYVSGLPKTMTQKELE 166



 Score = 30.3 bits (65), Expect = 7.9
 Identities = 16/52 (30%), Positives = 31/52 (59%), Gaps = 3/52 (5%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFIT---YSQAHMVDEAQNNRPHKIDGRIVE 401
           +G + +V V++D  T + KGFGF+T   Y +A M   + N   +++  R+++
Sbjct: 323 FGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNG--YRLGDRVLQ 372


>AY033995-1|AAK57538.1|  366|Homo sapiens HUD3 protein.
          Length = 366

 Score = 38.7 bits (86), Expect = 0.023
 Identities = 14/37 (37%), Positives = 24/37 (64%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           ++ L + FS +G I++  ++ D+ TG  RG GF+ FD
Sbjct: 145 QKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFD 181



 Score = 36.3 bits (80), Expect = 0.12
 Identities = 16/37 (43%), Positives = 22/37 (59%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           L + F  FG + +V V+ D  T K +GFGFV   +YD
Sbjct: 299 LWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYD 335



 Score = 34.7 bits (76), Expect = 0.37
 Identities = 15/38 (39%), Positives = 21/38 (55%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           +   R  F + G I S  +V DK TG+  G+GFV + D
Sbjct: 59  QEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYID 96



 Score = 32.7 bits (71), Expect = 1.5
 Identities = 22/85 (25%), Positives = 43/85 (50%)
 Frame = +3

Query: 258 GEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIKR 437
           GEI    +++D  T +S G+GF+ Y      ++A N     ++G  ++ K  +     + 
Sbjct: 70  GEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAINT----LNGLRLQTK-TIKVSYARP 124

Query: 438 PEASATVKKLFVAGLKQDIEEEDLE 512
             AS     L+V+GL + + +++LE
Sbjct: 125 SSASIRDANLYVSGLPKTMTQKELE 149



 Score = 30.3 bits (65), Expect = 7.9
 Identities = 16/52 (30%), Positives = 31/52 (59%), Gaps = 3/52 (5%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFIT---YSQAHMVDEAQNNRPHKIDGRIVE 401
           +G + +V V++D  T + KGFGF+T   Y +A M   + N   +++  R+++
Sbjct: 306 FGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNG--YRLGDRVLQ 355


>AL592182-6|CAI15792.1|  385|Homo sapiens ELAV (embryonic lethal,
           abnormal vision, Drosophila)-like 4 (Hu antigen D)
           protein.
          Length = 385

 Score = 38.7 bits (86), Expect = 0.023
 Identities = 14/37 (37%), Positives = 24/37 (64%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           ++ L + FS +G I++  ++ D+ TG  RG GF+ FD
Sbjct: 150 QKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFD 186



 Score = 36.3 bits (80), Expect = 0.12
 Identities = 16/37 (43%), Positives = 22/37 (59%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           L + F  FG + +V V+ D  T K +GFGFV   +YD
Sbjct: 318 LWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYD 354



 Score = 34.7 bits (76), Expect = 0.37
 Identities = 15/38 (39%), Positives = 21/38 (55%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           +   R  F + G I S  +V DK TG+  G+GFV + D
Sbjct: 64  QEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYID 101



 Score = 32.7 bits (71), Expect = 1.5
 Identities = 22/85 (25%), Positives = 43/85 (50%)
 Frame = +3

Query: 258 GEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIKR 437
           GEI    +++D  T +S G+GF+ Y      ++A N     ++G  ++ K  +     + 
Sbjct: 75  GEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAINT----LNGLRLQTK-TIKVSYARP 129

Query: 438 PEASATVKKLFVAGLKQDIEEEDLE 512
             AS     L+V+GL + + +++LE
Sbjct: 130 SSASIRDANLYVSGLPKTMTQKELE 154



 Score = 30.3 bits (65), Expect = 7.9
 Identities = 16/52 (30%), Positives = 31/52 (59%), Gaps = 3/52 (5%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFIT---YSQAHMVDEAQNNRPHKIDGRIVE 401
           +G + +V V++D  T + KGFGF+T   Y +A M   + N   +++  R+++
Sbjct: 325 FGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNG--YRLGDRVLQ 374


>AL592182-5|CAI15793.1|  371|Homo sapiens ELAV (embryonic lethal,
           abnormal vision, Drosophila)-like 4 (Hu antigen D)
           protein.
          Length = 371

 Score = 38.7 bits (86), Expect = 0.023
 Identities = 14/37 (37%), Positives = 24/37 (64%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           ++ L + FS +G I++  ++ D+ TG  RG GF+ FD
Sbjct: 150 QKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFD 186



 Score = 36.3 bits (80), Expect = 0.12
 Identities = 16/37 (43%), Positives = 22/37 (59%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           L + F  FG + +V V+ D  T K +GFGFV   +YD
Sbjct: 304 LWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYD 340



 Score = 34.7 bits (76), Expect = 0.37
 Identities = 15/38 (39%), Positives = 21/38 (55%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           +   R  F + G I S  +V DK TG+  G+GFV + D
Sbjct: 64  QEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYID 101



 Score = 32.7 bits (71), Expect = 1.5
 Identities = 22/85 (25%), Positives = 43/85 (50%)
 Frame = +3

Query: 258 GEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIKR 437
           GEI    +++D  T +S G+GF+ Y      ++A N     ++G  ++ K  +     + 
Sbjct: 75  GEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAINT----LNGLRLQTK-TIKVSYARP 129

Query: 438 PEASATVKKLFVAGLKQDIEEEDLE 512
             AS     L+V+GL + + +++LE
Sbjct: 130 SSASIRDANLYVSGLPKTMTQKELE 154



 Score = 30.3 bits (65), Expect = 7.9
 Identities = 16/52 (30%), Positives = 31/52 (59%), Gaps = 3/52 (5%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFIT---YSQAHMVDEAQNNRPHKIDGRIVE 401
           +G + +V V++D  T + KGFGF+T   Y +A M   + N   +++  R+++
Sbjct: 311 FGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNG--YRLGDRVLQ 360


>AL592182-4|CAI15791.1|  380|Homo sapiens ELAV (embryonic lethal,
           abnormal vision, Drosophila)-like 4 (Hu antigen D)
           protein.
          Length = 380

 Score = 38.7 bits (86), Expect = 0.023
 Identities = 14/37 (37%), Positives = 24/37 (64%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           ++ L + FS +G I++  ++ D+ TG  RG GF+ FD
Sbjct: 145 QKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFD 181



 Score = 36.3 bits (80), Expect = 0.12
 Identities = 16/37 (43%), Positives = 22/37 (59%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           L + F  FG + +V V+ D  T K +GFGFV   +YD
Sbjct: 313 LWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYD 349



 Score = 34.7 bits (76), Expect = 0.37
 Identities = 15/38 (39%), Positives = 21/38 (55%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           +   R  F + G I S  +V DK TG+  G+GFV + D
Sbjct: 59  QEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYID 96



 Score = 32.7 bits (71), Expect = 1.5
 Identities = 22/85 (25%), Positives = 43/85 (50%)
 Frame = +3

Query: 258 GEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIKR 437
           GEI    +++D  T +S G+GF+ Y      ++A N     ++G  ++ K  +     + 
Sbjct: 70  GEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAINT----LNGLRLQTK-TIKVSYARP 124

Query: 438 PEASATVKKLFVAGLKQDIEEEDLE 512
             AS     L+V+GL + + +++LE
Sbjct: 125 SSASIRDANLYVSGLPKTMTQKELE 149



 Score = 30.3 bits (65), Expect = 7.9
 Identities = 16/52 (30%), Positives = 31/52 (59%), Gaps = 3/52 (5%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFIT---YSQAHMVDEAQNNRPHKIDGRIVE 401
           +G + +V V++D  T + KGFGF+T   Y +A M   + N   +++  R+++
Sbjct: 320 FGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNG--YRLGDRVLQ 369


>AL592182-3|CAI15790.1|  366|Homo sapiens ELAV (embryonic lethal,
           abnormal vision, Drosophila)-like 4 (Hu antigen D)
           protein.
          Length = 366

 Score = 38.7 bits (86), Expect = 0.023
 Identities = 14/37 (37%), Positives = 24/37 (64%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           ++ L + FS +G I++  ++ D+ TG  RG GF+ FD
Sbjct: 145 QKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFD 181



 Score = 36.3 bits (80), Expect = 0.12
 Identities = 16/37 (43%), Positives = 22/37 (59%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           L + F  FG + +V V+ D  T K +GFGFV   +YD
Sbjct: 299 LWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYD 335



 Score = 34.7 bits (76), Expect = 0.37
 Identities = 15/38 (39%), Positives = 21/38 (55%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           +   R  F + G I S  +V DK TG+  G+GFV + D
Sbjct: 59  QEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYID 96



 Score = 32.7 bits (71), Expect = 1.5
 Identities = 22/85 (25%), Positives = 43/85 (50%)
 Frame = +3

Query: 258 GEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIKR 437
           GEI    +++D  T +S G+GF+ Y      ++A N     ++G  ++ K  +     + 
Sbjct: 70  GEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAINT----LNGLRLQTK-TIKVSYARP 124

Query: 438 PEASATVKKLFVAGLKQDIEEEDLE 512
             AS     L+V+GL + + +++LE
Sbjct: 125 SSASIRDANLYVSGLPKTMTQKELE 149



 Score = 30.3 bits (65), Expect = 7.9
 Identities = 16/52 (30%), Positives = 31/52 (59%), Gaps = 3/52 (5%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFIT---YSQAHMVDEAQNNRPHKIDGRIVE 401
           +G + +V V++D  T + KGFGF+T   Y +A M   + N   +++  R+++
Sbjct: 306 FGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNG--YRLGDRVLQ 355


>AL592182-2|CAI15789.1|  383|Homo sapiens ELAV (embryonic lethal,
           abnormal vision, Drosophila)-like 4 (Hu antigen D)
           protein.
          Length = 383

 Score = 38.7 bits (86), Expect = 0.023
 Identities = 14/37 (37%), Positives = 24/37 (64%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           ++ L + FS +G I++  ++ D+ TG  RG GF+ FD
Sbjct: 162 QKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFD 198



 Score = 36.3 bits (80), Expect = 0.12
 Identities = 16/37 (43%), Positives = 22/37 (59%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           L + F  FG + +V V+ D  T K +GFGFV   +YD
Sbjct: 316 LWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYD 352



 Score = 34.7 bits (76), Expect = 0.37
 Identities = 15/38 (39%), Positives = 21/38 (55%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           +   R  F + G I S  +V DK TG+  G+GFV + D
Sbjct: 76  QEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYID 113



 Score = 32.7 bits (71), Expect = 1.5
 Identities = 22/85 (25%), Positives = 43/85 (50%)
 Frame = +3

Query: 258 GEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIKR 437
           GEI    +++D  T +S G+GF+ Y      ++A N     ++G  ++ K  +     + 
Sbjct: 87  GEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAINT----LNGLRLQTK-TIKVSYARP 141

Query: 438 PEASATVKKLFVAGLKQDIEEEDLE 512
             AS     L+V+GL + + +++LE
Sbjct: 142 SSASIRDANLYVSGLPKTMTQKELE 166



 Score = 30.3 bits (65), Expect = 7.9
 Identities = 16/52 (30%), Positives = 31/52 (59%), Gaps = 3/52 (5%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFIT---YSQAHMVDEAQNNRPHKIDGRIVE 401
           +G + +V V++D  T + KGFGF+T   Y +A M   + N   +++  R+++
Sbjct: 323 FGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNG--YRLGDRVLQ 372


>AL592182-1|CAI15788.1|  366|Homo sapiens ELAV (embryonic lethal,
           abnormal vision, Drosophila)-like 4 (Hu antigen D)
           protein.
          Length = 366

 Score = 38.7 bits (86), Expect = 0.023
 Identities = 14/37 (37%), Positives = 24/37 (64%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           ++ L + FS +G I++  ++ D+ TG  RG GF+ FD
Sbjct: 145 QKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFD 181



 Score = 36.3 bits (80), Expect = 0.12
 Identities = 16/37 (43%), Positives = 22/37 (59%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           L + F  FG + +V V+ D  T K +GFGFV   +YD
Sbjct: 299 LWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYD 335



 Score = 34.7 bits (76), Expect = 0.37
 Identities = 15/38 (39%), Positives = 21/38 (55%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           +   R  F + G I S  +V DK TG+  G+GFV + D
Sbjct: 59  QEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYID 96



 Score = 32.7 bits (71), Expect = 1.5
 Identities = 22/85 (25%), Positives = 43/85 (50%)
 Frame = +3

Query: 258 GEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIKR 437
           GEI    +++D  T +S G+GF+ Y      ++A N     ++G  ++ K  +     + 
Sbjct: 70  GEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAINT----LNGLRLQTK-TIKVSYARP 124

Query: 438 PEASATVKKLFVAGLKQDIEEEDLE 512
             AS     L+V+GL + + +++LE
Sbjct: 125 SSASIRDANLYVSGLPKTMTQKELE 149



 Score = 30.3 bits (65), Expect = 7.9
 Identities = 16/52 (30%), Positives = 31/52 (59%), Gaps = 3/52 (5%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFIT---YSQAHMVDEAQNNRPHKIDGRIVE 401
           +G + +V V++D  T + KGFGF+T   Y +A M   + N   +++  R+++
Sbjct: 306 FGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNG--YRLGDRVLQ 355


>AL583843-6|CAI14638.1|  385|Homo sapiens ELAV (embryonic lethal,
           abnormal vision, Drosophila)-like 4 (Hu antigen D)
           protein.
          Length = 385

 Score = 38.7 bits (86), Expect = 0.023
 Identities = 14/37 (37%), Positives = 24/37 (64%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           ++ L + FS +G I++  ++ D+ TG  RG GF+ FD
Sbjct: 150 QKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFD 186



 Score = 36.3 bits (80), Expect = 0.12
 Identities = 16/37 (43%), Positives = 22/37 (59%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           L + F  FG + +V V+ D  T K +GFGFV   +YD
Sbjct: 318 LWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYD 354



 Score = 34.7 bits (76), Expect = 0.37
 Identities = 15/38 (39%), Positives = 21/38 (55%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           +   R  F + G I S  +V DK TG+  G+GFV + D
Sbjct: 64  QEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYID 101



 Score = 32.7 bits (71), Expect = 1.5
 Identities = 22/85 (25%), Positives = 43/85 (50%)
 Frame = +3

Query: 258 GEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIKR 437
           GEI    +++D  T +S G+GF+ Y      ++A N     ++G  ++ K  +     + 
Sbjct: 75  GEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAINT----LNGLRLQTK-TIKVSYARP 129

Query: 438 PEASATVKKLFVAGLKQDIEEEDLE 512
             AS     L+V+GL + + +++LE
Sbjct: 130 SSASIRDANLYVSGLPKTMTQKELE 154



 Score = 30.3 bits (65), Expect = 7.9
 Identities = 16/52 (30%), Positives = 31/52 (59%), Gaps = 3/52 (5%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFIT---YSQAHMVDEAQNNRPHKIDGRIVE 401
           +G + +V V++D  T + KGFGF+T   Y +A M   + N   +++  R+++
Sbjct: 325 FGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNG--YRLGDRVLQ 374


>AL583843-5|CAI14639.1|  371|Homo sapiens ELAV (embryonic lethal,
           abnormal vision, Drosophila)-like 4 (Hu antigen D)
           protein.
          Length = 371

 Score = 38.7 bits (86), Expect = 0.023
 Identities = 14/37 (37%), Positives = 24/37 (64%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           ++ L + FS +G I++  ++ D+ TG  RG GF+ FD
Sbjct: 150 QKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFD 186



 Score = 36.3 bits (80), Expect = 0.12
 Identities = 16/37 (43%), Positives = 22/37 (59%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           L + F  FG + +V V+ D  T K +GFGFV   +YD
Sbjct: 304 LWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYD 340



 Score = 34.7 bits (76), Expect = 0.37
 Identities = 15/38 (39%), Positives = 21/38 (55%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           +   R  F + G I S  +V DK TG+  G+GFV + D
Sbjct: 64  QEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYID 101



 Score = 32.7 bits (71), Expect = 1.5
 Identities = 22/85 (25%), Positives = 43/85 (50%)
 Frame = +3

Query: 258 GEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIKR 437
           GEI    +++D  T +S G+GF+ Y      ++A N     ++G  ++ K  +     + 
Sbjct: 75  GEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAINT----LNGLRLQTK-TIKVSYARP 129

Query: 438 PEASATVKKLFVAGLKQDIEEEDLE 512
             AS     L+V+GL + + +++LE
Sbjct: 130 SSASIRDANLYVSGLPKTMTQKELE 154



 Score = 30.3 bits (65), Expect = 7.9
 Identities = 16/52 (30%), Positives = 31/52 (59%), Gaps = 3/52 (5%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFIT---YSQAHMVDEAQNNRPHKIDGRIVE 401
           +G + +V V++D  T + KGFGF+T   Y +A M   + N   +++  R+++
Sbjct: 311 FGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNG--YRLGDRVLQ 360


>AL583843-4|CAI14637.1|  380|Homo sapiens ELAV (embryonic lethal,
           abnormal vision, Drosophila)-like 4 (Hu antigen D)
           protein.
          Length = 380

 Score = 38.7 bits (86), Expect = 0.023
 Identities = 14/37 (37%), Positives = 24/37 (64%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           ++ L + FS +G I++  ++ D+ TG  RG GF+ FD
Sbjct: 145 QKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFD 181



 Score = 36.3 bits (80), Expect = 0.12
 Identities = 16/37 (43%), Positives = 22/37 (59%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           L + F  FG + +V V+ D  T K +GFGFV   +YD
Sbjct: 313 LWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYD 349



 Score = 34.7 bits (76), Expect = 0.37
 Identities = 15/38 (39%), Positives = 21/38 (55%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           +   R  F + G I S  +V DK TG+  G+GFV + D
Sbjct: 59  QEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYID 96



 Score = 32.7 bits (71), Expect = 1.5
 Identities = 22/85 (25%), Positives = 43/85 (50%)
 Frame = +3

Query: 258 GEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIKR 437
           GEI    +++D  T +S G+GF+ Y      ++A N     ++G  ++ K  +     + 
Sbjct: 70  GEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAINT----LNGLRLQTK-TIKVSYARP 124

Query: 438 PEASATVKKLFVAGLKQDIEEEDLE 512
             AS     L+V+GL + + +++LE
Sbjct: 125 SSASIRDANLYVSGLPKTMTQKELE 149



 Score = 30.3 bits (65), Expect = 7.9
 Identities = 16/52 (30%), Positives = 31/52 (59%), Gaps = 3/52 (5%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFIT---YSQAHMVDEAQNNRPHKIDGRIVE 401
           +G + +V V++D  T + KGFGF+T   Y +A M   + N   +++  R+++
Sbjct: 320 FGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNG--YRLGDRVLQ 369


>AL583843-3|CAI14636.1|  366|Homo sapiens ELAV (embryonic lethal,
           abnormal vision, Drosophila)-like 4 (Hu antigen D)
           protein.
          Length = 366

 Score = 38.7 bits (86), Expect = 0.023
 Identities = 14/37 (37%), Positives = 24/37 (64%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           ++ L + FS +G I++  ++ D+ TG  RG GF+ FD
Sbjct: 145 QKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFD 181



 Score = 36.3 bits (80), Expect = 0.12
 Identities = 16/37 (43%), Positives = 22/37 (59%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           L + F  FG + +V V+ D  T K +GFGFV   +YD
Sbjct: 299 LWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYD 335



 Score = 34.7 bits (76), Expect = 0.37
 Identities = 15/38 (39%), Positives = 21/38 (55%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           +   R  F + G I S  +V DK TG+  G+GFV + D
Sbjct: 59  QEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYID 96



 Score = 32.7 bits (71), Expect = 1.5
 Identities = 22/85 (25%), Positives = 43/85 (50%)
 Frame = +3

Query: 258 GEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIKR 437
           GEI    +++D  T +S G+GF+ Y      ++A N     ++G  ++ K  +     + 
Sbjct: 70  GEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAINT----LNGLRLQTK-TIKVSYARP 124

Query: 438 PEASATVKKLFVAGLKQDIEEEDLE 512
             AS     L+V+GL + + +++LE
Sbjct: 125 SSASIRDANLYVSGLPKTMTQKELE 149



 Score = 30.3 bits (65), Expect = 7.9
 Identities = 16/52 (30%), Positives = 31/52 (59%), Gaps = 3/52 (5%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFIT---YSQAHMVDEAQNNRPHKIDGRIVE 401
           +G + +V V++D  T + KGFGF+T   Y +A M   + N   +++  R+++
Sbjct: 306 FGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNG--YRLGDRVLQ 355


>AL583843-2|CAI14635.1|  383|Homo sapiens ELAV (embryonic lethal,
           abnormal vision, Drosophila)-like 4 (Hu antigen D)
           protein.
          Length = 383

 Score = 38.7 bits (86), Expect = 0.023
 Identities = 14/37 (37%), Positives = 24/37 (64%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           ++ L + FS +G I++  ++ D+ TG  RG GF+ FD
Sbjct: 162 QKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFD 198



 Score = 36.3 bits (80), Expect = 0.12
 Identities = 16/37 (43%), Positives = 22/37 (59%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           L + F  FG + +V V+ D  T K +GFGFV   +YD
Sbjct: 316 LWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYD 352



 Score = 34.7 bits (76), Expect = 0.37
 Identities = 15/38 (39%), Positives = 21/38 (55%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           +   R  F + G I S  +V DK TG+  G+GFV + D
Sbjct: 76  QEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYID 113



 Score = 32.7 bits (71), Expect = 1.5
 Identities = 22/85 (25%), Positives = 43/85 (50%)
 Frame = +3

Query: 258 GEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIKR 437
           GEI    +++D  T +S G+GF+ Y      ++A N     ++G  ++ K  +     + 
Sbjct: 87  GEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAINT----LNGLRLQTK-TIKVSYARP 141

Query: 438 PEASATVKKLFVAGLKQDIEEEDLE 512
             AS     L+V+GL + + +++LE
Sbjct: 142 SSASIRDANLYVSGLPKTMTQKELE 166



 Score = 30.3 bits (65), Expect = 7.9
 Identities = 16/52 (30%), Positives = 31/52 (59%), Gaps = 3/52 (5%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFIT---YSQAHMVDEAQNNRPHKIDGRIVE 401
           +G + +V V++D  T + KGFGF+T   Y +A M   + N   +++  R+++
Sbjct: 323 FGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNG--YRLGDRVLQ 372


>AL583843-1|CAI14634.1|  366|Homo sapiens ELAV (embryonic lethal,
           abnormal vision, Drosophila)-like 4 (Hu antigen D)
           protein.
          Length = 366

 Score = 38.7 bits (86), Expect = 0.023
 Identities = 14/37 (37%), Positives = 24/37 (64%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           ++ L + FS +G I++  ++ D+ TG  RG GF+ FD
Sbjct: 145 QKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFD 181



 Score = 36.3 bits (80), Expect = 0.12
 Identities = 16/37 (43%), Positives = 22/37 (59%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           L + F  FG + +V V+ D  T K +GFGFV   +YD
Sbjct: 299 LWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYD 335



 Score = 34.7 bits (76), Expect = 0.37
 Identities = 15/38 (39%), Positives = 21/38 (55%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           +   R  F + G I S  +V DK TG+  G+GFV + D
Sbjct: 59  QEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYID 96



 Score = 32.7 bits (71), Expect = 1.5
 Identities = 22/85 (25%), Positives = 43/85 (50%)
 Frame = +3

Query: 258 GEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIKR 437
           GEI    +++D  T +S G+GF+ Y      ++A N     ++G  ++ K  +     + 
Sbjct: 70  GEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAINT----LNGLRLQTK-TIKVSYARP 124

Query: 438 PEASATVKKLFVAGLKQDIEEEDLE 512
             AS     L+V+GL + + +++LE
Sbjct: 125 SSASIRDANLYVSGLPKTMTQKELE 149



 Score = 30.3 bits (65), Expect = 7.9
 Identities = 16/52 (30%), Positives = 31/52 (59%), Gaps = 3/52 (5%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFIT---YSQAHMVDEAQNNRPHKIDGRIVE 401
           +G + +V V++D  T + KGFGF+T   Y +A M   + N   +++  R+++
Sbjct: 306 FGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNG--YRLGDRVLQ 355


>U63289-1|AAC50895.1|  482|Homo sapiens CUG-BP/hNab50 protein.
          Length = 482

 Score = 38.3 bits (85), Expect = 0.030
 Identities = 16/35 (45%), Positives = 22/35 (62%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           L + F  FGN+VS  V  DK+T   + FGFV +D+
Sbjct: 413 LLQMFMPFGNVVSAKVFIDKQTNLSKCFGFVSYDN 447


>U29943-1|AAA70417.1|  346|Homo sapiens Hel-N2 protein.
          Length = 346

 Score = 38.3 bits (85), Expect = 0.030
 Identities = 14/37 (37%), Positives = 24/37 (64%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           ++ L + FS +G I++  ++ D+ TG  RG GF+ FD
Sbjct: 138 QKELEQLFSQYGRIITSRILVDQVTGISRGVGFIRFD 174



 Score = 37.5 bits (83), Expect = 0.052
 Identities = 16/37 (43%), Positives = 22/37 (59%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           L + F  FG + +V V+ D  T K +GFGFV   +YD
Sbjct: 279 LWQMFGPFGAVTNVKVIRDFNTNKCKGFGFVTMTNYD 315



 Score = 35.9 bits (79), Expect = 0.16
 Identities = 21/73 (28%), Positives = 33/73 (45%)
 Frame = +2

Query: 392 NCRAKTSSSKGRD*KTRS*CHR*KVVCSWTEARH*RRRLREYFSTFGNIVSVSVVTDKET 571
           NC +   S    D KT        ++ ++      +  L+  F + G I S  +V DK T
Sbjct: 24  NCSSPVDSGNTEDSKTN-------LIVNYLPQNMTQEELKSLFGSIGEIESCKLVRDKIT 76

Query: 572 GKKRGFGFVEFDD 610
           G+  G+GFV + D
Sbjct: 77  GQSLGYGFVNYID 89



 Score = 33.5 bits (73), Expect = 0.85
 Identities = 23/93 (24%), Positives = 47/93 (50%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           +K +  + GEI    +++D  T +S G+GF+ Y      ++A N     ++G  ++ K  
Sbjct: 55  LKSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAINT----LNGLRLQTK-T 109

Query: 414 VPREEIKRPEASATVKKLFVAGLKQDIEEEDLE 512
           +     +   AS     L+V+GL + + +++LE
Sbjct: 110 IKVSYARPSSASIRDANLYVSGLPKTMTQKELE 142



 Score = 31.9 bits (69), Expect = 2.6
 Identities = 16/52 (30%), Positives = 31/52 (59%), Gaps = 3/52 (5%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFIT---YSQAHMVDEAQNNRPHKIDGRIVE 401
           +G + +V V++D  T + KGFGF+T   Y +A M   + N   +++  R+++
Sbjct: 286 FGAVTNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIRSLNG--YRLGDRVLQ 335


>U12431-1|AAA69698.1|  359|Homo sapiens ELAV-like neuronal protein 1
           protein.
          Length = 359

 Score = 38.3 bits (85), Expect = 0.030
 Identities = 14/37 (37%), Positives = 24/37 (64%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           ++ L + FS +G I++  ++ D+ TG  RG GF+ FD
Sbjct: 138 QKELEQLFSQYGRIITSRILVDQVTGISRGVGFIRFD 174



 Score = 37.5 bits (83), Expect = 0.052
 Identities = 16/37 (43%), Positives = 22/37 (59%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           L + F  FG + +V V+ D  T K +GFGFV   +YD
Sbjct: 292 LWQMFGPFGAVTNVKVIRDFNTNKCKGFGFVTMTNYD 328



 Score = 35.9 bits (79), Expect = 0.16
 Identities = 21/73 (28%), Positives = 33/73 (45%)
 Frame = +2

Query: 392 NCRAKTSSSKGRD*KTRS*CHR*KVVCSWTEARH*RRRLREYFSTFGNIVSVSVVTDKET 571
           NC +   S    D KT        ++ ++      +  L+  F + G I S  +V DK T
Sbjct: 24  NCSSPVDSGNTEDSKTN-------LIVNYLPQNMTQEELKSLFGSIGEIESCKLVRDKIT 76

Query: 572 GKKRGFGFVEFDD 610
           G+  G+GFV + D
Sbjct: 77  GQSLGYGFVNYID 89



 Score = 33.5 bits (73), Expect = 0.85
 Identities = 23/93 (24%), Positives = 47/93 (50%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           +K +  + GEI    +++D  T +S G+GF+ Y      ++A N     ++G  ++ K  
Sbjct: 55  LKSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAINT----LNGLRLQTK-T 109

Query: 414 VPREEIKRPEASATVKKLFVAGLKQDIEEEDLE 512
           +     +   AS     L+V+GL + + +++LE
Sbjct: 110 IKVSYARPSSASIRDANLYVSGLPKTMTQKELE 142



 Score = 31.9 bits (69), Expect = 2.6
 Identities = 16/52 (30%), Positives = 31/52 (59%), Gaps = 3/52 (5%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFIT---YSQAHMVDEAQNNRPHKIDGRIVE 401
           +G + +V V++D  T + KGFGF+T   Y +A M   + N   +++  R+++
Sbjct: 299 FGAVTNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIRSLNG--YRLGDRVLQ 348


>BC031079-1|AAH31079.1|  483|Homo sapiens CUG triplet repeat, RNA
           binding protein 1 protein.
          Length = 483

 Score = 38.3 bits (85), Expect = 0.030
 Identities = 16/35 (45%), Positives = 22/35 (62%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           L + F  FGN+VS  V  DK+T   + FGFV +D+
Sbjct: 414 LLQMFMPFGNVVSAKVFIDKQTNLSKCFGFVSYDN 448


>BC030692-1|AAH30692.1|  346|Homo sapiens ELAVL2 protein protein.
          Length = 346

 Score = 38.3 bits (85), Expect = 0.030
 Identities = 14/37 (37%), Positives = 24/37 (64%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           ++ L + FS +G I++  ++ D+ TG  RG GF+ FD
Sbjct: 138 QKELEQLFSQYGRIITSRILVDQVTGISRGVGFIRFD 174



 Score = 37.5 bits (83), Expect = 0.052
 Identities = 16/37 (43%), Positives = 22/37 (59%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           L + F  FG + +V V+ D  T K +GFGFV   +YD
Sbjct: 279 LWQMFGPFGAVTNVKVIRDFNTNKCKGFGFVTMTNYD 315



 Score = 35.9 bits (79), Expect = 0.16
 Identities = 21/73 (28%), Positives = 33/73 (45%)
 Frame = +2

Query: 392 NCRAKTSSSKGRD*KTRS*CHR*KVVCSWTEARH*RRRLREYFSTFGNIVSVSVVTDKET 571
           NC +   S    D KT        ++ ++      +  L+  F + G I S  +V DK T
Sbjct: 24  NCSSPVDSGNTEDSKTN-------LIVNYLPQNMTQEELKSLFGSIGEIESCKLVRDKIT 76

Query: 572 GKKRGFGFVEFDD 610
           G+  G+GFV + D
Sbjct: 77  GQSLGYGFVNYID 89



 Score = 33.5 bits (73), Expect = 0.85
 Identities = 23/93 (24%), Positives = 47/93 (50%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           +K +  + GEI    +++D  T +S G+GF+ Y      ++A N     ++G  ++ K  
Sbjct: 55  LKSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAINT----LNGLRLQTK-T 109

Query: 414 VPREEIKRPEASATVKKLFVAGLKQDIEEEDLE 512
           +     +   AS     L+V+GL + + +++LE
Sbjct: 110 IKVSYARPSSASIRDANLYVSGLPKTMTQKELE 142



 Score = 31.5 bits (68), Expect = 3.4
 Identities = 16/52 (30%), Positives = 31/52 (59%), Gaps = 3/52 (5%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFIT---YSQAHMVDEAQNNRPHKIDGRIVE 401
           +G + +V V++D  T + KGFGF+T   Y +A M   + N   +++  R+++
Sbjct: 286 FGAVTNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNG--YRLGDRVLQ 335


>AL161628-4|CAI13378.1|  387|Homo sapiens ELAV (embryonic lethal,
           abnormal vision, Drosophila)-like 2 (Hu antigen B)
           protein.
          Length = 387

 Score = 38.3 bits (85), Expect = 0.030
 Identities = 14/37 (37%), Positives = 24/37 (64%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           ++ L + FS +G I++  ++ D+ TG  RG GF+ FD
Sbjct: 166 QKELEQLFSQYGRIITSRILVDQVTGISRGVGFIRFD 202



 Score = 37.5 bits (83), Expect = 0.052
 Identities = 16/37 (43%), Positives = 22/37 (59%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           L + F  FG + +V V+ D  T K +GFGFV   +YD
Sbjct: 320 LWQMFGPFGAVTNVKVIRDFNTNKCKGFGFVTMTNYD 356



 Score = 35.9 bits (79), Expect = 0.16
 Identities = 21/73 (28%), Positives = 33/73 (45%)
 Frame = +2

Query: 392 NCRAKTSSSKGRD*KTRS*CHR*KVVCSWTEARH*RRRLREYFSTFGNIVSVSVVTDKET 571
           NC +   S    D KT        ++ ++      +  L+  F + G I S  +V DK T
Sbjct: 52  NCSSPVDSGNTEDSKTN-------LIVNYLPQNMTQEELKSLFGSIGEIESCKLVRDKIT 104

Query: 572 GKKRGFGFVEFDD 610
           G+  G+GFV + D
Sbjct: 105 GQSLGYGFVNYID 117



 Score = 33.5 bits (73), Expect = 0.85
 Identities = 23/93 (24%), Positives = 47/93 (50%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           +K +  + GEI    +++D  T +S G+GF+ Y      ++A N     ++G  ++ K  
Sbjct: 83  LKSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAINT----LNGLRLQTK-T 137

Query: 414 VPREEIKRPEASATVKKLFVAGLKQDIEEEDLE 512
           +     +   AS     L+V+GL + + +++LE
Sbjct: 138 IKVSYARPSSASIRDANLYVSGLPKTMTQKELE 170



 Score = 31.5 bits (68), Expect = 3.4
 Identities = 16/52 (30%), Positives = 31/52 (59%), Gaps = 3/52 (5%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFIT---YSQAHMVDEAQNNRPHKIDGRIVE 401
           +G + +V V++D  T + KGFGF+T   Y +A M   + N   +++  R+++
Sbjct: 327 FGAVTNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNG--YRLGDRVLQ 376


>AL161628-3|CAI13377.1|  189|Homo sapiens ELAV (embryonic lethal,
           abnormal vision, Drosophila)-like 2 (Hu antigen B)
           protein.
          Length = 189

 Score = 38.3 bits (85), Expect = 0.030
 Identities = 14/37 (37%), Positives = 24/37 (64%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           ++ L + FS +G I++  ++ D+ TG  RG GF+ FD
Sbjct: 138 QKELEQLFSQYGRIITSRILVDQVTGISRGVGFIRFD 174



 Score = 35.9 bits (79), Expect = 0.16
 Identities = 21/73 (28%), Positives = 33/73 (45%)
 Frame = +2

Query: 392 NCRAKTSSSKGRD*KTRS*CHR*KVVCSWTEARH*RRRLREYFSTFGNIVSVSVVTDKET 571
           NC +   S    D KT        ++ ++      +  L+  F + G I S  +V DK T
Sbjct: 24  NCSSPVDSGNTEDSKTN-------LIVNYLPQNMTQEELKSLFGSIGEIESCKLVRDKIT 76

Query: 572 GKKRGFGFVEFDD 610
           G+  G+GFV + D
Sbjct: 77  GQSLGYGFVNYID 89



 Score = 33.5 bits (73), Expect = 0.85
 Identities = 23/93 (24%), Positives = 47/93 (50%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           +K +  + GEI    +++D  T +S G+GF+ Y      ++A N     ++G  ++ K  
Sbjct: 55  LKSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAINT----LNGLRLQTK-T 109

Query: 414 VPREEIKRPEASATVKKLFVAGLKQDIEEEDLE 512
           +     +   AS     L+V+GL + + +++LE
Sbjct: 110 IKVSYARPSSASIRDANLYVSGLPKTMTQKELE 142


>AL161628-2|CAC22160.1|  359|Homo sapiens ELAV (embryonic lethal,
           abnormal vision, Drosophila)-like 2 (Hu antigen B)
           protein.
          Length = 359

 Score = 38.3 bits (85), Expect = 0.030
 Identities = 14/37 (37%), Positives = 24/37 (64%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           ++ L + FS +G I++  ++ D+ TG  RG GF+ FD
Sbjct: 138 QKELEQLFSQYGRIITSRILVDQVTGISRGVGFIRFD 174



 Score = 37.5 bits (83), Expect = 0.052
 Identities = 16/37 (43%), Positives = 22/37 (59%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           L + F  FG + +V V+ D  T K +GFGFV   +YD
Sbjct: 292 LWQMFGPFGAVTNVKVIRDFNTNKCKGFGFVTMTNYD 328



 Score = 35.9 bits (79), Expect = 0.16
 Identities = 21/73 (28%), Positives = 33/73 (45%)
 Frame = +2

Query: 392 NCRAKTSSSKGRD*KTRS*CHR*KVVCSWTEARH*RRRLREYFSTFGNIVSVSVVTDKET 571
           NC +   S    D KT        ++ ++      +  L+  F + G I S  +V DK T
Sbjct: 24  NCSSPVDSGNTEDSKTN-------LIVNYLPQNMTQEELKSLFGSIGEIESCKLVRDKIT 76

Query: 572 GKKRGFGFVEFDD 610
           G+  G+GFV + D
Sbjct: 77  GQSLGYGFVNYID 89



 Score = 33.5 bits (73), Expect = 0.85
 Identities = 23/93 (24%), Positives = 47/93 (50%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           +K +  + GEI    +++D  T +S G+GF+ Y      ++A N     ++G  ++ K  
Sbjct: 55  LKSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAINT----LNGLRLQTK-T 109

Query: 414 VPREEIKRPEASATVKKLFVAGLKQDIEEEDLE 512
           +     +   AS     L+V+GL + + +++LE
Sbjct: 110 IKVSYARPSSASIRDANLYVSGLPKTMTQKELE 142



 Score = 31.5 bits (68), Expect = 3.4
 Identities = 16/52 (30%), Positives = 31/52 (59%), Gaps = 3/52 (5%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFIT---YSQAHMVDEAQNNRPHKIDGRIVE 401
           +G + +V V++D  T + KGFGF+T   Y +A M   + N   +++  R+++
Sbjct: 299 FGAVTNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNG--YRLGDRVLQ 348


>AL161628-1|CAI13376.1|  346|Homo sapiens ELAV (embryonic lethal,
           abnormal vision, Drosophila)-like 2 (Hu antigen B)
           protein.
          Length = 346

 Score = 38.3 bits (85), Expect = 0.030
 Identities = 14/37 (37%), Positives = 24/37 (64%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           ++ L + FS +G I++  ++ D+ TG  RG GF+ FD
Sbjct: 138 QKELEQLFSQYGRIITSRILVDQVTGISRGVGFIRFD 174



 Score = 37.5 bits (83), Expect = 0.052
 Identities = 16/37 (43%), Positives = 22/37 (59%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           L + F  FG + +V V+ D  T K +GFGFV   +YD
Sbjct: 279 LWQMFGPFGAVTNVKVIRDFNTNKCKGFGFVTMTNYD 315



 Score = 35.9 bits (79), Expect = 0.16
 Identities = 21/73 (28%), Positives = 33/73 (45%)
 Frame = +2

Query: 392 NCRAKTSSSKGRD*KTRS*CHR*KVVCSWTEARH*RRRLREYFSTFGNIVSVSVVTDKET 571
           NC +   S    D KT        ++ ++      +  L+  F + G I S  +V DK T
Sbjct: 24  NCSSPVDSGNTEDSKTN-------LIVNYLPQNMTQEELKSLFGSIGEIESCKLVRDKIT 76

Query: 572 GKKRGFGFVEFDD 610
           G+  G+GFV + D
Sbjct: 77  GQSLGYGFVNYID 89



 Score = 33.5 bits (73), Expect = 0.85
 Identities = 23/93 (24%), Positives = 47/93 (50%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRA 413
           +K +  + GEI    +++D  T +S G+GF+ Y      ++A N     ++G  ++ K  
Sbjct: 55  LKSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAINT----LNGLRLQTK-T 109

Query: 414 VPREEIKRPEASATVKKLFVAGLKQDIEEEDLE 512
           +     +   AS     L+V+GL + + +++LE
Sbjct: 110 IKVSYARPSSASIRDANLYVSGLPKTMTQKELE 142



 Score = 31.5 bits (68), Expect = 3.4
 Identities = 16/52 (30%), Positives = 31/52 (59%), Gaps = 3/52 (5%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFIT---YSQAHMVDEAQNNRPHKIDGRIVE 401
           +G + +V V++D  T + KGFGF+T   Y +A M   + N   +++  R+++
Sbjct: 286 FGAVTNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNG--YRLGDRVLQ 335


>AL109839-2|CAI95632.1|  330|Homo sapiens chromosome 20 open reading
           frame 119 protein.
          Length = 330

 Score = 38.3 bits (85), Expect = 0.030
 Identities = 21/49 (42%), Positives = 28/49 (57%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           + L + FSTFGNI+S  V  D E G  RGFGFV F+ ++   +     N
Sbjct: 113 KALYDTFSTFGNILSCKVACD-EHG-SRGFGFVHFETHEAAQQAINTMN 159


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 99,584,225
Number of Sequences: 237096
Number of extensions: 1880434
Number of successful extensions: 5475
Number of sequences better than 10.0: 500
Number of HSP's better than 10.0 without gapping: 4137
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5425
length of database: 76,859,062
effective HSP length: 89
effective length of database: 55,757,518
effective search space used: 9199990470
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).