SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30008
         (465 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AK022027-1|BAB13955.1|  234|Homo sapiens protein ( Homo sapiens ...    64   3e-10
AK001440-1|BAA91692.1|  234|Homo sapiens protein ( Homo sapiens ...    64   3e-10
AF346603-1|AAK29084.1|  476|Homo sapiens Sec61 alpha form 2 prot...    64   3e-10
AL831940-1|CAD38592.1|  215|Homo sapiens hypothetical protein pr...    63   5e-10
AK075148-1|BAC11434.1|  170|Homo sapiens protein ( Homo sapiens ...    63   5e-10
AK074928-1|BAC11298.1|  356|Homo sapiens protein ( Homo sapiens ...    63   5e-10
AK074907-1|BAC11283.1|  170|Homo sapiens protein ( Homo sapiens ...    63   5e-10
AF346602-1|AAK29083.1|  476|Homo sapiens Sec61 alpha form 1 prot...    63   5e-10
AF084458-1|AAD39847.1|  476|Homo sapiens sec61 homolog protein.        63   5e-10
AK123191-1|BAC85553.1|  221|Homo sapiens protein ( Homo sapiens ...    29   6.0  
AL356104-4|CAH72941.1| 1037|Homo sapiens novel protein similar t...    29   7.9  
AL158169-5|CAH70011.1| 1037|Homo sapiens novel protein similar t...    29   7.9  
AK074121-1|BAB84947.1|  491|Homo sapiens FLJ00193 protein protein.     29   7.9  
AF063709-1|AAC16790.1|  108|Homo sapiens immunoglobulin lambda l...    29   7.9  

>AK022027-1|BAB13955.1|  234|Homo sapiens protein ( Homo sapiens
           cDNA FLJ11965 fis, clone HEMBB1001112, moderately
           similar to Homo sapiens sec61 homolog mRNA. ).
          Length = 234

 Score = 63.7 bits (148), Expect = 3e-10
 Identities = 30/38 (78%), Positives = 31/38 (81%)
 Frame = +1

Query: 73  GPSAPGTGILLAVTIIYQYFEIFVKEQAEMGGMSTLLF 186
           G    GTGILLAVTIIYQYFEIFVKEQAE+GGM  L F
Sbjct: 197 GAIGSGTGILLAVTIIYQYFEIFVKEQAEVGGMGALFF 234



 Score = 62.9 bits (146), Expect = 5e-10
 Identities = 29/29 (100%), Positives = 29/29 (100%)
 Frame = +3

Query: 3   YIPTAAAFGGLCIGALSVLADFLGAIGSG 89
           YIPTAAAFGGLCIGALSVLADFLGAIGSG
Sbjct: 174 YIPTAAAFGGLCIGALSVLADFLGAIGSG 202


>AK001440-1|BAA91692.1|  234|Homo sapiens protein ( Homo sapiens
           cDNA FLJ10578 fis, clone NT2RP2003433, highly similar to
           PROTEIN TRANSPORT PROTEIN SEC61 ALPHA SUBUNIT. ).
          Length = 234

 Score = 63.7 bits (148), Expect = 3e-10
 Identities = 30/38 (78%), Positives = 31/38 (81%)
 Frame = +1

Query: 73  GPSAPGTGILLAVTIIYQYFEIFVKEQAEMGGMSTLLF 186
           G    GTGILLAVTIIYQYFEIFVKEQAE+GGM  L F
Sbjct: 197 GAIGSGTGILLAVTIIYQYFEIFVKEQAEVGGMGALFF 234



 Score = 62.9 bits (146), Expect = 5e-10
 Identities = 29/29 (100%), Positives = 29/29 (100%)
 Frame = +3

Query: 3   YIPTAAAFGGLCIGALSVLADFLGAIGSG 89
           YIPTAAAFGGLCIGALSVLADFLGAIGSG
Sbjct: 174 YIPTAAAFGGLCIGALSVLADFLGAIGSG 202


>AF346603-1|AAK29084.1|  476|Homo sapiens Sec61 alpha form 2
           protein.
          Length = 476

 Score = 63.7 bits (148), Expect = 3e-10
 Identities = 30/38 (78%), Positives = 31/38 (81%)
 Frame = +1

Query: 73  GPSAPGTGILLAVTIIYQYFEIFVKEQAEMGGMSTLLF 186
           G    GTGILLAVTIIYQYFEIFVKEQAE+GGM  L F
Sbjct: 439 GAIGSGTGILLAVTIIYQYFEIFVKEQAEVGGMGALFF 476



 Score = 62.9 bits (146), Expect = 5e-10
 Identities = 29/29 (100%), Positives = 29/29 (100%)
 Frame = +3

Query: 3   YIPTAAAFGGLCIGALSVLADFLGAIGSG 89
           YIPTAAAFGGLCIGALSVLADFLGAIGSG
Sbjct: 416 YIPTAAAFGGLCIGALSVLADFLGAIGSG 444


>AL831940-1|CAD38592.1|  215|Homo sapiens hypothetical protein
           protein.
          Length = 215

 Score = 62.9 bits (146), Expect = 5e-10
 Identities = 29/29 (100%), Positives = 29/29 (100%)
 Frame = +3

Query: 3   YIPTAAAFGGLCIGALSVLADFLGAIGSG 89
           YIPTAAAFGGLCIGALSVLADFLGAIGSG
Sbjct: 155 YIPTAAAFGGLCIGALSVLADFLGAIGSG 183



 Score = 61.7 bits (143), Expect = 1e-09
 Identities = 29/38 (76%), Positives = 31/38 (81%)
 Frame = +1

Query: 73  GPSAPGTGILLAVTIIYQYFEIFVKEQAEMGGMSTLLF 186
           G    GTGILLAVTIIYQYFEIFVKEQ+E+G M  LLF
Sbjct: 178 GAIGSGTGILLAVTIIYQYFEIFVKEQSEVGSMGALLF 215


>AK075148-1|BAC11434.1|  170|Homo sapiens protein ( Homo sapiens
           cDNA FLJ90667 fis, clone PLACE1005410, highly similar to
           Protein transport protein Sec61 alpha subunitisoform 1.
           ).
          Length = 170

 Score = 62.9 bits (146), Expect = 5e-10
 Identities = 29/29 (100%), Positives = 29/29 (100%)
 Frame = +3

Query: 3   YIPTAAAFGGLCIGALSVLADFLGAIGSG 89
           YIPTAAAFGGLCIGALSVLADFLGAIGSG
Sbjct: 110 YIPTAAAFGGLCIGALSVLADFLGAIGSG 138



 Score = 61.7 bits (143), Expect = 1e-09
 Identities = 29/38 (76%), Positives = 31/38 (81%)
 Frame = +1

Query: 73  GPSAPGTGILLAVTIIYQYFEIFVKEQAEMGGMSTLLF 186
           G    GTGILLAVTIIYQYFEIFVKEQ+E+G M  LLF
Sbjct: 133 GAIGSGTGILLAVTIIYQYFEIFVKEQSEVGSMGALLF 170


>AK074928-1|BAC11298.1|  356|Homo sapiens protein ( Homo sapiens
           cDNA FLJ90447 fis, clone NT2RP3001240, highly similar to
           Canis familiaris sec61 homologue mRNA. ).
          Length = 356

 Score = 62.9 bits (146), Expect = 5e-10
 Identities = 29/29 (100%), Positives = 29/29 (100%)
 Frame = +3

Query: 3   YIPTAAAFGGLCIGALSVLADFLGAIGSG 89
           YIPTAAAFGGLCIGALSVLADFLGAIGSG
Sbjct: 296 YIPTAAAFGGLCIGALSVLADFLGAIGSG 324



 Score = 61.7 bits (143), Expect = 1e-09
 Identities = 29/38 (76%), Positives = 31/38 (81%)
 Frame = +1

Query: 73  GPSAPGTGILLAVTIIYQYFEIFVKEQAEMGGMSTLLF 186
           G    GTGILLAVTIIYQYFEIFVKEQ+E+G M  LLF
Sbjct: 319 GAIGSGTGILLAVTIIYQYFEIFVKEQSEVGSMGALLF 356


>AK074907-1|BAC11283.1|  170|Homo sapiens protein ( Homo sapiens
           cDNA FLJ90426 fis, clone NT2RP3000460, highly similar to
           Protein transport protein Sec61 alpha subunitisoform 1.
           ).
          Length = 170

 Score = 62.9 bits (146), Expect = 5e-10
 Identities = 29/29 (100%), Positives = 29/29 (100%)
 Frame = +3

Query: 3   YIPTAAAFGGLCIGALSVLADFLGAIGSG 89
           YIPTAAAFGGLCIGALSVLADFLGAIGSG
Sbjct: 110 YIPTAAAFGGLCIGALSVLADFLGAIGSG 138



 Score = 61.7 bits (143), Expect = 1e-09
 Identities = 29/38 (76%), Positives = 31/38 (81%)
 Frame = +1

Query: 73  GPSAPGTGILLAVTIIYQYFEIFVKEQAEMGGMSTLLF 186
           G    GTGILLAVTIIYQYFEIFVKEQ+E+G M  LLF
Sbjct: 133 GAIGSGTGILLAVTIIYQYFEIFVKEQSEVGSMGALLF 170


>AF346602-1|AAK29083.1|  476|Homo sapiens Sec61 alpha form 1
           protein.
          Length = 476

 Score = 62.9 bits (146), Expect = 5e-10
 Identities = 29/29 (100%), Positives = 29/29 (100%)
 Frame = +3

Query: 3   YIPTAAAFGGLCIGALSVLADFLGAIGSG 89
           YIPTAAAFGGLCIGALSVLADFLGAIGSG
Sbjct: 416 YIPTAAAFGGLCIGALSVLADFLGAIGSG 444



 Score = 61.7 bits (143), Expect = 1e-09
 Identities = 29/38 (76%), Positives = 31/38 (81%)
 Frame = +1

Query: 73  GPSAPGTGILLAVTIIYQYFEIFVKEQAEMGGMSTLLF 186
           G    GTGILLAVTIIYQYFEIFVKEQ+E+G M  LLF
Sbjct: 439 GAIGSGTGILLAVTIIYQYFEIFVKEQSEVGSMGALLF 476


>AF084458-1|AAD39847.1|  476|Homo sapiens sec61 homolog protein.
          Length = 476

 Score = 62.9 bits (146), Expect = 5e-10
 Identities = 29/29 (100%), Positives = 29/29 (100%)
 Frame = +3

Query: 3   YIPTAAAFGGLCIGALSVLADFLGAIGSG 89
           YIPTAAAFGGLCIGALSVLADFLGAIGSG
Sbjct: 416 YIPTAAAFGGLCIGALSVLADFLGAIGSG 444



 Score = 61.7 bits (143), Expect = 1e-09
 Identities = 29/38 (76%), Positives = 31/38 (81%)
 Frame = +1

Query: 73  GPSAPGTGILLAVTIIYQYFEIFVKEQAEMGGMSTLLF 186
           G    GTGILLAVTIIYQYFEIFVKEQ+E+G M  LLF
Sbjct: 439 GAIGSGTGILLAVTIIYQYFEIFVKEQSEVGSMGALLF 476


>AK123191-1|BAC85553.1|  221|Homo sapiens protein ( Homo sapiens
           cDNA FLJ41197 fis, clone BRACE2045947. ).
          Length = 221

 Score = 29.5 bits (63), Expect = 6.0
 Identities = 14/29 (48%), Positives = 16/29 (55%)
 Frame = -3

Query: 94  QCPEPMAPRKSASTDRAPMHSPPNAAAVG 8
           QCP P  PR+S ST   P  +PP  A  G
Sbjct: 127 QCPWPSEPRRS-STPSRPSSTPPRPAGQG 154


>AL356104-4|CAH72941.1| 1037|Homo sapiens novel protein similar to
           mouse Jedi soluble isoform 736 protein protein.
          Length = 1037

 Score = 29.1 bits (62), Expect = 7.9
 Identities = 16/42 (38%), Positives = 19/42 (45%)
 Frame = +3

Query: 3   YIPTAAAFGGLCIGALSVLADFLGAIGSGHWDTARRHHHLPV 128
           Y    A  G   +G+L V    L  IG  HW   + HHHL V
Sbjct: 752 YNSLGAVIGIAVLGSLVVALVAL-FIGYRHWQKGKEHHHLAV 792


>AL158169-5|CAH70011.1| 1037|Homo sapiens novel protein similar to
           mouse Jedi soluble isoform 736 protein protein.
          Length = 1037

 Score = 29.1 bits (62), Expect = 7.9
 Identities = 16/42 (38%), Positives = 19/42 (45%)
 Frame = +3

Query: 3   YIPTAAAFGGLCIGALSVLADFLGAIGSGHWDTARRHHHLPV 128
           Y    A  G   +G+L V    L  IG  HW   + HHHL V
Sbjct: 752 YNSLGAVIGIAVLGSLVVALVAL-FIGYRHWQKGKEHHHLAV 792


>AK074121-1|BAB84947.1|  491|Homo sapiens FLJ00193 protein protein.
          Length = 491

 Score = 29.1 bits (62), Expect = 7.9
 Identities = 16/42 (38%), Positives = 19/42 (45%)
 Frame = +3

Query: 3   YIPTAAAFGGLCIGALSVLADFLGAIGSGHWDTARRHHHLPV 128
           Y    A  G   +G+L V    L  IG  HW   + HHHL V
Sbjct: 206 YNSLGAVIGIAVLGSLVVALVAL-FIGYRHWQKGKEHHHLAV 246


>AF063709-1|AAC16790.1|  108|Homo sapiens immunoglobulin lambda
           light chain variable region protein.
          Length = 108

 Score = 29.1 bits (62), Expect = 7.9
 Identities = 14/32 (43%), Positives = 17/32 (53%)
 Frame = +1

Query: 16  RPRSEDCASGLCQCWPTSSGPSAPGTGILLAV 111
           R  + D A   CQ W TSS P   GTG  ++V
Sbjct: 76  RVEAGDEADYYCQVWDTSSDPDVFGTGTKVSV 107


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 68,588,657
Number of Sequences: 237096
Number of extensions: 1405244
Number of successful extensions: 4705
Number of sequences better than 10.0: 14
Number of HSP's better than 10.0 without gapping: 4371
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4705
length of database: 76,859,062
effective HSP length: 84
effective length of database: 56,942,998
effective search space used: 3986009860
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).