SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30005
         (981 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z49835-1|CAA89996.1|  505|Homo sapiens protein disulfide isomera...    37   0.13 
U75885-1|AAC51518.1|  505|Homo sapiens ER-60 protein protein.          37   0.13 
U42068-1|AAC50331.1|  505|Homo sapiens P58 protein.                    37   0.13 
D83485-1|BAA11928.1|  505|Homo sapiens ER-60 protease protein.         37   0.13 
BC071878-1|AAH71878.1|  505|Homo sapiens protein disulfide isome...    37   0.13 
BC036000-1|AAH36000.4|  505|Homo sapiens protein disulfide isome...    37   0.13 
BC014433-1|AAH14433.1|  505|Homo sapiens protein disulfide isome...    37   0.13 
D16234-1|BAA03759.1|  505|Homo sapiens phospholipase C-alpha pro...    36   0.17 
BC025275-1|AAH25275.1|  483|Homo sapiens ATPase, H+ transporting...    31   4.9  
AF298777-1|AAG22809.1|  483|Homo sapiens vacuolar ATPase subunit...    31   4.9  
AF132945-1|AAD27720.1|  483|Homo sapiens CGI-11 protein protein.       31   4.9  
AF125105-1|AAL75942.1|  476|Homo sapiens vacuolar proton pump su...    31   4.9  
AF112204-1|AAF17192.1|  483|Homo sapiens Vacuolar proton pump su...    31   4.9  

>Z49835-1|CAA89996.1|  505|Homo sapiens protein disulfide isomerase
           protein.
          Length = 505

 Score = 36.7 bits (81), Expect = 0.13
 Identities = 27/77 (35%), Positives = 38/77 (49%), Gaps = 1/77 (1%)
 Frame = +1

Query: 49  LNEFGIDFAKGDKPVVAGRDADG-KQIRHETRSSASKIY*RSQRTCSMGKLEPFVKFRGP 225
           L++FG++   G+ PVVA R A G K +  E  S   K   R  +    G L+ ++K   P
Sbjct: 311 LSDFGLESTAGEIPVVAIRTAKGEKFVMQEEFSRDGKALERFLQDYFDGNLKRYLKSE-P 369

Query: 226 *PGKRTGPVK*PFGKNF 276
            P    GPVK    +NF
Sbjct: 370 IPESNDGPVKVVVAENF 386


>U75885-1|AAC51518.1|  505|Homo sapiens ER-60 protein protein.
          Length = 505

 Score = 36.7 bits (81), Expect = 0.13
 Identities = 27/77 (35%), Positives = 38/77 (49%), Gaps = 1/77 (1%)
 Frame = +1

Query: 49  LNEFGIDFAKGDKPVVAGRDADG-KQIRHETRSSASKIY*RSQRTCSMGKLEPFVKFRGP 225
           L++FG++   G+ PVVA R A G K +  E  S   K   R  +    G L+ ++K   P
Sbjct: 311 LSDFGLESTAGEIPVVAIRTAKGEKFVMQEEFSRDGKALERFLQDYFDGNLKRYLKSE-P 369

Query: 226 *PGKRTGPVK*PFGKNF 276
            P    GPVK    +NF
Sbjct: 370 IPESNDGPVKVVVAENF 386


>U42068-1|AAC50331.1|  505|Homo sapiens P58 protein.
          Length = 505

 Score = 36.7 bits (81), Expect = 0.13
 Identities = 27/77 (35%), Positives = 38/77 (49%), Gaps = 1/77 (1%)
 Frame = +1

Query: 49  LNEFGIDFAKGDKPVVAGRDADG-KQIRHETRSSASKIY*RSQRTCSMGKLEPFVKFRGP 225
           L++FG++   G+ PVVA R A G K +  E  S   K   R  +    G L+ ++K   P
Sbjct: 311 LSDFGLESTAGEIPVVAIRTAKGEKFVMQEEFSRDGKALERFLQDYFDGNLKRYLKSE-P 369

Query: 226 *PGKRTGPVK*PFGKNF 276
            P    GPVK    +NF
Sbjct: 370 IPESNDGPVKVVVAENF 386


>D83485-1|BAA11928.1|  505|Homo sapiens ER-60 protease protein.
          Length = 505

 Score = 36.7 bits (81), Expect = 0.13
 Identities = 27/77 (35%), Positives = 38/77 (49%), Gaps = 1/77 (1%)
 Frame = +1

Query: 49  LNEFGIDFAKGDKPVVAGRDADG-KQIRHETRSSASKIY*RSQRTCSMGKLEPFVKFRGP 225
           L++FG++   G+ PVVA R A G K +  E  S   K   R  +    G L+ ++K   P
Sbjct: 311 LSDFGLESTAGEIPVVAIRTAKGEKFVMQEEFSRDGKALERFLQDYFDGNLKRYLKSE-P 369

Query: 226 *PGKRTGPVK*PFGKNF 276
            P    GPVK    +NF
Sbjct: 370 IPESNDGPVKVVVAENF 386


>BC071878-1|AAH71878.1|  505|Homo sapiens protein disulfide
           isomerase family A, member 3 protein.
          Length = 505

 Score = 36.7 bits (81), Expect = 0.13
 Identities = 27/77 (35%), Positives = 38/77 (49%), Gaps = 1/77 (1%)
 Frame = +1

Query: 49  LNEFGIDFAKGDKPVVAGRDADG-KQIRHETRSSASKIY*RSQRTCSMGKLEPFVKFRGP 225
           L++FG++   G+ PVVA R A G K +  E  S   K   R  +    G L+ ++K   P
Sbjct: 311 LSDFGLESTAGEIPVVAIRTAKGEKFVMQEEFSRDGKALERFLQDYFDGNLKRYLKSE-P 369

Query: 226 *PGKRTGPVK*PFGKNF 276
            P    GPVK    +NF
Sbjct: 370 IPESNDGPVKVVVAENF 386


>BC036000-1|AAH36000.4|  505|Homo sapiens protein disulfide
           isomerase family A, member 3 protein.
          Length = 505

 Score = 36.7 bits (81), Expect = 0.13
 Identities = 27/77 (35%), Positives = 38/77 (49%), Gaps = 1/77 (1%)
 Frame = +1

Query: 49  LNEFGIDFAKGDKPVVAGRDADG-KQIRHETRSSASKIY*RSQRTCSMGKLEPFVKFRGP 225
           L++FG++   G+ PVVA R A G K +  E  S   K   R  +    G L+ ++K   P
Sbjct: 311 LSDFGLESTAGEIPVVAIRTAKGEKFVMQEEFSRDGKALERFLQDYFDGNLKRYLKSE-P 369

Query: 226 *PGKRTGPVK*PFGKNF 276
            P    GPVK    +NF
Sbjct: 370 IPESNDGPVKVVVAENF 386


>BC014433-1|AAH14433.1|  505|Homo sapiens protein disulfide
           isomerase family A, member 3 protein.
          Length = 505

 Score = 36.7 bits (81), Expect = 0.13
 Identities = 27/77 (35%), Positives = 38/77 (49%), Gaps = 1/77 (1%)
 Frame = +1

Query: 49  LNEFGIDFAKGDKPVVAGRDADG-KQIRHETRSSASKIY*RSQRTCSMGKLEPFVKFRGP 225
           L++FG++   G+ PVVA R A G K +  E  S   K   R  +    G L+ ++K   P
Sbjct: 311 LSDFGLESTAGEIPVVAIRTAKGEKFVMQEEFSRDGKALERFLQDYFDGNLKRYLKSE-P 369

Query: 226 *PGKRTGPVK*PFGKNF 276
            P    GPVK    +NF
Sbjct: 370 IPESNDGPVKVVVAENF 386


>D16234-1|BAA03759.1|  505|Homo sapiens phospholipase C-alpha
           protein.
          Length = 505

 Score = 36.3 bits (80), Expect = 0.17
 Identities = 27/77 (35%), Positives = 38/77 (49%), Gaps = 1/77 (1%)
 Frame = +1

Query: 49  LNEFGIDFAKGDKPVVAGRDADG-KQIRHETRSSASKIY*RSQRTCSMGKLEPFVKFRGP 225
           L++FG++   G+ PVVA R A G K +  E  S   K   R  +    G L+ ++K   P
Sbjct: 311 LSDFGLESTAGEIPVVAIRTAKGEKFVMQEEFSRDGKALERFLQGYFGGNLKRYLK-SDP 369

Query: 226 *PGKRTGPVK*PFGKNF 276
            P    GPVK    +NF
Sbjct: 370 IPESNDGPVKVVVAENF 386


>BC025275-1|AAH25275.1|  483|Homo sapiens ATPase, H+ transporting,
           lysosomal 50/57kDa, V1 subunit H protein.
          Length = 483

 Score = 31.5 bits (68), Expect = 4.9
 Identities = 16/59 (27%), Positives = 28/59 (47%)
 Frame = +2

Query: 311 QLHRISMAAMVAEQLSEAWLPFWEELGEKLKDGRS*TFIQDSMQTGKWNWAQIHNFERF 487
           QL  +       E +SE      E+LGE ++D  S       +++G+  W+ +H  E+F
Sbjct: 317 QLENLEQQKYDDEDISEDIKFLLEKLGESVQDLSSFDEYSSELKSGRLEWSPVHKSEKF 375


>AF298777-1|AAG22809.1|  483|Homo sapiens vacuolar ATPase subunit H
           protein.
          Length = 483

 Score = 31.5 bits (68), Expect = 4.9
 Identities = 16/59 (27%), Positives = 28/59 (47%)
 Frame = +2

Query: 311 QLHRISMAAMVAEQLSEAWLPFWEELGEKLKDGRS*TFIQDSMQTGKWNWAQIHNFERF 487
           QL  +       E +SE      E+LGE ++D  S       +++G+  W+ +H  E+F
Sbjct: 317 QLENLEQQKYDDEDISEDIKFLLEKLGESVQDLSSFDEYSSELKSGRLEWSPVHKSEKF 375


>AF132945-1|AAD27720.1|  483|Homo sapiens CGI-11 protein protein.
          Length = 483

 Score = 31.5 bits (68), Expect = 4.9
 Identities = 16/59 (27%), Positives = 28/59 (47%)
 Frame = +2

Query: 311 QLHRISMAAMVAEQLSEAWLPFWEELGEKLKDGRS*TFIQDSMQTGKWNWAQIHNFERF 487
           QL  +       E +SE      E+LGE ++D  S       +++G+  W+ +H  E+F
Sbjct: 317 QLENLEQQKYDDEDISEDIKFLLEKLGESVQDLSSFDEYSSELKSGRLEWSPVHKSEKF 375


>AF125105-1|AAL75942.1|  476|Homo sapiens vacuolar proton pump
           subunit SFD alpha isoform protein.
          Length = 476

 Score = 31.5 bits (68), Expect = 4.9
 Identities = 16/59 (27%), Positives = 28/59 (47%)
 Frame = +2

Query: 311 QLHRISMAAMVAEQLSEAWLPFWEELGEKLKDGRS*TFIQDSMQTGKWNWAQIHNFERF 487
           QL  +       E +SE      E+LGE ++D  S       +++G+  W+ +H  E+F
Sbjct: 317 QLENLEQQKYDDEDISEDIKFLLEKLGESVQDLSSFDEYSSELKSGRLEWSPVHKSEKF 375


>AF112204-1|AAF17192.1|  483|Homo sapiens Vacuolar proton pump
           subunit SFD alpha isoform protein.
          Length = 483

 Score = 31.5 bits (68), Expect = 4.9
 Identities = 16/59 (27%), Positives = 28/59 (47%)
 Frame = +2

Query: 311 QLHRISMAAMVAEQLSEAWLPFWEELGEKLKDGRS*TFIQDSMQTGKWNWAQIHNFERF 487
           QL  +       E +SE      E+LGE ++D  S       +++G+  W+ +H  E+F
Sbjct: 317 QLENLEQQKYDDEDISEDIKFLLEKLGESVQDLSSFDEYSSELKSGRLEWSPVHKSEKF 375


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 137,125,398
Number of Sequences: 237096
Number of extensions: 2875109
Number of successful extensions: 5697
Number of sequences better than 10.0: 13
Number of HSP's better than 10.0 without gapping: 5473
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5697
length of database: 76,859,062
effective HSP length: 90
effective length of database: 55,520,422
effective search space used: 13102819592
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).