SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30001
         (833 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AK127847-1|BAC87159.1|  129|Homo sapiens protein ( Homo sapiens ...    46   1e-04
AK130656-1|BAC85402.1|  181|Homo sapiens protein ( Homo sapiens ...    44   0.001
U93569-2|AAC51271.1| 1275|Homo sapiens putative p150 protein.          40   0.011
X52235-2|CAA36480.1|  712|Homo sapiens protein ( Human DNA for L...    39   0.019
X03145-4|CAA26918.1|  140|Homo sapiens protein ( Human KpnI repe...    39   0.019
U93574-2|AAC51279.1| 1275|Homo sapiens putative p150 protein.          39   0.019
U93572-2|AAC51276.1| 1275|Homo sapiens putative p150 protein.          39   0.019
U93568-2|AAC51269.1| 1275|Homo sapiens putative p150 protein.          39   0.019
U93567-2|AAC51267.1| 1275|Homo sapiens putative p150 protein.          39   0.019
U93565-1|AAC51264.1| 1275|Homo sapiens putative p150 protein.          39   0.019
U93564-2|AAC51263.1| 1275|Homo sapiens putative p150 protein.          39   0.019
U09116-2|AAB60345.1| 1275|Homo sapiens ORF2 protein.                   39   0.019
M80343-2|AAB59368.1| 1275|Homo sapiens protein ( Human transposo...    39   0.019
M80340-1|AAA51622.1| 1275|Homo sapiens ORF2 protein.                   39   0.019
M22333-1|AAA88037.1| 1192|Homo sapiens unknown protein protein.        39   0.019
AK097143-1|BAC04963.1|  372|Homo sapiens protein ( Homo sapiens ...    39   0.019
AF421375-1|AAL50637.1| 1275|Homo sapiens unknown protein.              39   0.019
AF194537-1|AAG27485.1|  420|Homo sapiens NAG13 protein.                39   0.019
AF149422-2|AAD38785.1| 1275|Homo sapiens unknown protein.              39   0.019
AF148856-2|AAD39215.1| 1275|Homo sapiens unknown protein.              39   0.019
AF003535-1|AAD04635.1|  573|Homo sapiens ORF2-like protein protein.    39   0.019
U93563-1|AAC51261.1| 1275|Homo sapiens putative p150 protein.          38   0.034
U93570-2|AAC51273.1| 1275|Homo sapiens putative p150 protein.          38   0.045
AK096400-1|BAC04777.1|  644|Homo sapiens protein ( Homo sapiens ...    38   0.045
AK127459-1|BAC86988.1|  238|Homo sapiens protein ( Homo sapiens ...    37   0.10 
AK098235-1|BAC05265.1|  195|Homo sapiens protein ( Homo sapiens ...    37   0.10 
AK094887-1|BAC04450.1|  272|Homo sapiens protein ( Homo sapiens ...    36   0.14 
AK127765-1|BAC87120.1|  184|Homo sapiens protein ( Homo sapiens ...    34   0.55 
AK095784-1|BAC04627.1|  214|Homo sapiens protein ( Homo sapiens ...    34   0.55 
AK091740-1|BAC03736.1|  473|Homo sapiens protein ( Homo sapiens ...    34   0.55 
AK126793-1|BAC86696.1|  188|Homo sapiens protein ( Homo sapiens ...    32   2.2  
BC036758-1|AAH36758.1|  328|Homo sapiens MGC4836 protein protein.      31   3.9  
M22334-1|AAA88038.1|  641|Homo sapiens unknown protein protein.        31   6.8  

>AK127847-1|BAC87159.1|  129|Homo sapiens protein ( Homo sapiens
           cDNA FLJ45950 fis, clone PLACE7008136. ).
          Length = 129

 Score = 46.4 bits (105), Expect = 1e-04
 Identities = 21/63 (33%), Positives = 37/63 (58%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIM 528
           L + GI    + +I+A+Y  ST  ++ +  +     +  G +QGCLLSPLLF ++L+ + 
Sbjct: 57  LSKIGIEGTYLKVIKAIYHKSTANIILNGEMLKAFPLRTGTRQGCLLSPLLFSIVLEVLA 116

Query: 527 REV 519
           R +
Sbjct: 117 RAI 119


>AK130656-1|BAC85402.1|  181|Homo sapiens protein ( Homo sapiens
           cDNA FLJ27146 fis, clone SPL09537. ).
          Length = 181

 Score = 43.6 bits (98), Expect = 0.001
 Identities = 20/58 (34%), Positives = 32/58 (55%)
 Frame = -1

Query: 692 IPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIMREV 519
           I    + II+A+Y   T  ++ D+       +  G +QGC LSPLLF  +L+D+ R +
Sbjct: 10  IDGTYVKIIRAIYDKPTANIILDEQKQEAFPLKTGTRQGCPLSPLLFNTVLEDLARAI 67


>U93569-2|AAC51271.1| 1275|Homo sapiens putative p150 protein.
          Length = 1275

 Score = 39.9 bits (89), Expect = 0.011
 Identities = 23/64 (35%), Positives = 37/64 (57%), Gaps = 1/64 (1%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVV-HDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDI 531
           L + GI    + II+A+Y   T  ++ + Q L A   +  G +QGC LSPLLF ++L+ +
Sbjct: 617 LNKLGIDGMYLKIIRAIYDKPTANIILNGQKLEA-FPLKTGTRQGCPLSPLLFNIVLEVL 675

Query: 530 MREV 519
            R +
Sbjct: 676 ARAI 679


>X52235-2|CAA36480.1|  712|Homo sapiens protein ( Human DNA for
           LINE-1 transposable element ORFI and II. ).
          Length = 712

 Score = 39.1 bits (87), Expect = 0.019
 Identities = 23/64 (35%), Positives = 36/64 (56%), Gaps = 1/64 (1%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVV-HDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDI 531
           L + GI      II+A+Y   T  ++ + Q L A   +  G +QGC LSPLLF ++L+ +
Sbjct: 54  LNKLGIDGTYFKIIRAIYDKPTANIILNGQKLEA-FPLKTGTRQGCPLSPLLFNIVLEVL 112

Query: 530 MREV 519
            R +
Sbjct: 113 ARAI 116


>X03145-4|CAA26918.1|  140|Homo sapiens protein ( Human KpnI
           repetitive sequence (T-betaG41) 3kb downstream of
           beta-globin gene.  ).
          Length = 140

 Score = 39.1 bits (87), Expect = 0.019
 Identities = 20/63 (31%), Positives = 33/63 (52%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIM 528
           L + GI    + II+A+Y   T  ++          +  G +QGC LSPLLF ++L+ + 
Sbjct: 55  LNKLGIDGTYLKIIRAIYDKPTANIILSGQKLEAFPLKTGTRQGCPLSPLLFNIVLEVLA 114

Query: 527 REV 519
           R +
Sbjct: 115 RAI 117


>U93574-2|AAC51279.1| 1275|Homo sapiens putative p150 protein.
          Length = 1275

 Score = 39.1 bits (87), Expect = 0.019
 Identities = 23/64 (35%), Positives = 36/64 (56%), Gaps = 1/64 (1%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVV-HDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDI 531
           L + GI      II+A+Y   T  ++ + Q L A   +  G +QGC LSPLLF ++L+ +
Sbjct: 617 LNKLGIDGTYFKIIRAIYDKPTANIILNGQKLEA-FPLKTGTRQGCPLSPLLFNIVLEVL 675

Query: 530 MREV 519
            R +
Sbjct: 676 ARAI 679


>U93572-2|AAC51276.1| 1275|Homo sapiens putative p150 protein.
          Length = 1275

 Score = 39.1 bits (87), Expect = 0.019
 Identities = 23/64 (35%), Positives = 36/64 (56%), Gaps = 1/64 (1%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVV-HDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDI 531
           L + GI      II+A+Y   T  ++ + Q L A   +  G +QGC LSPLLF ++L+ +
Sbjct: 617 LNKLGIDGTYFKIIRAIYDKPTANIILNGQKLEA-FPLKTGTRQGCPLSPLLFNIVLEVL 675

Query: 530 MREV 519
            R +
Sbjct: 676 ARAI 679


>U93568-2|AAC51269.1| 1275|Homo sapiens putative p150 protein.
          Length = 1275

 Score = 39.1 bits (87), Expect = 0.019
 Identities = 23/64 (35%), Positives = 36/64 (56%), Gaps = 1/64 (1%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVV-HDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDI 531
           L + GI      II+A+Y   T  ++ + Q L A   +  G +QGC LSPLLF ++L+ +
Sbjct: 617 LNKLGIDGTYFKIIRAIYDKPTANIILNGQKLEA-FPLKTGTRQGCPLSPLLFNIVLEVL 675

Query: 530 MREV 519
            R +
Sbjct: 676 ARAI 679


>U93567-2|AAC51267.1| 1275|Homo sapiens putative p150 protein.
          Length = 1275

 Score = 39.1 bits (87), Expect = 0.019
 Identities = 23/64 (35%), Positives = 36/64 (56%), Gaps = 1/64 (1%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVV-HDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDI 531
           L + GI      II+A+Y   T  ++ + Q L A   +  G +QGC LSPLLF ++L+ +
Sbjct: 617 LNKLGIDGTYFKIIRAIYDKPTANIILNGQKLEA-FPLKTGTRQGCPLSPLLFNIVLEVL 675

Query: 530 MREV 519
            R +
Sbjct: 676 ARAI 679


>U93565-1|AAC51264.1| 1275|Homo sapiens putative p150 protein.
          Length = 1275

 Score = 39.1 bits (87), Expect = 0.019
 Identities = 23/64 (35%), Positives = 36/64 (56%), Gaps = 1/64 (1%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVV-HDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDI 531
           L + GI      II+A+Y   T  ++ + Q L A   +  G +QGC LSPLLF ++L+ +
Sbjct: 617 LNKLGIDGMYFKIIRAIYDKPTANIILNGQKLEA-FPLKTGTRQGCPLSPLLFNIVLEVL 675

Query: 530 MREV 519
            R +
Sbjct: 676 ARAI 679


>U93564-2|AAC51263.1| 1275|Homo sapiens putative p150 protein.
          Length = 1275

 Score = 39.1 bits (87), Expect = 0.019
 Identities = 23/64 (35%), Positives = 36/64 (56%), Gaps = 1/64 (1%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVV-HDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDI 531
           L + GI      II+A+Y   T  ++ + Q L A   +  G +QGC LSPLLF ++L+ +
Sbjct: 617 LNKLGIDGTYFKIIRAIYDKPTANIILNGQKLEA-FPLKTGTRQGCPLSPLLFNIVLEVL 675

Query: 530 MREV 519
            R +
Sbjct: 676 ARAI 679


>U09116-2|AAB60345.1| 1275|Homo sapiens ORF2 protein.
          Length = 1275

 Score = 39.1 bits (87), Expect = 0.019
 Identities = 23/64 (35%), Positives = 36/64 (56%), Gaps = 1/64 (1%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVV-HDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDI 531
           L + GI      II+A+Y   T  ++ + Q L A   +  G +QGC LSPLLF ++L+ +
Sbjct: 617 LNKLGIDGTYFKIIRAIYDKPTANIILNGQKLEA-FPLKTGTRQGCPLSPLLFNIVLEVL 675

Query: 530 MREV 519
            R +
Sbjct: 676 ARAI 679


>M80343-2|AAB59368.1| 1275|Homo sapiens protein ( Human transposon
           L1.2. ).
          Length = 1275

 Score = 39.1 bits (87), Expect = 0.019
 Identities = 23/64 (35%), Positives = 36/64 (56%), Gaps = 1/64 (1%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVV-HDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDI 531
           L + GI      II+A+Y   T  ++ + Q L A   +  G +QGC LSPLLF ++L+ +
Sbjct: 617 LNKLGIDGTYFKIIRAIYDKPTANIILNGQKLEA-FPLKTGTRQGCPLSPLLFNIVLEVL 675

Query: 530 MREV 519
            R +
Sbjct: 676 ARAI 679


>M80340-1|AAA51622.1| 1275|Homo sapiens ORF2 protein.
          Length = 1275

 Score = 39.1 bits (87), Expect = 0.019
 Identities = 23/64 (35%), Positives = 36/64 (56%), Gaps = 1/64 (1%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVV-HDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDI 531
           L + GI      II+A+Y   T  ++ + Q L A   +  G +QGC LSPLLF ++L+ +
Sbjct: 617 LNKLGIDGTYFKIIRAIYDKPTANIILNGQKLEA-FPLKTGTRQGCPLSPLLFNIVLEVL 675

Query: 530 MREV 519
            R +
Sbjct: 676 ARAI 679


>M22333-1|AAA88037.1| 1192|Homo sapiens unknown protein protein.
          Length = 1192

 Score = 39.1 bits (87), Expect = 0.019
 Identities = 23/64 (35%), Positives = 36/64 (56%), Gaps = 1/64 (1%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVV-HDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDI 531
           L + GI      II+A+Y   T  ++ + Q L A   +  G +QGC LSPLLF ++L+ +
Sbjct: 534 LNKLGIDGTYFKIIRAIYDKPTANIILNGQKLEA-FPLKTGTRQGCPLSPLLFNIVLEVL 592

Query: 530 MREV 519
            R +
Sbjct: 593 ARAI 596


>AK097143-1|BAC04963.1|  372|Homo sapiens protein ( Homo sapiens
           cDNA FLJ39824 fis, clone SPLEN2011981. ).
          Length = 372

 Score = 39.1 bits (87), Expect = 0.019
 Identities = 23/64 (35%), Positives = 36/64 (56%), Gaps = 1/64 (1%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVV-HDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDI 531
           L + GI      II+A+Y   T  ++ + Q L A   +  G +QGC LSPLLF ++L+ +
Sbjct: 189 LNKLGIDGTYFKIIRAIYDKPTANIILNGQKLEA-FPLKTGTRQGCPLSPLLFNIVLEVL 247

Query: 530 MREV 519
            R +
Sbjct: 248 ARAI 251


>AF421375-1|AAL50637.1| 1275|Homo sapiens unknown protein.
          Length = 1275

 Score = 39.1 bits (87), Expect = 0.019
 Identities = 23/64 (35%), Positives = 36/64 (56%), Gaps = 1/64 (1%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVV-HDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDI 531
           L + GI      II+A+Y   T  ++ + Q L A   +  G +QGC LSPLLF ++L+ +
Sbjct: 617 LNKLGIDGTYFKIIRAIYDKPTANIILNGQKLEA-FPLKTGTRQGCPLSPLLFNIVLEVL 675

Query: 530 MREV 519
            R +
Sbjct: 676 ARAI 679


>AF194537-1|AAG27485.1|  420|Homo sapiens NAG13 protein.
          Length = 420

 Score = 39.1 bits (87), Expect = 0.019
 Identities = 23/64 (35%), Positives = 36/64 (56%), Gaps = 1/64 (1%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVV-HDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDI 531
           L + GI      II+A+Y   T  ++ + Q L A   +  G +QGC LSPLLF ++L+ +
Sbjct: 266 LNKLGIDGTYFKIIRAIYGKPTANIILNGQKLEA-FPLKTGTRQGCPLSPLLFNIVLEVL 324

Query: 530 MREV 519
            R +
Sbjct: 325 ARAI 328


>AF149422-2|AAD38785.1| 1275|Homo sapiens unknown protein.
          Length = 1275

 Score = 39.1 bits (87), Expect = 0.019
 Identities = 23/64 (35%), Positives = 36/64 (56%), Gaps = 1/64 (1%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVV-HDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDI 531
           L + GI      II+A+Y   T  ++ + Q L A   +  G +QGC LSPLLF ++L+ +
Sbjct: 617 LNKLGIDGTYFKIIRAIYDKPTANIILNGQKLEA-FPLKTGTRQGCPLSPLLFNIVLEVL 675

Query: 530 MREV 519
            R +
Sbjct: 676 ARAI 679


>AF148856-2|AAD39215.1| 1275|Homo sapiens unknown protein.
          Length = 1275

 Score = 39.1 bits (87), Expect = 0.019
 Identities = 23/64 (35%), Positives = 36/64 (56%), Gaps = 1/64 (1%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVV-HDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDI 531
           L + GI      II+A+Y   T  ++ + Q L A   +  G +QGC LSPLLF ++L+ +
Sbjct: 617 LNKLGIDGTYFKIIRAIYDKPTANIILNGQKLEA-FPLKTGTRQGCPLSPLLFNIVLEVL 675

Query: 530 MREV 519
            R +
Sbjct: 676 ARAI 679


>AF003535-1|AAD04635.1|  573|Homo sapiens ORF2-like protein protein.
          Length = 573

 Score = 39.1 bits (87), Expect = 0.019
 Identities = 23/64 (35%), Positives = 36/64 (56%), Gaps = 1/64 (1%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVV-HDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDI 531
           L + GI      II+A+Y   T  ++ + Q L A   +  G +QGC LSPLLF ++L+ +
Sbjct: 131 LNKLGIDGMYFKIIRAIYDKPTANIILNGQKLEA-FPLKTGTRQGCPLSPLLFNIVLEVL 189

Query: 530 MREV 519
            R +
Sbjct: 190 ARAI 193


>U93563-1|AAC51261.1| 1275|Homo sapiens putative p150 protein.
          Length = 1275

 Score = 38.3 bits (85), Expect = 0.034
 Identities = 23/64 (35%), Positives = 36/64 (56%), Gaps = 1/64 (1%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRV-VHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDI 531
           L + GI      II+A+Y   T  + ++ Q L A   +  G +QGC LSPLLF ++L+ +
Sbjct: 617 LNKLGIDGTYFKIIRAIYDKPTANIRLNGQKLEA-FPLKTGTRQGCPLSPLLFNIVLEVL 675

Query: 530 MREV 519
            R +
Sbjct: 676 ARAI 679


>U93570-2|AAC51273.1| 1275|Homo sapiens putative p150 protein.
          Length = 1275

 Score = 37.9 bits (84), Expect = 0.045
 Identities = 22/64 (34%), Positives = 36/64 (56%), Gaps = 1/64 (1%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVV-HDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDI 531
           L + GI      I++A+Y   T  ++ + Q L A   +  G +QGC LSPLLF ++L+ +
Sbjct: 617 LNKLGIDGTYFKIMRAIYDKPTANIILNGQKLEA-FPLKTGTRQGCPLSPLLFNIVLEVL 675

Query: 530 MREV 519
            R +
Sbjct: 676 ARAI 679


>AK096400-1|BAC04777.1|  644|Homo sapiens protein ( Homo sapiens
           cDNA FLJ39081 fis, clone NT2RP7018340. ).
          Length = 644

 Score = 37.9 bits (84), Expect = 0.045
 Identities = 22/60 (36%), Positives = 34/60 (56%), Gaps = 1/60 (1%)
 Frame = -1

Query: 695 GIPNKIIGIIQALYRGSTCRVV-HDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIMREV 519
           GI      II+A+Y   T  ++ + Q L A   +  G +QGC LSPLLF ++L+ + R +
Sbjct: 19  GIDGTYFKIIRAIYDKPTANIILNGQKLEA-FPLKTGTRQGCPLSPLLFNIVLEVLARAI 77


>AK127459-1|BAC86988.1|  238|Homo sapiens protein ( Homo sapiens
           cDNA FLJ45551 fis, clone BRTHA2037247. ).
          Length = 238

 Score = 36.7 bits (81), Expect = 0.10
 Identities = 23/85 (27%), Positives = 45/85 (52%), Gaps = 1/85 (1%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVV-HDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDI 531
           L + GI    + II+A+    T  ++ + Q L A   +  G +QGC LSPLLF ++L ++
Sbjct: 48  LNKLGIEGPCLKIIRAICDKRTANIILNGQQLEA-FPLKTGTRQGCPLSPLLFNIVL-EV 105

Query: 530 MREVVTTLGALNGAKISWKTLTMQM 456
           +   +  +  + G +I  + + + +
Sbjct: 106 LARAIRQVKEIKGIQIGREEVNLSL 130


>AK098235-1|BAC05265.1|  195|Homo sapiens protein ( Homo sapiens
           cDNA FLJ40916 fis, clone UTERU2005533. ).
          Length = 195

 Score = 36.7 bits (81), Expect = 0.10
 Identities = 23/85 (27%), Positives = 45/85 (52%), Gaps = 1/85 (1%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVV-HDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDI 531
           L + GI    + II+A+    T  ++ + Q L A   +  G +QGC LSPLLF ++L ++
Sbjct: 5   LNKLGIEGPCLKIIRAICDKRTANIILNGQQLEA-FPLKTGTRQGCPLSPLLFNIVL-EV 62

Query: 530 MREVVTTLGALNGAKISWKTLTMQM 456
           +   +  +  + G +I  + + + +
Sbjct: 63  LARAIRQVKEIKGIQIGREEVNLSL 87


>AK094887-1|BAC04450.1|  272|Homo sapiens protein ( Homo sapiens
           cDNA FLJ37568 fis, clone BRCOC2002323. ).
          Length = 272

 Score = 36.3 bits (80), Expect = 0.14
 Identities = 20/57 (35%), Positives = 31/57 (54%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLD 537
           L + GI    I II+A+Y      ++ +        +T G +QGC LSPLLF ++L+
Sbjct: 23  LNKLGIDGTHIKIIRAIYDKPIANIILNGQKLEGFLLTTGTRQGCPLSPLLFNIVLE 79


>AK127765-1|BAC87120.1|  184|Homo sapiens protein ( Homo sapiens
           cDNA FLJ45866 fis, clone OCBBF3001616. ).
          Length = 184

 Score = 34.3 bits (75), Expect = 0.55
 Identities = 17/58 (29%), Positives = 30/58 (51%)
 Frame = -1

Query: 692 IPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIMREV 519
           I    + +I+A+Y   T  ++ +        +  G +QGC LSPLLF + L+ + R +
Sbjct: 68  IQGTYLNVIKAIYDKPTANMILNGEKLKAFPLRIGTRQGCPLSPLLFNIALEVLTRAI 125


>AK095784-1|BAC04627.1|  214|Homo sapiens protein ( Homo sapiens
           cDNA FLJ38465 fis, clone FEBRA2021497. ).
          Length = 214

 Score = 34.3 bits (75), Expect = 0.55
 Identities = 20/50 (40%), Positives = 31/50 (62%), Gaps = 1/50 (2%)
 Frame = -1

Query: 671 IIQALYRGSTCRVV-HDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIMR 525
           II+A+Y   T  ++ + Q L A   + A  +QGC LSPLLF ++L+ + R
Sbjct: 5   IIRAIYDKPTANIILNGQKLEA-FPLKASTRQGCPLSPLLFNIVLEVLTR 53


>AK091740-1|BAC03736.1|  473|Homo sapiens protein ( Homo sapiens
           cDNA FLJ34421 fis, clone HHDPC2002963. ).
          Length = 473

 Score = 34.3 bits (75), Expect = 0.55
 Identities = 23/64 (35%), Positives = 35/64 (54%), Gaps = 1/64 (1%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVV-HDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDI 531
           L + GI      II A+Y   T  ++ + Q L A   +  G +QGC LSPLLF ++L+ +
Sbjct: 17  LNKLGIDGTYFKII-AIYDKPTANIILNGQKLEA-FPLKTGTRQGCPLSPLLFNIVLEVL 74

Query: 530 MREV 519
            R +
Sbjct: 75  ARAI 78


>AK126793-1|BAC86696.1|  188|Homo sapiens protein ( Homo sapiens
           cDNA FLJ44843 fis, clone BRACE3050270. ).
          Length = 188

 Score = 32.3 bits (70), Expect = 2.2
 Identities = 19/84 (22%), Positives = 40/84 (47%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRVVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIM 528
           L + GI    + I++A+Y   T  ++ +        +  G +Q C L PLLF  +L +++
Sbjct: 28  LDKLGIDGTYLKIVRAIYDKPTANIILNGHKLEVFPLKTGTRQECPLLPLLFNTVL-EVL 86

Query: 527 REVVTTLGALNGAKISWKTLTMQM 456
              +T    + G +I  + + + +
Sbjct: 87  ARAITQEKEIQGIQIGSEKVKLSL 110


>BC036758-1|AAH36758.1|  328|Homo sapiens MGC4836 protein protein.
          Length = 328

 Score = 31.5 bits (68), Expect = 3.9
 Identities = 20/58 (34%), Positives = 31/58 (53%), Gaps = 1/58 (1%)
 Frame = -1

Query: 707 LKQRGIPNKIIGIIQALYRGSTCRV-VHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLD 537
           L + GI      II+A+Y   T  + ++ Q L A   +  G   GC +SPLLF ++L+
Sbjct: 5   LNKLGIDGTYFKIIRAVYDKPTANITLNGQKLKA-FPLKTGTTHGCPVSPLLFNIVLE 61


>M22334-1|AAA88038.1|  641|Homo sapiens unknown protein protein.
          Length = 641

 Score = 30.7 bits (66), Expect = 6.8
 Identities = 15/39 (38%), Positives = 25/39 (64%)
 Frame = -1

Query: 635 VVHDQVLGAPIEMTAGVKQGCLLSPLLFIMLLDDIMREV 519
           +++ Q L A   +  G +QGC LSPLLF ++L+ + R +
Sbjct: 8   ILNGQKLQA-FPLKTGTRQGCPLSPLLFNIVLEVLARAI 45


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 130,730,924
Number of Sequences: 237096
Number of extensions: 2948158
Number of successful extensions: 5344
Number of sequences better than 10.0: 33
Number of HSP's better than 10.0 without gapping: 5095
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5344
length of database: 76,859,062
effective HSP length: 89
effective length of database: 55,757,518
effective search space used: 10482413384
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).