SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0036
         (648 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

X02344-1|CAA26203.1|  445|Homo sapiens beta-tubulin protein.          182   7e-46
BX255925-3|CAM24148.1|  445|Homo sapiens tubulin, beta 2C protein.    182   7e-46
BC071889-1|AAH71889.1|  445|Homo sapiens tubulin, beta 2C protein.    182   7e-46
BC039175-1|AAH39175.1|  445|Homo sapiens tubulin, beta 2C protein.    182   7e-46
BC029529-1|AAH29529.1|  445|Homo sapiens tubulin, beta 2C protein.    182   7e-46
BC024038-1|AAH24038.1|  445|Homo sapiens tubulin, beta 2C protein.    182   7e-46
BC019829-1|AAH19829.1|  445|Homo sapiens tubulin, beta 2C protein.    182   7e-46
BC019359-1|AAH19359.1|  445|Homo sapiens tubulin, beta 2C protein.    182   7e-46
BC012835-1|AAH12835.1|  445|Homo sapiens tubulin, beta 2C protein.    182   7e-46
BC007889-1|AAH07889.1|  445|Homo sapiens tubulin, beta 2C protein.    182   7e-46
BC004188-1|AAH04188.1|  445|Homo sapiens tubulin, beta 2C protein.    182   7e-46
BC002885-1|AAH02885.1|  445|Homo sapiens tubulin, beta 2C protein.    182   7e-46
BC002783-1|AAH02783.1|  445|Homo sapiens tubulin, beta 2C protein.    182   7e-46
BC001911-1|AAH01911.1|  445|Homo sapiens tubulin, beta 2C protein.    182   7e-46
AY167990-1|AAN87335.1|  445|Homo sapiens class IVb beta tubulin ...   182   7e-46
V00599-1|CAA23844.1|  437|Homo sapiens protein ( Human mRNA frag...   180   4e-45
J00314-1|AAB59507.1|  444|Homo sapiens protein ( Human beta-tubu...   180   4e-45
BX248307-7|CAM25934.1|  426|Homo sapiens tubulin beta polypeptid...   180   4e-45
BX248307-6|CAM25933.1|  444|Homo sapiens tubulin beta polypeptid...   180   4e-45
BC103746-1|AAI03747.1|  444|Homo sapiens tubulin, beta protein.       180   4e-45
BC070326-1|AAH70326.1|  444|Homo sapiens tubulin, beta protein.       180   4e-45
BC021909-1|AAH21909.1|  444|Homo sapiens tubulin, beta protein.       180   4e-45
BC020946-1|AAH20946.1|  444|Homo sapiens tubulin, beta protein.       180   4e-45
BC019924-1|AAH19924.1|  444|Homo sapiens tubulin, beta protein.       180   4e-45
BC013374-1|AAH13374.1|  444|Homo sapiens tubulin, beta protein.       180   4e-45
BC007605-1|AAH07605.1|  444|Homo sapiens tubulin, beta protein.       180   4e-45
BC005838-1|AAH05838.1|  444|Homo sapiens tubulin, beta protein.       180   4e-45
BC002347-1|AAH02347.1|  444|Homo sapiens tubulin, beta protein.       180   4e-45
BC001938-1|AAH01938.1|  444|Homo sapiens tubulin, beta protein.       180   4e-45
BA000025-69|BAB63321.1|  444|Homo sapiens Beta-tubulin protein.       180   4e-45
AL845353-24|CAI41893.1|  426|Homo sapiens tubulin, beta polypept...   180   4e-45
AL845353-23|CAI41892.1|  444|Homo sapiens tubulin, beta polypept...   180   4e-45
AL662848-8|CAM24851.1|  426|Homo sapiens tubulin, beta protein.       180   4e-45
AL662848-7|CAI17441.1|  444|Homo sapiens tubulin, beta protein.       180   4e-45
AL662797-12|CAM25516.1|  426|Homo sapiens tubulin, beta protein.      180   4e-45
AL662797-11|CAI18196.1|  444|Homo sapiens tubulin, beta protein.      180   4e-45
AF141349-1|AAD33873.1|  444|Homo sapiens beta-tubulin protein.        180   4e-45
AF070600-1|AAC28654.1|  444|Homo sapiens beta-tubulin protein.        180   4e-45
AF070593-1|AAC28650.1|  444|Homo sapiens beta-tubulin protein.        180   4e-45
AF070561-1|AAC28642.1|  444|Homo sapiens beta-tubulin protein.        180   4e-45
AB202098-1|BAE78618.1|  444|Homo sapiens beta 5-tubulin protein.      180   4e-45
AB103606-1|BAF31267.1|  444|Homo sapiens beta-tubulin protein pr...   180   4e-45
AB088100-1|BAC54932.1|  444|Homo sapiens tubulin, beta polypepti...   180   4e-45
AB062393-1|BAB93480.1|  444|Homo sapiens beta 5-tubulin protein.      180   4e-45
X00734-1|CAA25318.1|  444|Homo sapiens tubulin 5-beta protein.        179   7e-45
BC013683-1|AAH13683.1|  444|Homo sapiens tubulin, beta 4 protein.     179   7e-45
BC006570-1|AAH06570.1|  444|Homo sapiens TUBB4 protein protein.       179   7e-45
X79535-1|CAA56071.1|  445|Homo sapiens beta tubulin protein.          178   1e-44
CR541958-1|CAG46756.1|  445|Homo sapiens TUBB protein.                178   1e-44
CR456788-1|CAG33069.1|  445|Homo sapiens MGC8685 protein.             178   1e-44
BT019930-1|AAV38733.1|  445|Homo sapiens tubulin, beta polypepti...   178   1e-44
BC141925-1|AAI41926.1|  253|Homo sapiens TUBB2A protein protein.      178   1e-44
BC141924-1|AAI41925.1|  253|Homo sapiens TUBB2A protein protein.      178   1e-44
BC063610-1|AAH63610.1|  445|Homo sapiens tubulin, beta 2B protein.    178   1e-44
BC018780-1|AAH18780.1|  445|Homo sapiens tubulin, beta 2A protein.    178   1e-44
BC001352-1|AAH01352.1|  445|Homo sapiens tubulin, beta 2B protein.    178   1e-44
BC001194-1|AAH01194.1|  445|Homo sapiens tubulin, beta 2A protein.    178   1e-44
AY159127-1|AAN85571.1|  445|Homo sapiens class II beta tubulin i...   178   1e-44
AL445309-1|CAI40952.1|  445|Homo sapiens RP11-506K6.1 protein.        178   1e-44
AL031963-6|CAD70628.1|  445|Homo sapiens protein ( Human DNA seq...   178   1e-44
BC101271-1|AAI01272.1|  441|Homo sapiens TUBB8 protein protein.       176   6e-44
BC101270-1|AAI01271.1|  441|Homo sapiens TUBB8 protein protein.       176   6e-44
AL713922-4|CAI16221.1|  435|Homo sapiens novel protein similar t...   176   6e-44
AF355127-1|AAL32434.1|  444|Homo sapiens beta-tubulin 4Q protein.     176   6e-44
AK022340-1|BAB14016.1|  446|Homo sapiens protein ( Homo sapiens ...   169   6e-42
BC002654-1|AAH02654.1|  446|Homo sapiens tubulin, beta 6 protein.     169   7e-42
BC111374-1|AAI11375.1|  447|Homo sapiens TUBB6 protein protein.       168   1e-41
U47634-1|AAC52035.1|  450|Homo sapiens beta-tubulin protein.          167   2e-41
BT006971-1|AAP35617.1|  797|Homo sapiens tubulin, beta, 4 protein.    167   2e-41
BC003021-1|AAH03021.2|  450|Homo sapiens tubulin, beta 3 protein.     167   2e-41
BC001678-1|AAH01678.2|  406|Homo sapiens TUBB3 protein protein.       167   2e-41
BC000748-1|AAH00748.1|  450|Homo sapiens tubulin, beta 3 protein.     167   2e-41
AK223039-1|BAD96759.1|  450|Homo sapiens tubulin, beta, 4 varian...   167   2e-41
AF427491-1|AAL28094.1|  450|Homo sapiens class III beta tubulin ...   167   2e-41
U83110-1|AAB41497.1|  434|Homo sapiens beta-tubulin protein.          157   4e-38
U83668-1|AAB48456.1|  433|Homo sapiens beta-tubulin protein.          150   5e-36
BC033679-1|AAH33679.1|  451|Homo sapiens tubulin, beta 1 protein.     147   3e-35
AL109840-7|CAC09371.2|  451|Homo sapiens tubulin, beta 1 protein.     147   3e-35
AJ292757-1|CAC16605.1|  451|Homo sapiens protein ( Homo sapiens ...   147   3e-35
BC047518-1|AAH47518.1|  280|Homo sapiens TUBB3 protein protein.       136   5e-32
BX248307-8|CAM25935.1|  372|Homo sapiens tubulin beta polypeptid...   128   2e-29
AL845353-25|CAI41894.1|  372|Homo sapiens tubulin, beta polypept...   128   2e-29
AL662848-9|CAI17442.1|  372|Homo sapiens tubulin, beta protein.       128   2e-29
AL662797-13|CAI18197.1|  372|Homo sapiens tubulin, beta protein.      128   2e-29
BC127872-1|AAI27873.2|  188|Homo sapiens TUBB2B protein protein.      126   5e-29
AL713922-2|CAI16219.1|  227|Homo sapiens novel protein similar t...   121   2e-27
X01703-1|CAA25855.1|  451|Homo sapiens alpha-tubulin protein.          97   5e-20
K00558-1|AAA91576.1|  451|Homo sapiens protein ( human alpha-tub...    97   5e-20
DQ400107-1|ABD60581.1|  451|Homo sapiens alpha tubulin protein.        97   5e-20
BC071904-1|AAH71904.1|  451|Homo sapiens tubulin, alpha 1b protein.    97   5e-20
BC063036-1|AAH63036.1|  449|Homo sapiens tubulin, alpha 1c protein.    97   5e-20
BC051297-1|AAH51297.1|  449|Homo sapiens tubulin, alpha 1c protein.    97   5e-20
BC050637-1|AAH50637.1|  451|Homo sapiens tubulin, alpha 1a protein.    97   5e-20
BC030820-1|AAH30820.1|  451|Homo sapiens tubulin, alpha 1b protein.    97   5e-20
BC021088-1|AAH21088.1|  449|Homo sapiens tubulin, alpha 1c protein.    97   5e-20
BC019298-1|AAH19298.1|  449|Homo sapiens tubulin, alpha 1c protein.    97   5e-20
BC017004-1|AAH17004.1|  451|Homo sapiens tubulin, alpha 1b protein.    97   5e-20
BC015883-1|AAH15883.1|  451|Homo sapiens tubulin, alpha 1b protein.    97   5e-20
BC011790-1|AAH11790.1|  449|Homo sapiens tubulin, alpha 1c protein.    97   5e-20
BC011572-1|AAH11572.1|  451|Homo sapiens tubulin, alpha 1b protein.    97   5e-20
BC010494-1|AAH10494.1|  451|Homo sapiens tubulin, alpha 1b protein.    97   5e-20
BC009513-1|AAH09513.1|  451|Homo sapiens tubulin, alpha 1b protein.    97   5e-20
BC009512-1|AAH09512.1|  451|Homo sapiens tubulin, alpha 1b protein.    97   5e-20
BC009509-1|AAH09509.1|  451|Homo sapiens tubulin, alpha 1b protein.    97   5e-20
BC009314-1|AAH09314.1|  451|Homo sapiens tubulin, alpha 1b protein.    97   5e-20
BC008659-1|AAH08659.1|  451|Homo sapiens tubulin, alpha 1b protein.    97   5e-20
BC006481-1|AAH06481.1|  451|Homo sapiens tubulin, alpha 1b protein.    97   5e-20
BC006468-1|AAH06468.1|  451|Homo sapiens tubulin, alpha 1a protein.    97   5e-20
BC006379-1|AAH06379.1|  451|Homo sapiens tubulin, alpha 1b protein.    97   5e-20
BC005946-1|AAH05946.1|  449|Homo sapiens tubulin, alpha 1c protein.    97   5e-20
BC004949-1|AAH04949.1|  449|Homo sapiens tubulin, alpha 1c protein.    97   5e-20
BC001128-1|AAH01128.1|  451|Homo sapiens tubulin, alpha 1b protein.    97   5e-20
BC000696-1|AAH00696.1|  451|Homo sapiens tubulin, alpha 1b protein.    97   5e-20
AK223024-1|BAD96744.1|  449|Homo sapiens tubulin alpha 6 variant...    97   5e-20
AF141347-1|AAD33871.1|  451|Homo sapiens alpha-tubulin protein.        97   5e-20
AF081484-1|AAC31959.1|  451|Homo sapiens alpha-tubulin isoform 1...    97   5e-20
DQ422808-1|ABD72607.1|  450|Homo sapiens tubulin, alpha 2 protein.     97   6e-20
BC057810-1|AAH57810.1|  450|Homo sapiens tubulin, alpha 3d protein.    97   6e-20
BC011721-1|AAH11721.1|  418|Homo sapiens tubulin, alpha 3c protein.    97   6e-20
AL139327-3|CAH73534.1|  450|Homo sapiens tubulin, alpha 3c protein.    97   6e-20
AF005392-1|AAC39578.1|  449|Homo sapiens alpha tubulin protein.        97   6e-20
X06956-1|CAA30026.1|  447|Homo sapiens alpha-tubulin protein.          95   2e-19
BT006731-1|AAP35377.1|  448|Homo sapiens tubulin, alpha 1 (testi...    95   2e-19
BC009238-1|AAH09238.1|  448|Homo sapiens tubulin, alpha 4a protein.    95   2e-19
AY895018-1|AAW65371.1|  448|Homo sapiens tubulin, alpha 1 (testi...    95   2e-19
BC057811-1|AAH57811.1|  450|Homo sapiens tubulin, alpha 3e protein.    95   3e-19
CR456600-1|CAG30486.1|  449|Homo sapiens TUBA8 protein.                94   3e-19
BX537702-1|CAD97815.1|  479|Homo sapiens hypothetical protein pr...    94   3e-19
BC104845-1|AAI04846.1|  449|Homo sapiens tubulin, alpha 8 protein.     94   3e-19
BC074827-1|AAH74827.1|  449|Homo sapiens tubulin, alpha 8 protein.     94   3e-19
AJ245922-1|CAB88036.1|  449|Homo sapiens alpha-tubulin 8 protein.      94   3e-19
BC033064-1|AAH33064.1|  325|Homo sapiens TUBA1C protein protein.       91   3e-18
BC105634-1|AAI05635.1|  446|Homo sapiens tubulin, alpha-like 3 p...    81   3e-15
BC099716-1|AAH99716.1|  446|Homo sapiens tubulin, alpha-like 3 p...    81   3e-15
BC098247-1|AAH98247.1|  406|Homo sapiens TUBAL3 protein protein.       81   3e-15
AL683826-2|CAI23625.1|  446|Homo sapiens tubulin, alpha-like 3 p...    81   3e-15
AK025318-1|BAB15110.1|  446|Homo sapiens protein ( Homo sapiens ...    81   3e-15
AL713922-3|CAI16220.1|  410|Homo sapiens novel protein similar t...    80   8e-15
BC021564-1|AAH21564.1|  335|Homo sapiens TUBA1B protein protein.       79   1e-14
M61764-1|AAA52620.1|  451|Homo sapiens gamma-tubulin protein.          77   7e-14
CR407642-1|CAG28570.1|  451|Homo sapiens TUBG1 protein.                77   7e-14
BT019931-1|AAV38734.1|  451|Homo sapiens tubulin, gamma 1 protein.     77   7e-14
BC108739-1|AAI08740.1|  451|Homo sapiens tubulin, gamma 2 protein.     77   7e-14
BC051890-1|AAH51890.1|  451|Homo sapiens tubulin, gamma 2 protein.     77   7e-14
BC009670-1|AAH09670.1|  451|Homo sapiens tubulin, gamma 2 protein.     77   7e-14
BC000619-1|AAH00619.1|  451|Homo sapiens tubulin, gamma 1 protein.     77   7e-14
AK022324-1|BAB14012.1|  451|Homo sapiens protein ( Homo sapiens ...    77   7e-14
AF225971-1|AAF34188.1|  451|Homo sapiens gamma-tubulin protein.        77   7e-14
Z99289-5|CAI42328.1|  163|Homo sapiens tubulin, epsilon 1 protein.     69   1e-11
Z99289-4|CAI42327.1|  475|Homo sapiens tubulin, epsilon 1 protein.     69   1e-11
Z99289-3|CAI42326.1|  206|Homo sapiens tubulin, epsilon 1 protein.     69   1e-11
BC025405-1|AAH25405.1|  475|Homo sapiens tubulin, epsilon 1 prot...    69   1e-11
AF201334-1|AAF09585.1|  475|Homo sapiens epsilon-tubulin protein.      69   1e-11
BC031101-1|AAH31101.1|  475|Homo sapiens tubulin, epsilon 1 prot...    69   2e-11
AY533484-1|AAS86429.1|   98|Homo sapiens tubulin alpha-1 protein.      62   2e-09
AF035316-1|AAB88188.1|  342|Homo sapiens protein ( Homo sapiens ...    58   3e-08
BC000258-1|AAH00258.1|  398|Homo sapiens TUBD1 protein protein.        57   5e-08
BC001896-1|AAH01896.1|  340|Homo sapiens TUBB protein protein.         57   6e-08
AF201333-1|AAF09584.1|  453|Homo sapiens delta-tubulin protein.        57   6e-08
AB031045-1|BAD83581.1|  351|Homo sapiens delta-tubulin isoform p...    57   6e-08
AB031044-1|BAD83580.1|  398|Homo sapiens delta-tubulin isoform p...    57   6e-08
AB030837-1|BAD16590.1|  453|Homo sapiens delta tubulin protein.        57   6e-08
AK024002-1|BAB14767.1|  241|Homo sapiens protein ( Homo sapiens ...    56   8e-08
BC127874-1|AAI27875.1|  151|Homo sapiens Unknown (protein for IM...    46   9e-05
AL050056-1|CAB43252.1|  325|Homo sapiens hypothetical protein pr...    46   9e-05
DQ457058-1|ABE96641.1|  208|Homo sapiens XTP3TPA-transactivated ...    45   2e-04
AK024096-1|BAB14825.1|  199|Homo sapiens protein ( Homo sapiens ...    33   1.2  
X07882-1|CAA30729.1|  226|Homo sapiens Po protein protein.             31   4.7  
X07704-1|CAA30542.1|  234|Homo sapiens Po protein protein.             31   4.7  
S80916-1|AAB50687.2|  238|Homo sapiens parotid 'o' protein protein.    31   4.7  
S80905-1|AAB50686.1|  382|Homo sapiens Con1 protein.                   31   4.7  
K03208-1|AAA60189.1|  251|Homo sapiens PRB2 protein.                   31   4.7  
K03207-1|AAA60188.1|  247|Homo sapiens salivary proline-rich pro...    31   4.7  
BC130386-1|AAI30387.1|  268|Homo sapiens PRB4 protein protein.         31   4.7  
K02575-1|AAA36502.1|  173|Homo sapiens protein ( Human salivary ...    30   8.2  
EF064726-1|ABK41909.1|  302|Homo sapiens inducible T-cell co-sti...    30   8.2  
BC064637-1|AAH64637.1|  302|Homo sapiens ICOSLG protein protein.       30   8.2  
AF289028-1|AAG01176.1|  302|Homo sapiens transmembrane protein B...    30   8.2  
AF216749-1|AAK16241.1|  302|Homo sapiens B7-related protein-1 pr...    30   8.2  
AF199028-1|AAF34739.1|  309|Homo sapiens B7-like protein protein.      30   8.2  
AB014553-1|BAA31628.1|  558|Homo sapiens KIAA0653 protein protein.     30   8.2  

>X02344-1|CAA26203.1|  445|Homo sapiens beta-tubulin protein.
          Length = 445

 Score =  182 bits (444), Expect = 7e-46
 Identities = 82/88 (93%), Positives = 85/88 (96%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           RINVYYNEA+GGKYVPRAV+VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH
Sbjct: 46  RINVYYNEATGGKYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 105

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAELVDSVLDVVRKEAE CDC + F
Sbjct: 106 YTEGAELVDSVLDVVRKEAESCDCLQGF 133



 Score = 91.9 bits (218), Expect = 2e-18
 Identities = 40/44 (90%), Positives = 41/44 (93%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQL 254
           MREIVH+QAGQCGNQIGAKFWEVISDEHGID TG Y GDSDLQL
Sbjct: 1   MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQL 44



 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 24/44 (54%), Positives = 24/44 (54%)
 Frame = +1

Query: 511 QGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           QGFQ                   KIREEYPDRIMNTFSVVPS K
Sbjct: 131 QGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPK 174


>BX255925-3|CAM24148.1|  445|Homo sapiens tubulin, beta 2C protein.
          Length = 445

 Score =  182 bits (444), Expect = 7e-46
 Identities = 82/88 (93%), Positives = 85/88 (96%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           RINVYYNEA+GGKYVPRAV+VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH
Sbjct: 46  RINVYYNEATGGKYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 105

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAELVDSVLDVVRKEAE CDC + F
Sbjct: 106 YTEGAELVDSVLDVVRKEAESCDCLQGF 133



 Score = 91.9 bits (218), Expect = 2e-18
 Identities = 40/44 (90%), Positives = 41/44 (93%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQL 254
           MREIVH+QAGQCGNQIGAKFWEVISDEHGID TG Y GDSDLQL
Sbjct: 1   MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQL 44



 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 24/44 (54%), Positives = 24/44 (54%)
 Frame = +1

Query: 511 QGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           QGFQ                   KIREEYPDRIMNTFSVVPS K
Sbjct: 131 QGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPK 174


>BC071889-1|AAH71889.1|  445|Homo sapiens tubulin, beta 2C protein.
          Length = 445

 Score =  182 bits (444), Expect = 7e-46
 Identities = 82/88 (93%), Positives = 85/88 (96%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           RINVYYNEA+GGKYVPRAV+VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH
Sbjct: 46  RINVYYNEATGGKYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 105

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAELVDSVLDVVRKEAE CDC + F
Sbjct: 106 YTEGAELVDSVLDVVRKEAESCDCLQGF 133



 Score = 91.9 bits (218), Expect = 2e-18
 Identities = 40/44 (90%), Positives = 41/44 (93%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQL 254
           MREIVH+QAGQCGNQIGAKFWEVISDEHGID TG Y GDSDLQL
Sbjct: 1   MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQL 44



 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 24/44 (54%), Positives = 24/44 (54%)
 Frame = +1

Query: 511 QGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           QGFQ                   KIREEYPDRIMNTFSVVPS K
Sbjct: 131 QGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPK 174


>BC039175-1|AAH39175.1|  445|Homo sapiens tubulin, beta 2C protein.
          Length = 445

 Score =  182 bits (444), Expect = 7e-46
 Identities = 82/88 (93%), Positives = 85/88 (96%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           RINVYYNEA+GGKYVPRAV+VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH
Sbjct: 46  RINVYYNEATGGKYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 105

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAELVDSVLDVVRKEAE CDC + F
Sbjct: 106 YTEGAELVDSVLDVVRKEAESCDCLQGF 133



 Score = 91.9 bits (218), Expect = 2e-18
 Identities = 40/44 (90%), Positives = 41/44 (93%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQL 254
           MREIVH+QAGQCGNQIGAKFWEVISDEHGID TG Y GDSDLQL
Sbjct: 1   MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQL 44



 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 24/44 (54%), Positives = 24/44 (54%)
 Frame = +1

Query: 511 QGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           QGFQ                   KIREEYPDRIMNTFSVVPS K
Sbjct: 131 QGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPK 174


>BC029529-1|AAH29529.1|  445|Homo sapiens tubulin, beta 2C protein.
          Length = 445

 Score =  182 bits (444), Expect = 7e-46
 Identities = 82/88 (93%), Positives = 85/88 (96%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           RINVYYNEA+GGKYVPRAV+VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH
Sbjct: 46  RINVYYNEATGGKYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 105

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAELVDSVLDVVRKEAE CDC + F
Sbjct: 106 YTEGAELVDSVLDVVRKEAESCDCLQGF 133



 Score = 91.9 bits (218), Expect = 2e-18
 Identities = 40/44 (90%), Positives = 41/44 (93%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQL 254
           MREIVH+QAGQCGNQIGAKFWEVISDEHGID TG Y GDSDLQL
Sbjct: 1   MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQL 44



 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 24/44 (54%), Positives = 24/44 (54%)
 Frame = +1

Query: 511 QGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           QGFQ                   KIREEYPDRIMNTFSVVPS K
Sbjct: 131 QGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPK 174


>BC024038-1|AAH24038.1|  445|Homo sapiens tubulin, beta 2C protein.
          Length = 445

 Score =  182 bits (444), Expect = 7e-46
 Identities = 82/88 (93%), Positives = 85/88 (96%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           RINVYYNEA+GGKYVPRAV+VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH
Sbjct: 46  RINVYYNEATGGKYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 105

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAELVDSVLDVVRKEAE CDC + F
Sbjct: 106 YTEGAELVDSVLDVVRKEAESCDCLQGF 133



 Score = 91.9 bits (218), Expect = 2e-18
 Identities = 40/44 (90%), Positives = 41/44 (93%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQL 254
           MREIVH+QAGQCGNQIGAKFWEVISDEHGID TG Y GDSDLQL
Sbjct: 1   MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQL 44



 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 24/44 (54%), Positives = 24/44 (54%)
 Frame = +1

Query: 511 QGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           QGFQ                   KIREEYPDRIMNTFSVVPS K
Sbjct: 131 QGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPK 174


>BC019829-1|AAH19829.1|  445|Homo sapiens tubulin, beta 2C protein.
          Length = 445

 Score =  182 bits (444), Expect = 7e-46
 Identities = 82/88 (93%), Positives = 85/88 (96%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           RINVYYNEA+GGKYVPRAV+VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH
Sbjct: 46  RINVYYNEATGGKYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 105

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAELVDSVLDVVRKEAE CDC + F
Sbjct: 106 YTEGAELVDSVLDVVRKEAESCDCLQGF 133



 Score = 91.9 bits (218), Expect = 2e-18
 Identities = 40/44 (90%), Positives = 41/44 (93%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQL 254
           MREIVH+QAGQCGNQIGAKFWEVISDEHGID TG Y GDSDLQL
Sbjct: 1   MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQL 44



 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 24/44 (54%), Positives = 24/44 (54%)
 Frame = +1

Query: 511 QGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           QGFQ                   KIREEYPDRIMNTFSVVPS K
Sbjct: 131 QGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPK 174


>BC019359-1|AAH19359.1|  445|Homo sapiens tubulin, beta 2C protein.
          Length = 445

 Score =  182 bits (444), Expect = 7e-46
 Identities = 82/88 (93%), Positives = 85/88 (96%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           RINVYYNEA+GGKYVPRAV+VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH
Sbjct: 46  RINVYYNEATGGKYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 105

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAELVDSVLDVVRKEAE CDC + F
Sbjct: 106 YTEGAELVDSVLDVVRKEAESCDCLQGF 133



 Score = 91.9 bits (218), Expect = 2e-18
 Identities = 40/44 (90%), Positives = 41/44 (93%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQL 254
           MREIVH+QAGQCGNQIGAKFWEVISDEHGID TG Y GDSDLQL
Sbjct: 1   MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQL 44



 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 24/44 (54%), Positives = 24/44 (54%)
 Frame = +1

Query: 511 QGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           QGFQ                   KIREEYPDRIMNTFSVVPS K
Sbjct: 131 QGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPK 174


>BC012835-1|AAH12835.1|  445|Homo sapiens tubulin, beta 2C protein.
          Length = 445

 Score =  182 bits (444), Expect = 7e-46
 Identities = 82/88 (93%), Positives = 85/88 (96%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           RINVYYNEA+GGKYVPRAV+VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH
Sbjct: 46  RINVYYNEATGGKYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 105

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAELVDSVLDVVRKEAE CDC + F
Sbjct: 106 YTEGAELVDSVLDVVRKEAESCDCLQGF 133



 Score = 91.9 bits (218), Expect = 2e-18
 Identities = 40/44 (90%), Positives = 41/44 (93%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQL 254
           MREIVH+QAGQCGNQIGAKFWEVISDEHGID TG Y GDSDLQL
Sbjct: 1   MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQL 44



 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 24/44 (54%), Positives = 24/44 (54%)
 Frame = +1

Query: 511 QGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           QGFQ                   KIREEYPDRIMNTFSVVPS K
Sbjct: 131 QGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPK 174


>BC007889-1|AAH07889.1|  445|Homo sapiens tubulin, beta 2C protein.
          Length = 445

 Score =  182 bits (444), Expect = 7e-46
 Identities = 82/88 (93%), Positives = 85/88 (96%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           RINVYYNEA+GGKYVPRAV+VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH
Sbjct: 46  RINVYYNEATGGKYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 105

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAELVDSVLDVVRKEAE CDC + F
Sbjct: 106 YTEGAELVDSVLDVVRKEAESCDCLQGF 133



 Score = 91.9 bits (218), Expect = 2e-18
 Identities = 40/44 (90%), Positives = 41/44 (93%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQL 254
           MREIVH+QAGQCGNQIGAKFWEVISDEHGID TG Y GDSDLQL
Sbjct: 1   MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQL 44



 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 24/44 (54%), Positives = 24/44 (54%)
 Frame = +1

Query: 511 QGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           QGFQ                   KIREEYPDRIMNTFSVVPS K
Sbjct: 131 QGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPK 174


>BC004188-1|AAH04188.1|  445|Homo sapiens tubulin, beta 2C protein.
          Length = 445

 Score =  182 bits (444), Expect = 7e-46
 Identities = 82/88 (93%), Positives = 85/88 (96%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           RINVYYNEA+GGKYVPRAV+VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH
Sbjct: 46  RINVYYNEATGGKYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 105

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAELVDSVLDVVRKEAE CDC + F
Sbjct: 106 YTEGAELVDSVLDVVRKEAESCDCLQGF 133



 Score = 91.9 bits (218), Expect = 2e-18
 Identities = 40/44 (90%), Positives = 41/44 (93%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQL 254
           MREIVH+QAGQCGNQIGAKFWEVISDEHGID TG Y GDSDLQL
Sbjct: 1   MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQL 44



 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 24/44 (54%), Positives = 24/44 (54%)
 Frame = +1

Query: 511 QGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           QGFQ                   KIREEYPDRIMNTFSVVPS K
Sbjct: 131 QGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPK 174


>BC002885-1|AAH02885.1|  445|Homo sapiens tubulin, beta 2C protein.
          Length = 445

 Score =  182 bits (444), Expect = 7e-46
 Identities = 82/88 (93%), Positives = 85/88 (96%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           RINVYYNEA+GGKYVPRAV+VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH
Sbjct: 46  RINVYYNEATGGKYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 105

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAELVDSVLDVVRKEAE CDC + F
Sbjct: 106 YTEGAELVDSVLDVVRKEAESCDCLQGF 133



 Score = 91.9 bits (218), Expect = 2e-18
 Identities = 40/44 (90%), Positives = 41/44 (93%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQL 254
           MREIVH+QAGQCGNQIGAKFWEVISDEHGID TG Y GDSDLQL
Sbjct: 1   MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQL 44



 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 24/44 (54%), Positives = 24/44 (54%)
 Frame = +1

Query: 511 QGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           QGFQ                   KIREEYPDRIMNTFSVVPS K
Sbjct: 131 QGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPK 174


>BC002783-1|AAH02783.1|  445|Homo sapiens tubulin, beta 2C protein.
          Length = 445

 Score =  182 bits (444), Expect = 7e-46
 Identities = 82/88 (93%), Positives = 85/88 (96%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           RINVYYNEA+GGKYVPRAV+VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH
Sbjct: 46  RINVYYNEATGGKYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 105

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAELVDSVLDVVRKEAE CDC + F
Sbjct: 106 YTEGAELVDSVLDVVRKEAESCDCLQGF 133



 Score = 91.9 bits (218), Expect = 2e-18
 Identities = 40/44 (90%), Positives = 41/44 (93%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQL 254
           MREIVH+QAGQCGNQIGAKFWEVISDEHGID TG Y GDSDLQL
Sbjct: 1   MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQL 44



 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 24/44 (54%), Positives = 24/44 (54%)
 Frame = +1

Query: 511 QGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           QGFQ                   KIREEYPDRIMNTFSVVPS K
Sbjct: 131 QGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPK 174


>BC001911-1|AAH01911.1|  445|Homo sapiens tubulin, beta 2C protein.
          Length = 445

 Score =  182 bits (444), Expect = 7e-46
 Identities = 82/88 (93%), Positives = 85/88 (96%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           RINVYYNEA+GGKYVPRAV+VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH
Sbjct: 46  RINVYYNEATGGKYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 105

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAELVDSVLDVVRKEAE CDC + F
Sbjct: 106 YTEGAELVDSVLDVVRKEAESCDCLQGF 133



 Score = 91.9 bits (218), Expect = 2e-18
 Identities = 40/44 (90%), Positives = 41/44 (93%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQL 254
           MREIVH+QAGQCGNQIGAKFWEVISDEHGID TG Y GDSDLQL
Sbjct: 1   MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQL 44



 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 24/44 (54%), Positives = 24/44 (54%)
 Frame = +1

Query: 511 QGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           QGFQ                   KIREEYPDRIMNTFSVVPS K
Sbjct: 131 QGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPK 174


>AY167990-1|AAN87335.1|  445|Homo sapiens class IVb beta tubulin
           protein.
          Length = 445

 Score =  182 bits (444), Expect = 7e-46
 Identities = 82/88 (93%), Positives = 85/88 (96%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           RINVYYNEA+GGKYVPRAV+VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH
Sbjct: 46  RINVYYNEATGGKYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 105

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAELVDSVLDVVRKEAE CDC + F
Sbjct: 106 YTEGAELVDSVLDVVRKEAESCDCLQGF 133



 Score = 91.9 bits (218), Expect = 2e-18
 Identities = 40/44 (90%), Positives = 41/44 (93%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQL 254
           MREIVH+QAGQCGNQIGAKFWEVISDEHGID TG Y GDSDLQL
Sbjct: 1   MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQL 44



 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 24/44 (54%), Positives = 24/44 (54%)
 Frame = +1

Query: 511 QGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           QGFQ                   KIREEYPDRIMNTFSVVPS K
Sbjct: 131 QGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPK 174


>V00599-1|CAA23844.1|  437|Homo sapiens protein ( Human mRNA
           fragment encoding beta-tubulin. (from clone D-beta-1).
           ).
          Length = 437

 Score =  180 bits (438), Expect = 4e-45
 Identities = 80/88 (90%), Positives = 85/88 (96%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           RI+VYYNEA+GGKYVPRA++VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH
Sbjct: 39  RISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 98

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAELVDSVLDVVRKEAE CDC + F
Sbjct: 99  YTEGAELVDSVLDVVRKEAESCDCLQGF 126



 Score = 79.0 bits (186), Expect = 1e-14
 Identities = 34/38 (89%), Positives = 35/38 (92%)
 Frame = +3

Query: 144 QAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLN 257
           QAGQCGNQIGAKFWEVISDEHGID TG Y GDSDLQL+
Sbjct: 1   QAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLD 38



 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 24/44 (54%), Positives = 24/44 (54%)
 Frame = +1

Query: 511 QGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           QGFQ                   KIREEYPDRIMNTFSVVPS K
Sbjct: 124 QGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPK 167


>J00314-1|AAB59507.1|  444|Homo sapiens protein ( Human beta-tubulin
           gene, clone m40. ).
          Length = 444

 Score =  180 bits (438), Expect = 4e-45
 Identities = 80/88 (90%), Positives = 85/88 (96%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           RI+VYYNEA+GGKYVPRA++VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH
Sbjct: 46  RISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 105

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAELVDSVLDVVRKEAE CDC + F
Sbjct: 106 YTEGAELVDSVLDVVRKEAESCDCLQGF 133



 Score = 93.1 bits (221), Expect = 8e-19
 Identities = 41/45 (91%), Positives = 42/45 (93%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLN 257
           MREIVHIQAGQCGNQIGAKFWEVISDEHGID TG Y GDSDLQL+
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLD 45



 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 24/44 (54%), Positives = 24/44 (54%)
 Frame = +1

Query: 511 QGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           QGFQ                   KIREEYPDRIMNTFSVVPS K
Sbjct: 131 QGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPK 174


>BX248307-7|CAM25934.1|  426|Homo sapiens tubulin beta polypeptide
           protein.
          Length = 426

 Score =  180 bits (438), Expect = 4e-45
 Identities = 80/88 (90%), Positives = 85/88 (96%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           RI+VYYNEA+GGKYVPRA++VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH
Sbjct: 28  RISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 87

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAELVDSVLDVVRKEAE CDC + F
Sbjct: 88  YTEGAELVDSVLDVVRKEAESCDCLQGF 115



 Score = 52.8 bits (121), Expect = 1e-06
 Identities = 22/26 (84%), Positives = 23/26 (88%)
 Frame = +3

Query: 180 FWEVISDEHGIDATGAYSGDSDLQLN 257
           FWEVISDEHGID TG Y GDSDLQL+
Sbjct: 2   FWEVISDEHGIDPTGTYHGDSDLQLD 27



 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 24/44 (54%), Positives = 24/44 (54%)
 Frame = +1

Query: 511 QGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           QGFQ                   KIREEYPDRIMNTFSVVPS K
Sbjct: 113 QGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPK 156


>BX248307-6|CAM25933.1|  444|Homo sapiens tubulin beta polypeptide
           protein.
          Length = 444

 Score =  180 bits (438), Expect = 4e-45
 Identities = 80/88 (90%), Positives = 85/88 (96%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           RI+VYYNEA+GGKYVPRA++VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH
Sbjct: 46  RISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 105

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAELVDSVLDVVRKEAE CDC + F
Sbjct: 106 YTEGAELVDSVLDVVRKEAESCDCLQGF 133



 Score = 93.1 bits (221), Expect = 8e-19
 Identities = 41/45 (91%), Positives = 42/45 (93%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLN 257
           MREIVHIQAGQCGNQIGAKFWEVISDEHGID TG Y GDSDLQL+
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLD 45



 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 24/44 (54%), Positives = 24/44 (54%)
 Frame = +1

Query: 511 QGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           QGFQ                   KIREEYPDRIMNTFSVVPS K
Sbjct: 131 QGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPK 174


>BC103746-1|AAI03747.1|  444|Homo sapiens tubulin, beta protein.
          Length = 444

 Score =  180 bits (438), Expect = 4e-45
 Identities = 80/88 (90%), Positives = 85/88 (96%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           RI+VYYNEA+GGKYVPRA++VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH
Sbjct: 46  RISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 105

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAELVDSVLDVVRKEAE CDC + F
Sbjct: 106 YTEGAELVDSVLDVVRKEAESCDCLQGF 133



 Score = 93.1 bits (221), Expect = 8e-19
 Identities = 41/45 (91%), Positives = 42/45 (93%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLN 257
           MREIVHIQAGQCGNQIGAKFWEVISDEHGID TG Y GDSDLQL+
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLD 45



 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 24/44 (54%), Positives = 24/44 (54%)
 Frame = +1

Query: 511 QGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           QGFQ                   KIREEYPDRIMNTFSVVPS K
Sbjct: 131 QGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPK 174


>BC070326-1|AAH70326.1|  444|Homo sapiens tubulin, beta protein.
          Length = 444

 Score =  180 bits (438), Expect = 4e-45
 Identities = 80/88 (90%), Positives = 85/88 (96%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           RI+VYYNEA+GGKYVPRA++VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH
Sbjct: 46  RISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 105

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAELVDSVLDVVRKEAE CDC + F
Sbjct: 106 YTEGAELVDSVLDVVRKEAESCDCLQGF 133



 Score = 93.1 bits (221), Expect = 8e-19
 Identities = 41/45 (91%), Positives = 42/45 (93%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLN 257
           MREIVHIQAGQCGNQIGAKFWEVISDEHGID TG Y GDSDLQL+
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLD 45



 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 24/44 (54%), Positives = 24/44 (54%)
 Frame = +1

Query: 511 QGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           QGFQ                   KIREEYPDRIMNTFSVVPS K
Sbjct: 131 QGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPK 174


>BC021909-1|AAH21909.1|  444|Homo sapiens tubulin, beta protein.
          Length = 444

 Score =  180 bits (438), Expect = 4e-45
 Identities = 80/88 (90%), Positives = 85/88 (96%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           RI+VYYNEA+GGKYVPRA++VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH
Sbjct: 46  RISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 105

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAELVDSVLDVVRKEAE CDC + F
Sbjct: 106 YTEGAELVDSVLDVVRKEAESCDCLQGF 133



 Score = 93.1 bits (221), Expect = 8e-19
 Identities = 41/45 (91%), Positives = 42/45 (93%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLN 257
           MREIVHIQAGQCGNQIGAKFWEVISDEHGID TG Y GDSDLQL+
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLD 45



 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 24/44 (54%), Positives = 24/44 (54%)
 Frame = +1

Query: 511 QGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           QGFQ                   KIREEYPDRIMNTFSVVPS K
Sbjct: 131 QGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPK 174


>BC020946-1|AAH20946.1|  444|Homo sapiens tubulin, beta protein.
          Length = 444

 Score =  180 bits (438), Expect = 4e-45
 Identities = 80/88 (90%), Positives = 85/88 (96%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           RI+VYYNEA+GGKYVPRA++VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH
Sbjct: 46  RISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 105

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAELVDSVLDVVRKEAE CDC + F
Sbjct: 106 YTEGAELVDSVLDVVRKEAESCDCLQGF 133



 Score = 93.1 bits (221), Expect = 8e-19
 Identities = 41/45 (91%), Positives = 42/45 (93%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLN 257
           MREIVHIQAGQCGNQIGAKFWEVISDEHGID TG Y GDSDLQL+
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLD 45



 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 24/44 (54%), Positives = 24/44 (54%)
 Frame = +1

Query: 511 QGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           QGFQ                   KIREEYPDRIMNTFSVVPS K
Sbjct: 131 QGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPK 174


>BC019924-1|AAH19924.1|  444|Homo sapiens tubulin, beta protein.
          Length = 444

 Score =  180 bits (438), Expect = 4e-45
 Identities = 80/88 (90%), Positives = 85/88 (96%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           RI+VYYNEA+GGKYVPRA++VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH
Sbjct: 46  RISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 105

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAELVDSVLDVVRKEAE CDC + F
Sbjct: 106 YTEGAELVDSVLDVVRKEAESCDCLQGF 133



 Score = 93.1 bits (221), Expect = 8e-19
 Identities = 41/45 (91%), Positives = 42/45 (93%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLN 257
           MREIVHIQAGQCGNQIGAKFWEVISDEHGID TG Y GDSDLQL+
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLD 45



 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 24/44 (54%), Positives = 24/44 (54%)
 Frame = +1

Query: 511 QGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           QGFQ                   KIREEYPDRIMNTFSVVPS K
Sbjct: 131 QGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPK 174


>BC013374-1|AAH13374.1|  444|Homo sapiens tubulin, beta protein.
          Length = 444

 Score =  180 bits (438), Expect = 4e-45
 Identities = 80/88 (90%), Positives = 85/88 (96%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           RI+VYYNEA+GGKYVPRA++VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH
Sbjct: 46  RISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 105

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAELVDSVLDVVRKEAE CDC + F
Sbjct: 106 YTEGAELVDSVLDVVRKEAESCDCLQGF 133



 Score = 93.1 bits (221), Expect = 8e-19
 Identities = 41/45 (91%), Positives = 42/45 (93%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLN 257
           MREIVHIQAGQCGNQIGAKFWEVISDEHGID TG Y GDSDLQL+
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLD 45



 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 24/44 (54%), Positives = 24/44 (54%)
 Frame = +1

Query: 511 QGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           QGFQ                   KIREEYPDRIMNTFSVVPS K
Sbjct: 131 QGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPK 174


>BC007605-1|AAH07605.1|  444|Homo sapiens tubulin, beta protein.
          Length = 444

 Score =  180 bits (438), Expect = 4e-45
 Identities = 80/88 (90%), Positives = 85/88 (96%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           RI+VYYNEA+GGKYVPRA++VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH
Sbjct: 46  RISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 105

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAELVDSVLDVVRKEAE CDC + F
Sbjct: 106 YTEGAELVDSVLDVVRKEAESCDCLQGF 133



 Score = 93.1 bits (221), Expect = 8e-19
 Identities = 41/45 (91%), Positives = 42/45 (93%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLN 257
           MREIVHIQAGQCGNQIGAKFWEVISDEHGID TG Y GDSDLQL+
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLD 45



 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 24/44 (54%), Positives = 24/44 (54%)
 Frame = +1

Query: 511 QGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           QGFQ                   KIREEYPDRIMNTFSVVPS K
Sbjct: 131 QGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPK 174


>BC005838-1|AAH05838.1|  444|Homo sapiens tubulin, beta protein.
          Length = 444

 Score =  180 bits (438), Expect = 4e-45
 Identities = 80/88 (90%), Positives = 85/88 (96%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           RI+VYYNEA+GGKYVPRA++VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH
Sbjct: 46  RISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 105

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAELVDSVLDVVRKEAE CDC + F
Sbjct: 106 YTEGAELVDSVLDVVRKEAESCDCLQGF 133



 Score = 93.1 bits (221), Expect = 8e-19
 Identities = 41/45 (91%), Positives = 42/45 (93%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLN 257
           MREIVHIQAGQCGNQIGAKFWEVISDEHGID TG Y GDSDLQL+
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLD 45



 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 24/44 (54%), Positives = 24/44 (54%)
 Frame = +1

Query: 511 QGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           QGFQ                   KIREEYPDRIMNTFSVVPS K
Sbjct: 131 QGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPK 174


>BC002347-1|AAH02347.1|  444|Homo sapiens tubulin, beta protein.
          Length = 444

 Score =  180 bits (438), Expect = 4e-45
 Identities = 80/88 (90%), Positives = 85/88 (96%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           RI+VYYNEA+GGKYVPRA++VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH
Sbjct: 46  RISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 105

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAELVDSVLDVVRKEAE CDC + F
Sbjct: 106 YTEGAELVDSVLDVVRKEAESCDCLQGF 133



 Score = 93.1 bits (221), Expect = 8e-19
 Identities = 41/45 (91%), Positives = 42/45 (93%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLN 257
           MREIVHIQAGQCGNQIGAKFWEVISDEHGID TG Y GDSDLQL+
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLD 45



 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 24/44 (54%), Positives = 24/44 (54%)
 Frame = +1

Query: 511 QGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           QGFQ                   KIREEYPDRIMNTFSVVPS K
Sbjct: 131 QGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPK 174


>BC001938-1|AAH01938.1|  444|Homo sapiens tubulin, beta protein.
          Length = 444

 Score =  180 bits (438), Expect = 4e-45
 Identities = 80/88 (90%), Positives = 85/88 (96%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           RI+VYYNEA+GGKYVPRA++VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH
Sbjct: 46  RISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 105

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAELVDSVLDVVRKEAE CDC + F
Sbjct: 106 YTEGAELVDSVLDVVRKEAESCDCLQGF 133



 Score = 93.1 bits (221), Expect = 8e-19
 Identities = 41/45 (91%), Positives = 42/45 (93%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLN 257
           MREIVHIQAGQCGNQIGAKFWEVISDEHGID TG Y GDSDLQL+
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLD 45



 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 24/44 (54%), Positives = 24/44 (54%)
 Frame = +1

Query: 511 QGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           QGFQ                   KIREEYPDRIMNTFSVVPS K
Sbjct: 131 QGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPK 174


>BA000025-69|BAB63321.1|  444|Homo sapiens Beta-tubulin protein.
          Length = 444

 Score =  180 bits (438), Expect = 4e-45
 Identities = 80/88 (90%), Positives = 85/88 (96%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           RI+VYYNEA+GGKYVPRA++VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH
Sbjct: 46  RISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 105

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAELVDSVLDVVRKEAE CDC + F
Sbjct: 106 YTEGAELVDSVLDVVRKEAESCDCLQGF 133



 Score = 93.1 bits (221), Expect = 8e-19
 Identities = 41/45 (91%), Positives = 42/45 (93%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLN 257
           MREIVHIQAGQCGNQIGAKFWEVISDEHGID TG Y GDSDLQL+
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLD 45



 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 24/44 (54%), Positives = 24/44 (54%)
 Frame = +1

Query: 511 QGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           QGFQ                   KIREEYPDRIMNTFSVVPS K
Sbjct: 131 QGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPK 174


>AL845353-24|CAI41893.1|  426|Homo sapiens tubulin, beta polypeptide
           protein.
          Length = 426

 Score =  180 bits (438), Expect = 4e-45
 Identities = 80/88 (90%), Positives = 85/88 (96%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           RI+VYYNEA+GGKYVPRA++VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH
Sbjct: 28  RISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 87

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAELVDSVLDVVRKEAE CDC + F
Sbjct: 88  YTEGAELVDSVLDVVRKEAESCDCLQGF 115



 Score = 52.8 bits (121), Expect = 1e-06
 Identities = 22/26 (84%), Positives = 23/26 (88%)
 Frame = +3

Query: 180 FWEVISDEHGIDATGAYSGDSDLQLN 257
           FWEVISDEHGID TG Y GDSDLQL+
Sbjct: 2   FWEVISDEHGIDPTGTYHGDSDLQLD 27



 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 24/44 (54%), Positives = 24/44 (54%)
 Frame = +1

Query: 511 QGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           QGFQ                   KIREEYPDRIMNTFSVVPS K
Sbjct: 113 QGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPK 156


>AL845353-23|CAI41892.1|  444|Homo sapiens tubulin, beta polypeptide
           protein.
          Length = 444

 Score =  180 bits (438), Expect = 4e-45
 Identities = 80/88 (90%), Positives = 85/88 (96%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           RI+VYYNEA+GGKYVPRA++VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH
Sbjct: 46  RISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 105

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAELVDSVLDVVRKEAE CDC + F
Sbjct: 106 YTEGAELVDSVLDVVRKEAESCDCLQGF 133



 Score = 93.1 bits (221), Expect = 8e-19
 Identities = 41/45 (91%), Positives = 42/45 (93%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLN 257
           MREIVHIQAGQCGNQIGAKFWEVISDEHGID TG Y GDSDLQL+
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLD 45



 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 24/44 (54%), Positives = 24/44 (54%)
 Frame = +1

Query: 511 QGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           QGFQ                   KIREEYPDRIMNTFSVVPS K
Sbjct: 131 QGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPK 174


>AL662848-8|CAM24851.1|  426|Homo sapiens tubulin, beta protein.
          Length = 426

 Score =  180 bits (438), Expect = 4e-45
 Identities = 80/88 (90%), Positives = 85/88 (96%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           RI+VYYNEA+GGKYVPRA++VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH
Sbjct: 28  RISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 87

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAELVDSVLDVVRKEAE CDC + F
Sbjct: 88  YTEGAELVDSVLDVVRKEAESCDCLQGF 115



 Score = 52.8 bits (121), Expect = 1e-06
 Identities = 22/26 (84%), Positives = 23/26 (88%)
 Frame = +3

Query: 180 FWEVISDEHGIDATGAYSGDSDLQLN 257
           FWEVISDEHGID TG Y GDSDLQL+
Sbjct: 2   FWEVISDEHGIDPTGTYHGDSDLQLD 27



 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 24/44 (54%), Positives = 24/44 (54%)
 Frame = +1

Query: 511 QGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           QGFQ                   KIREEYPDRIMNTFSVVPS K
Sbjct: 113 QGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPK 156


>AL662848-7|CAI17441.1|  444|Homo sapiens tubulin, beta protein.
          Length = 444

 Score =  180 bits (438), Expect = 4e-45
 Identities = 80/88 (90%), Positives = 85/88 (96%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           RI+VYYNEA+GGKYVPRA++VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH
Sbjct: 46  RISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 105

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAELVDSVLDVVRKEAE CDC + F
Sbjct: 106 YTEGAELVDSVLDVVRKEAESCDCLQGF 133



 Score = 93.1 bits (221), Expect = 8e-19
 Identities = 41/45 (91%), Positives = 42/45 (93%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLN 257
           MREIVHIQAGQCGNQIGAKFWEVISDEHGID TG Y GDSDLQL+
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLD 45



 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 24/44 (54%), Positives = 24/44 (54%)
 Frame = +1

Query: 511 QGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           QGFQ                   KIREEYPDRIMNTFSVVPS K
Sbjct: 131 QGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPK 174


>AL662797-12|CAM25516.1|  426|Homo sapiens tubulin, beta protein.
          Length = 426

 Score =  180 bits (438), Expect = 4e-45
 Identities = 80/88 (90%), Positives = 85/88 (96%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           RI+VYYNEA+GGKYVPRA++VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH
Sbjct: 28  RISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 87

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAELVDSVLDVVRKEAE CDC + F
Sbjct: 88  YTEGAELVDSVLDVVRKEAESCDCLQGF 115



 Score = 52.8 bits (121), Expect = 1e-06
 Identities = 22/26 (84%), Positives = 23/26 (88%)
 Frame = +3

Query: 180 FWEVISDEHGIDATGAYSGDSDLQLN 257
           FWEVISDEHGID TG Y GDSDLQL+
Sbjct: 2   FWEVISDEHGIDPTGTYHGDSDLQLD 27



 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 24/44 (54%), Positives = 24/44 (54%)
 Frame = +1

Query: 511 QGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           QGFQ                   KIREEYPDRIMNTFSVVPS K
Sbjct: 113 QGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPK 156


>AL662797-11|CAI18196.1|  444|Homo sapiens tubulin, beta protein.
          Length = 444

 Score =  180 bits (438), Expect = 4e-45
 Identities = 80/88 (90%), Positives = 85/88 (96%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           RI+VYYNEA+GGKYVPRA++VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH
Sbjct: 46  RISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 105

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAELVDSVLDVVRKEAE CDC + F
Sbjct: 106 YTEGAELVDSVLDVVRKEAESCDCLQGF 133



 Score = 93.1 bits (221), Expect = 8e-19
 Identities = 41/45 (91%), Positives = 42/45 (93%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLN 257
           MREIVHIQAGQCGNQIGAKFWEVISDEHGID TG Y GDSDLQL+
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLD 45



 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 24/44 (54%), Positives = 24/44 (54%)
 Frame = +1

Query: 511 QGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           QGFQ                   KIREEYPDRIMNTFSVVPS K
Sbjct: 131 QGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPK 174


>AF141349-1|AAD33873.1|  444|Homo sapiens beta-tubulin protein.
          Length = 444

 Score =  180 bits (438), Expect = 4e-45
 Identities = 80/88 (90%), Positives = 85/88 (96%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           RI+VYYNEA+GGKYVPRA++VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH
Sbjct: 46  RISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 105

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAELVDSVLDVVRKEAE CDC + F
Sbjct: 106 YTEGAELVDSVLDVVRKEAESCDCLQGF 133



 Score = 93.1 bits (221), Expect = 8e-19
 Identities = 41/45 (91%), Positives = 42/45 (93%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLN 257
           MREIVHIQAGQCGNQIGAKFWEVISDEHGID TG Y GDSDLQL+
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLD 45



 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 24/44 (54%), Positives = 24/44 (54%)
 Frame = +1

Query: 511 QGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           QGFQ                   KIREEYPDRIMNTFSVVPS K
Sbjct: 131 QGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPK 174


>AF070600-1|AAC28654.1|  444|Homo sapiens beta-tubulin protein.
          Length = 444

 Score =  180 bits (438), Expect = 4e-45
 Identities = 80/88 (90%), Positives = 85/88 (96%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           RI+VYYNEA+GGKYVPRA++VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH
Sbjct: 46  RISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 105

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAELVDSVLDVVRKEAE CDC + F
Sbjct: 106 YTEGAELVDSVLDVVRKEAESCDCLQGF 133



 Score = 93.1 bits (221), Expect = 8e-19
 Identities = 41/45 (91%), Positives = 42/45 (93%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLN 257
           MREIVHIQAGQCGNQIGAKFWEVISDEHGID TG Y GDSDLQL+
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLD 45



 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 24/44 (54%), Positives = 24/44 (54%)
 Frame = +1

Query: 511 QGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           QGFQ                   KIREEYPDRIMNTFSVVPS K
Sbjct: 131 QGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPK 174


>AF070593-1|AAC28650.1|  444|Homo sapiens beta-tubulin protein.
          Length = 444

 Score =  180 bits (438), Expect = 4e-45
 Identities = 80/88 (90%), Positives = 85/88 (96%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           RI+VYYNEA+GGKYVPRA++VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH
Sbjct: 46  RISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 105

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAELVDSVLDVVRKEAE CDC + F
Sbjct: 106 YTEGAELVDSVLDVVRKEAESCDCLQGF 133



 Score = 93.1 bits (221), Expect = 8e-19
 Identities = 41/45 (91%), Positives = 42/45 (93%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLN 257
           MREIVHIQAGQCGNQIGAKFWEVISDEHGID TG Y GDSDLQL+
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLD 45



 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 24/44 (54%), Positives = 24/44 (54%)
 Frame = +1

Query: 511 QGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           QGFQ                   KIREEYPDRIMNTFSVVPS K
Sbjct: 131 QGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPK 174


>AF070561-1|AAC28642.1|  444|Homo sapiens beta-tubulin protein.
          Length = 444

 Score =  180 bits (438), Expect = 4e-45
 Identities = 80/88 (90%), Positives = 85/88 (96%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           RI+VYYNEA+GGKYVPRA++VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH
Sbjct: 46  RISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 105

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAELVDSVLDVVRKEAE CDC + F
Sbjct: 106 YTEGAELVDSVLDVVRKEAESCDCLQGF 133



 Score = 93.1 bits (221), Expect = 8e-19
 Identities = 41/45 (91%), Positives = 42/45 (93%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLN 257
           MREIVHIQAGQCGNQIGAKFWEVISDEHGID TG Y GDSDLQL+
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLD 45



 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 24/44 (54%), Positives = 24/44 (54%)
 Frame = +1

Query: 511 QGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           QGFQ                   KIREEYPDRIMNTFSVVPS K
Sbjct: 131 QGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPK 174


>AB202098-1|BAE78618.1|  444|Homo sapiens beta 5-tubulin protein.
          Length = 444

 Score =  180 bits (438), Expect = 4e-45
 Identities = 80/88 (90%), Positives = 85/88 (96%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           RI+VYYNEA+GGKYVPRA++VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH
Sbjct: 46  RISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 105

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAELVDSVLDVVRKEAE CDC + F
Sbjct: 106 YTEGAELVDSVLDVVRKEAESCDCLQGF 133



 Score = 93.1 bits (221), Expect = 8e-19
 Identities = 41/45 (91%), Positives = 42/45 (93%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLN 257
           MREIVHIQAGQCGNQIGAKFWEVISDEHGID TG Y GDSDLQL+
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLD 45



 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 24/44 (54%), Positives = 24/44 (54%)
 Frame = +1

Query: 511 QGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           QGFQ                   KIREEYPDRIMNTFSVVPS K
Sbjct: 131 QGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPK 174


>AB103606-1|BAF31267.1|  444|Homo sapiens beta-tubulin protein
           protein.
          Length = 444

 Score =  180 bits (438), Expect = 4e-45
 Identities = 80/88 (90%), Positives = 85/88 (96%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           RI+VYYNEA+GGKYVPRA++VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH
Sbjct: 46  RISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 105

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAELVDSVLDVVRKEAE CDC + F
Sbjct: 106 YTEGAELVDSVLDVVRKEAESCDCLQGF 133



 Score = 93.1 bits (221), Expect = 8e-19
 Identities = 41/45 (91%), Positives = 42/45 (93%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLN 257
           MREIVHIQAGQCGNQIGAKFWEVISDEHGID TG Y GDSDLQL+
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLD 45



 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 24/44 (54%), Positives = 24/44 (54%)
 Frame = +1

Query: 511 QGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           QGFQ                   KIREEYPDRIMNTFSVVPS K
Sbjct: 131 QGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPK 174


>AB088100-1|BAC54932.1|  444|Homo sapiens tubulin, beta polypeptide
           protein.
          Length = 444

 Score =  180 bits (438), Expect = 4e-45
 Identities = 80/88 (90%), Positives = 85/88 (96%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           RI+VYYNEA+GGKYVPRA++VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH
Sbjct: 46  RISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 105

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAELVDSVLDVVRKEAE CDC + F
Sbjct: 106 YTEGAELVDSVLDVVRKEAESCDCLQGF 133



 Score = 93.1 bits (221), Expect = 8e-19
 Identities = 41/45 (91%), Positives = 42/45 (93%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLN 257
           MREIVHIQAGQCGNQIGAKFWEVISDEHGID TG Y GDSDLQL+
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLD 45



 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 24/44 (54%), Positives = 24/44 (54%)
 Frame = +1

Query: 511 QGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           QGFQ                   KIREEYPDRIMNTFSVVPS K
Sbjct: 131 QGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPK 174


>AB062393-1|BAB93480.1|  444|Homo sapiens beta 5-tubulin protein.
          Length = 444

 Score =  180 bits (438), Expect = 4e-45
 Identities = 80/88 (90%), Positives = 85/88 (96%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           RI+VYYNEA+GGKYVPRA++VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH
Sbjct: 46  RISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 105

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAELVDSVLDVVRKEAE CDC + F
Sbjct: 106 YTEGAELVDSVLDVVRKEAESCDCLQGF 133



 Score = 93.1 bits (221), Expect = 8e-19
 Identities = 41/45 (91%), Positives = 42/45 (93%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLN 257
           MREIVHIQAGQCGNQIGAKFWEVISDEHGID TG Y GDSDLQL+
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLD 45



 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 24/44 (54%), Positives = 24/44 (54%)
 Frame = +1

Query: 511 QGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           QGFQ                   KIREEYPDRIMNTFSVVPS K
Sbjct: 131 QGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPK 174


>X00734-1|CAA25318.1|  444|Homo sapiens tubulin 5-beta protein.
          Length = 444

 Score =  179 bits (436), Expect = 7e-45
 Identities = 80/88 (90%), Positives = 84/88 (95%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           RINVYYNEA+GG YVPRAV+VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH
Sbjct: 46  RINVYYNEATGGNYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 105

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAELVD+VLDVVRKEAE CDC + F
Sbjct: 106 YTEGAELVDAVLDVVRKEAESCDCLQGF 133



 Score = 91.9 bits (218), Expect = 2e-18
 Identities = 40/44 (90%), Positives = 41/44 (93%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQL 254
           MREIVH+QAGQCGNQIGAKFWEVISDEHGID TG Y GDSDLQL
Sbjct: 1   MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQL 44



 Score = 43.6 bits (98), Expect = 6e-04
 Identities = 22/44 (50%), Positives = 24/44 (54%)
 Frame = +1

Query: 511 QGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           QGFQ                   K+REE+PDRIMNTFSVVPS K
Sbjct: 131 QGFQLTHSLGGGTGSGMGTLLISKMREEFPDRIMNTFSVVPSPK 174


>BC013683-1|AAH13683.1|  444|Homo sapiens tubulin, beta 4 protein.
          Length = 444

 Score =  179 bits (436), Expect = 7e-45
 Identities = 80/88 (90%), Positives = 84/88 (95%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           RINVYYNEA+GG YVPRAV+VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH
Sbjct: 46  RINVYYNEATGGNYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 105

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAELVD+VLDVVRKEAE CDC + F
Sbjct: 106 YTEGAELVDAVLDVVRKEAESCDCLQGF 133



 Score = 91.9 bits (218), Expect = 2e-18
 Identities = 40/44 (90%), Positives = 41/44 (93%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQL 254
           MREIVH+QAGQCGNQIGAKFWEVISDEHGID TG Y GDSDLQL
Sbjct: 1   MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQL 44



 Score = 44.8 bits (101), Expect = 3e-04
 Identities = 23/44 (52%), Positives = 24/44 (54%)
 Frame = +1

Query: 511 QGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           QGFQ                   KIREE+PDRIMNTFSVVPS K
Sbjct: 131 QGFQLTHSLGGGTGSGMGTLLISKIREEFPDRIMNTFSVVPSPK 174


>BC006570-1|AAH06570.1|  444|Homo sapiens TUBB4 protein protein.
          Length = 444

 Score =  179 bits (436), Expect = 7e-45
 Identities = 80/88 (90%), Positives = 84/88 (95%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           RINVYYNEA+GG YVPRAV+VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH
Sbjct: 46  RINVYYNEATGGNYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 105

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAELVD+VLDVVRKEAE CDC + F
Sbjct: 106 YTEGAELVDAVLDVVRKEAESCDCLQGF 133



 Score = 91.9 bits (218), Expect = 2e-18
 Identities = 40/44 (90%), Positives = 41/44 (93%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQL 254
           MREIVH+QAGQCGNQIGAKFWEVISDEHGID TG Y GDSDLQL
Sbjct: 1   MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQL 44



 Score = 44.8 bits (101), Expect = 3e-04
 Identities = 23/44 (52%), Positives = 24/44 (54%)
 Frame = +1

Query: 511 QGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           QGFQ                   KIREE+PDRIMNTFSVVPS K
Sbjct: 131 QGFQLTHSLGGGTGSGMGTLLISKIREEFPDRIMNTFSVVPSPK 174


>X79535-1|CAA56071.1|  445|Homo sapiens beta tubulin protein.
          Length = 445

 Score =  178 bits (434), Expect = 1e-44
 Identities = 79/88 (89%), Positives = 84/88 (95%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           RINVYYNEA+G KYVPRA++VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH
Sbjct: 46  RINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 105

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAELVDSVLDVVRKE+E CDC + F
Sbjct: 106 YTEGAELVDSVLDVVRKESESCDCLQGF 133



 Score = 93.1 bits (221), Expect = 8e-19
 Identities = 41/44 (93%), Positives = 42/44 (95%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQL 254
           MREIVHIQAGQCGNQIGAKFWEVISDEHGID TG+Y GDSDLQL
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQL 44



 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 25/53 (47%), Positives = 26/53 (49%)
 Frame = +1

Query: 484 KRSXXXXXXQGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           K S      QGFQ                   KIREEYPDRIMNTFSV+PS K
Sbjct: 122 KESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPK 174


>CR541958-1|CAG46756.1|  445|Homo sapiens TUBB protein.
          Length = 445

 Score =  178 bits (434), Expect = 1e-44
 Identities = 79/88 (89%), Positives = 84/88 (95%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           RINVYYNEA+G KYVPRA++VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH
Sbjct: 46  RINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 105

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAELVDSVLDVVRKE+E CDC + F
Sbjct: 106 YTEGAELVDSVLDVVRKESESCDCLQGF 133



 Score = 93.1 bits (221), Expect = 8e-19
 Identities = 41/44 (93%), Positives = 42/44 (95%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQL 254
           MREIVHIQAGQCGNQIGAKFWEVISDEHGID TG+Y GDSDLQL
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQL 44



 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 25/53 (47%), Positives = 26/53 (49%)
 Frame = +1

Query: 484 KRSXXXXXXQGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           K S      QGFQ                   KIREEYPDRIMNTFSV+PS K
Sbjct: 122 KESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPK 174


>CR456788-1|CAG33069.1|  445|Homo sapiens MGC8685 protein.
          Length = 445

 Score =  178 bits (434), Expect = 1e-44
 Identities = 79/88 (89%), Positives = 84/88 (95%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           RINVYYNEA+G KYVPRA++VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH
Sbjct: 46  RINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 105

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAELVDSVLDVVRKE+E CDC + F
Sbjct: 106 YTEGAELVDSVLDVVRKESESCDCLQGF 133



 Score = 93.1 bits (221), Expect = 8e-19
 Identities = 41/44 (93%), Positives = 42/44 (95%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQL 254
           MREIVHIQAGQCGNQIGAKFWEVISDEHGID TG+Y GDSDLQL
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQL 44



 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 25/53 (47%), Positives = 26/53 (49%)
 Frame = +1

Query: 484 KRSXXXXXXQGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           K S      QGFQ                   KIREEYPDRIMNTFSV+PS K
Sbjct: 122 KESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPK 174


>BT019930-1|AAV38733.1|  445|Homo sapiens tubulin, beta polypeptide
           paralog protein.
          Length = 445

 Score =  178 bits (434), Expect = 1e-44
 Identities = 79/88 (89%), Positives = 84/88 (95%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           RINVYYNEA+G KYVPRA++VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH
Sbjct: 46  RINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 105

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAELVDSVLDVVRKE+E CDC + F
Sbjct: 106 YTEGAELVDSVLDVVRKESESCDCLQGF 133



 Score = 93.1 bits (221), Expect = 8e-19
 Identities = 41/44 (93%), Positives = 42/44 (95%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQL 254
           MREIVHIQAGQCGNQIGAKFWEVISDEHGID TG+Y GDSDLQL
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQL 44



 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 25/53 (47%), Positives = 26/53 (49%)
 Frame = +1

Query: 484 KRSXXXXXXQGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           K S      QGFQ                   KIREEYPDRIMNTFSV+PS K
Sbjct: 122 KESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPK 174


>BC141925-1|AAI41926.1|  253|Homo sapiens TUBB2A protein protein.
          Length = 253

 Score =  178 bits (434), Expect = 1e-44
 Identities = 79/88 (89%), Positives = 84/88 (95%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           RINVYYNEA+G KYVPRA++VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH
Sbjct: 39  RINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 98

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAELVDSVLDVVRKE+E CDC + F
Sbjct: 99  YTEGAELVDSVLDVVRKESESCDCLQGF 126



 Score = 53.2 bits (122), Expect = 8e-07
 Identities = 22/26 (84%), Positives = 24/26 (92%)
 Frame = +3

Query: 177 KFWEVISDEHGIDATGAYSGDSDLQL 254
           +FWEVISDEHGID TG+Y GDSDLQL
Sbjct: 12  QFWEVISDEHGIDPTGSYHGDSDLQL 37



 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 25/53 (47%), Positives = 26/53 (49%)
 Frame = +1

Query: 484 KRSXXXXXXQGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           K S      QGFQ                   KIREEYPDRIMNTFSV+PS K
Sbjct: 115 KESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPK 167


>BC141924-1|AAI41925.1|  253|Homo sapiens TUBB2A protein protein.
          Length = 253

 Score =  178 bits (434), Expect = 1e-44
 Identities = 79/88 (89%), Positives = 84/88 (95%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           RINVYYNEA+G KYVPRA++VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH
Sbjct: 39  RINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 98

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAELVDSVLDVVRKE+E CDC + F
Sbjct: 99  YTEGAELVDSVLDVVRKESESCDCLQGF 126



 Score = 53.2 bits (122), Expect = 8e-07
 Identities = 22/26 (84%), Positives = 24/26 (92%)
 Frame = +3

Query: 177 KFWEVISDEHGIDATGAYSGDSDLQL 254
           +FWEVISDEHGID TG+Y GDSDLQL
Sbjct: 12  QFWEVISDEHGIDPTGSYHGDSDLQL 37



 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 25/53 (47%), Positives = 26/53 (49%)
 Frame = +1

Query: 484 KRSXXXXXXQGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           K S      QGFQ                   KIREEYPDRIMNTFSV+PS K
Sbjct: 115 KESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPK 167


>BC063610-1|AAH63610.1|  445|Homo sapiens tubulin, beta 2B protein.
          Length = 445

 Score =  178 bits (434), Expect = 1e-44
 Identities = 79/88 (89%), Positives = 84/88 (95%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           RINVYYNEA+G KYVPRA++VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH
Sbjct: 46  RINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 105

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAELVDSVLDVVRKE+E CDC + F
Sbjct: 106 YTEGAELVDSVLDVVRKESESCDCLQGF 133



 Score = 93.1 bits (221), Expect = 8e-19
 Identities = 41/44 (93%), Positives = 42/44 (95%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQL 254
           MREIVHIQAGQCGNQIGAKFWEVISDEHGID TG+Y GDSDLQL
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQL 44



 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 25/53 (47%), Positives = 26/53 (49%)
 Frame = +1

Query: 484 KRSXXXXXXQGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           K S      QGFQ                   KIREEYPDRIMNTFSV+PS K
Sbjct: 122 KESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPK 174


>BC018780-1|AAH18780.1|  445|Homo sapiens tubulin, beta 2A protein.
          Length = 445

 Score =  178 bits (434), Expect = 1e-44
 Identities = 79/88 (89%), Positives = 84/88 (95%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           RINVYYNEA+G KYVPRA++VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH
Sbjct: 46  RINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 105

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAELVDSVLDVVRKE+E CDC + F
Sbjct: 106 YTEGAELVDSVLDVVRKESESCDCLQGF 133



 Score = 93.1 bits (221), Expect = 8e-19
 Identities = 41/44 (93%), Positives = 42/44 (95%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQL 254
           MREIVHIQAGQCGNQIGAKFWEVISDEHGID TG+Y GDSDLQL
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQL 44



 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 25/53 (47%), Positives = 26/53 (49%)
 Frame = +1

Query: 484 KRSXXXXXXQGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           K S      QGFQ                   KIREEYPDRIMNTFSV+PS K
Sbjct: 122 KESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPK 174


>BC001352-1|AAH01352.1|  445|Homo sapiens tubulin, beta 2B protein.
          Length = 445

 Score =  178 bits (434), Expect = 1e-44
 Identities = 79/88 (89%), Positives = 84/88 (95%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           RINVYYNEA+G KYVPRA++VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH
Sbjct: 46  RINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 105

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAELVDSVLDVVRKE+E CDC + F
Sbjct: 106 YTEGAELVDSVLDVVRKESESCDCLQGF 133



 Score = 93.1 bits (221), Expect = 8e-19
 Identities = 41/44 (93%), Positives = 42/44 (95%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQL 254
           MREIVHIQAGQCGNQIGAKFWEVISDEHGID TG+Y GDSDLQL
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQL 44



 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 25/53 (47%), Positives = 26/53 (49%)
 Frame = +1

Query: 484 KRSXXXXXXQGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           K S      QGFQ                   KIREEYPDRIMNTFSV+PS K
Sbjct: 122 KESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPK 174


>BC001194-1|AAH01194.1|  445|Homo sapiens tubulin, beta 2A protein.
          Length = 445

 Score =  178 bits (434), Expect = 1e-44
 Identities = 79/88 (89%), Positives = 84/88 (95%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           RINVYYNEA+G KYVPRA++VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH
Sbjct: 46  RINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 105

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAELVDSVLDVVRKE+E CDC + F
Sbjct: 106 YTEGAELVDSVLDVVRKESESCDCLQGF 133



 Score = 93.1 bits (221), Expect = 8e-19
 Identities = 41/44 (93%), Positives = 42/44 (95%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQL 254
           MREIVHIQAGQCGNQIGAKFWEVISDEHGID TG+Y GDSDLQL
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQL 44



 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 25/53 (47%), Positives = 26/53 (49%)
 Frame = +1

Query: 484 KRSXXXXXXQGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           K S      QGFQ                   KIREEYPDRIMNTFSV+PS K
Sbjct: 122 KESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPK 174


>AY159127-1|AAN85571.1|  445|Homo sapiens class II beta tubulin
           isotype protein.
          Length = 445

 Score =  178 bits (434), Expect = 1e-44
 Identities = 79/88 (89%), Positives = 84/88 (95%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           RINVYYNEA+G KYVPRA++VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH
Sbjct: 46  RINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 105

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAELVDSVLDVVRKE+E CDC + F
Sbjct: 106 YTEGAELVDSVLDVVRKESESCDCLQGF 133



 Score = 93.1 bits (221), Expect = 8e-19
 Identities = 41/44 (93%), Positives = 42/44 (95%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQL 254
           MREIVHIQAGQCGNQIGAKFWEVISDEHGID TG+Y GDSDLQL
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQL 44



 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 25/53 (47%), Positives = 26/53 (49%)
 Frame = +1

Query: 484 KRSXXXXXXQGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           K S      QGFQ                   KIREEYPDRIMNTFSV+PS K
Sbjct: 122 KESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPK 174


>AL445309-1|CAI40952.1|  445|Homo sapiens RP11-506K6.1 protein.
          Length = 445

 Score =  178 bits (434), Expect = 1e-44
 Identities = 79/88 (89%), Positives = 84/88 (95%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           RINVYYNEA+G KYVPRA++VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH
Sbjct: 46  RINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 105

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAELVDSVLDVVRKE+E CDC + F
Sbjct: 106 YTEGAELVDSVLDVVRKESESCDCLQGF 133



 Score = 93.1 bits (221), Expect = 8e-19
 Identities = 41/44 (93%), Positives = 42/44 (95%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQL 254
           MREIVHIQAGQCGNQIGAKFWEVISDEHGID TG+Y GDSDLQL
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQL 44



 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 25/53 (47%), Positives = 26/53 (49%)
 Frame = +1

Query: 484 KRSXXXXXXQGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           K S      QGFQ                   KIREEYPDRIMNTFSV+PS K
Sbjct: 122 KESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPK 174


>AL031963-6|CAD70628.1|  445|Homo sapiens protein ( Human DNA
           sequence from clone RP1-40E16 on chromosome 6p24.1-25.3 
           Contains the gene for a novel protein similar to D.
           melanogaster  ).
          Length = 445

 Score =  178 bits (434), Expect = 1e-44
 Identities = 79/88 (89%), Positives = 84/88 (95%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           RINVYYNEA+G KYVPRA++VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH
Sbjct: 46  RINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 105

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAELVDSVLDVVRKE+E CDC + F
Sbjct: 106 YTEGAELVDSVLDVVRKESESCDCLQGF 133



 Score = 93.1 bits (221), Expect = 8e-19
 Identities = 41/44 (93%), Positives = 42/44 (95%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQL 254
           MREIVHIQAGQCGNQIGAKFWEVISDEHGID TG+Y GDSDLQL
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQL 44



 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 25/53 (47%), Positives = 26/53 (49%)
 Frame = +1

Query: 484 KRSXXXXXXQGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           K S      QGFQ                   KIREEYPDRIMNTFSV+PS K
Sbjct: 122 KESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPK 174


>BC101271-1|AAI01272.1|  441|Homo sapiens TUBB8 protein protein.
          Length = 441

 Score =  176 bits (428), Expect = 6e-44
 Identities = 76/88 (86%), Positives = 84/88 (95%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           RINVYYNEASGG+YVPRAV+VDLEPGTMDSVRSGPFGQ+FRPDNF+FGQ GAGNNWAKGH
Sbjct: 43  RINVYYNEASGGRYVPRAVLVDLEPGTMDSVRSGPFGQVFRPDNFIFGQCGAGNNWAKGH 102

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAEL++SV+DVVRKEAE CDC + F
Sbjct: 103 YTEGAELMESVMDVVRKEAESCDCLQGF 130



 Score = 71.7 bits (168), Expect = 2e-12
 Identities = 32/41 (78%), Positives = 33/41 (80%)
 Frame = +3

Query: 132 IVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQL 254
           IV  Q GQCGNQIGAKFWEVISDEH ID+ G Y GDS LQL
Sbjct: 1   IVLTQIGQCGNQIGAKFWEVISDEHAIDSAGTYHGDSHLQL 41



 Score = 43.2 bits (97), Expect = 8e-04
 Identities = 21/44 (47%), Positives = 24/44 (54%)
 Frame = +1

Query: 511 QGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           QGFQ                   KIREEYPDRI+NTFS++PS K
Sbjct: 128 QGFQLTHSLGGGTGSGMGTLLLSKIREEYPDRIINTFSILPSPK 171


>BC101270-1|AAI01271.1|  441|Homo sapiens TUBB8 protein protein.
          Length = 441

 Score =  176 bits (428), Expect = 6e-44
 Identities = 76/88 (86%), Positives = 84/88 (95%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           RINVYYNEASGG+YVPRAV+VDLEPGTMDSVRSGPFGQ+FRPDNF+FGQ GAGNNWAKGH
Sbjct: 43  RINVYYNEASGGRYVPRAVLVDLEPGTMDSVRSGPFGQVFRPDNFIFGQCGAGNNWAKGH 102

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAEL++SV+DVVRKEAE CDC + F
Sbjct: 103 YTEGAELMESVMDVVRKEAESCDCLQGF 130



 Score = 71.7 bits (168), Expect = 2e-12
 Identities = 32/41 (78%), Positives = 33/41 (80%)
 Frame = +3

Query: 132 IVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQL 254
           IV  Q GQCGNQIGAKFWEVISDEH ID+ G Y GDS LQL
Sbjct: 1   IVLTQIGQCGNQIGAKFWEVISDEHAIDSAGTYHGDSHLQL 41



 Score = 43.2 bits (97), Expect = 8e-04
 Identities = 21/44 (47%), Positives = 24/44 (54%)
 Frame = +1

Query: 511 QGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           QGFQ                   KIREEYPDRI+NTFS++PS K
Sbjct: 128 QGFQLTHSLGGGTGSGMGTLLLSKIREEYPDRIINTFSILPSPK 171


>AL713922-4|CAI16221.1|  435|Homo sapiens novel protein similar to
           beta-tubulin 4Q (TUBB4Q)kinase) II gamma protein.
          Length = 435

 Score =  176 bits (428), Expect = 6e-44
 Identities = 76/88 (86%), Positives = 84/88 (95%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           RINVYYNEASGG+YVPRAV+VDLEPGTMDSVRSGPFGQ+FRPDNF+FGQ GAGNNWAKGH
Sbjct: 46  RINVYYNEASGGRYVPRAVLVDLEPGTMDSVRSGPFGQVFRPDNFIFGQCGAGNNWAKGH 105

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAEL++SV+DVVRKEAE CDC + F
Sbjct: 106 YTEGAELMESVMDVVRKEAESCDCLQGF 133



 Score = 77.8 bits (183), Expect = 3e-14
 Identities = 35/44 (79%), Positives = 36/44 (81%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQL 254
           MREIV  Q GQCGNQIGAKFWEVISDEH ID+ G Y GDS LQL
Sbjct: 1   MREIVLTQIGQCGNQIGAKFWEVISDEHAIDSAGTYHGDSHLQL 44



 Score = 43.2 bits (97), Expect = 8e-04
 Identities = 21/44 (47%), Positives = 24/44 (54%)
 Frame = +1

Query: 511 QGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           QGFQ                   KIREEYPDRI+NTFS++PS K
Sbjct: 131 QGFQLTHSLGGGTGSGMGTLLLSKIREEYPDRIINTFSILPSPK 174


>AF355127-1|AAL32434.1|  444|Homo sapiens beta-tubulin 4Q protein.
          Length = 444

 Score =  176 bits (428), Expect = 6e-44
 Identities = 76/88 (86%), Positives = 84/88 (95%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           RINVYYNEASGG+YVPRAV+VDLEPGTMDSVRSGPFGQ+FRPDNF+FGQ GAGNNWAKGH
Sbjct: 46  RINVYYNEASGGRYVPRAVLVDLEPGTMDSVRSGPFGQVFRPDNFIFGQCGAGNNWAKGH 105

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAEL++SV+DVVRKEAE CDC + F
Sbjct: 106 YTEGAELMESVMDVVRKEAESCDCLQGF 133



 Score = 77.8 bits (183), Expect = 3e-14
 Identities = 35/44 (79%), Positives = 36/44 (81%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQL 254
           MREIV  Q GQCGNQIGAKFWEVISDEH ID+ G Y GDS LQL
Sbjct: 1   MREIVLTQIGQCGNQIGAKFWEVISDEHAIDSAGTYHGDSHLQL 44



 Score = 43.2 bits (97), Expect = 8e-04
 Identities = 21/44 (47%), Positives = 24/44 (54%)
 Frame = +1

Query: 511 QGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           QGFQ                   KIREEYPDRI+NTFS++PS K
Sbjct: 131 QGFQLTHSLGGGTGSGMGTLLLSKIREEYPDRIINTFSILPSPK 174


>AK022340-1|BAB14016.1|  446|Homo sapiens protein ( Homo sapiens
           cDNA FLJ12278 fis, clone MAMMA1001735, highly similar to
           TUBULIN BETA-5 CHAIN. ).
          Length = 446

 Score =  169 bits (412), Expect = 6e-42
 Identities = 75/88 (85%), Positives = 81/88 (92%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           RINVYYNE+S  KYVPRA +VDLEPGTMDSVRSGPFGQ+FRPDNFVFGQ+GAGNNWAKGH
Sbjct: 46  RINVYYNESSSQKYVPRAALVDLEPGTMDSVRSGPFGQLFRPDNFVFGQTGAGNNWAKGH 105

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAELVD+VLDVVRKE E CDC + F
Sbjct: 106 YTEGAELVDAVLDVVRKECEHCDCLQGF 133



 Score = 85.4 bits (202), Expect = 2e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQL 254
           MREIVHIQAGQCGNQIG KFWEVISDEHGID  G Y GDS LQL
Sbjct: 1   MREIVHIQAGQCGNQIGTKFWEVISDEHGIDPAGGYVGDSALQL 44



 Score = 43.6 bits (98), Expect = 6e-04
 Identities = 22/44 (50%), Positives = 24/44 (54%)
 Frame = +1

Query: 511 QGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           QGFQ                   KIREE+PDRIMNTFSV+PS K
Sbjct: 131 QGFQLTHSLGGGTGSGMGTLLISKIREEFPDRIMNTFSVMPSPK 174


>BC002654-1|AAH02654.1|  446|Homo sapiens tubulin, beta 6 protein.
          Length = 446

 Score =  169 bits (411), Expect = 7e-42
 Identities = 74/88 (84%), Positives = 81/88 (92%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           RINVYYNE+S  KYVPRA +VDLEPGTMDSVRSGPFGQ+FRPDNF+FGQ+GAGNNWAKGH
Sbjct: 46  RINVYYNESSSQKYVPRAALVDLEPGTMDSVRSGPFGQLFRPDNFIFGQTGAGNNWAKGH 105

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAELVD+VLDVVRKE E CDC + F
Sbjct: 106 YTEGAELVDAVLDVVRKECEHCDCLQGF 133



 Score = 85.4 bits (202), Expect = 2e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQL 254
           MREIVHIQAGQCGNQIG KFWEVISDEHGID  G Y GDS LQL
Sbjct: 1   MREIVHIQAGQCGNQIGTKFWEVISDEHGIDPAGGYVGDSALQL 44



 Score = 43.6 bits (98), Expect = 6e-04
 Identities = 22/44 (50%), Positives = 24/44 (54%)
 Frame = +1

Query: 511 QGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           QGFQ                   KIREE+PDRIMNTFSV+PS K
Sbjct: 131 QGFQLTHSLGGGTGSGMGTLLISKIREEFPDRIMNTFSVMPSPK 174


>BC111374-1|AAI11375.1|  447|Homo sapiens TUBB6 protein protein.
          Length = 447

 Score =  168 bits (409), Expect = 1e-41
 Identities = 74/88 (84%), Positives = 81/88 (92%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           RI+VYYNE+S  KYVPRA +VDLEPGTMDSVRSGPFGQ+FRPDNF+FGQ+GAGNNWAKGH
Sbjct: 46  RISVYYNESSSKKYVPRAALVDLEPGTMDSVRSGPFGQLFRPDNFIFGQTGAGNNWAKGH 105

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAELVDSVLDVVRKE E CDC + F
Sbjct: 106 YTEGAELVDSVLDVVRKECEHCDCLQGF 133



 Score = 85.4 bits (202), Expect = 2e-16
 Identities = 38/44 (86%), Positives = 38/44 (86%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQL 254
           MREIVHIQAGQCGNQIG KFWEVISDEHGID  G Y GDS LQL
Sbjct: 1   MREIVHIQAGQCGNQIGTKFWEVISDEHGIDQAGGYVGDSALQL 44



 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 23/44 (52%), Positives = 24/44 (54%)
 Frame = +1

Query: 511 QGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           QGFQ                   KIREEYPDRIMNTFSV+PS K
Sbjct: 131 QGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPK 174


>U47634-1|AAC52035.1|  450|Homo sapiens beta-tubulin protein.
          Length = 450

 Score =  167 bits (407), Expect = 2e-41
 Identities = 74/88 (84%), Positives = 80/88 (90%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           RI+VYYNEAS  KYVPRA++VDLEPGTMDSVRSG FG +FRPDNF+FGQSGAGNNWAKGH
Sbjct: 46  RISVYYNEASSHKYVPRAILVDLEPGTMDSVRSGAFGHLFRPDNFIFGQSGAGNNWAKGH 105

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAELVDSVLDVVRKE E CDC + F
Sbjct: 106 YTEGAELVDSVLDVVRKECENCDCLQGF 133



 Score = 89.8 bits (213), Expect = 7e-18
 Identities = 40/44 (90%), Positives = 41/44 (93%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQL 254
           MREIVHIQAGQCGNQIGAKFWEVISDEHGID +G Y GDSDLQL
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPSGNYVGDSDLQL 44



 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 23/44 (52%), Positives = 24/44 (54%)
 Frame = +1

Query: 511 QGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           QGFQ                   K+REEYPDRIMNTFSVVPS K
Sbjct: 131 QGFQLTHSLGGGTGSGMGTLLISKVREEYPDRIMNTFSVVPSPK 174


>BT006971-1|AAP35617.1|  797|Homo sapiens tubulin, beta, 4 protein.
          Length = 797

 Score =  167 bits (407), Expect = 2e-41
 Identities = 74/88 (84%), Positives = 80/88 (90%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           RI+VYYNEAS  KYVPRA++VDLEPGTMDSVRSG FG +FRPDNF+FGQSGAGNNWAKGH
Sbjct: 393 RISVYYNEASSHKYVPRAILVDLEPGTMDSVRSGAFGHLFRPDNFIFGQSGAGNNWAKGH 452

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAELVDSVLDVVRKE E CDC + F
Sbjct: 453 YTEGAELVDSVLDVVRKECENCDCLQGF 480



 Score = 50.0 bits (114), Expect = 7e-06
 Identities = 21/26 (80%), Positives = 23/26 (88%)
 Frame = +3

Query: 177 KFWEVISDEHGIDATGAYSGDSDLQL 254
           +FWEVISDEHGID +G Y GDSDLQL
Sbjct: 366 EFWEVISDEHGIDPSGNYVGDSDLQL 391



 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 23/44 (52%), Positives = 24/44 (54%)
 Frame = +1

Query: 511 QGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           QGFQ                   K+REEYPDRIMNTFSVVPS K
Sbjct: 478 QGFQLTHSLGGGTGSGMGTLLISKVREEYPDRIMNTFSVVPSPK 521


>BC003021-1|AAH03021.2|  450|Homo sapiens tubulin, beta 3 protein.
          Length = 450

 Score =  167 bits (407), Expect = 2e-41
 Identities = 74/88 (84%), Positives = 80/88 (90%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           RI+VYYNEAS  KYVPRA++VDLEPGTMDSVRSG FG +FRPDNF+FGQSGAGNNWAKGH
Sbjct: 46  RISVYYNEASSHKYVPRAILVDLEPGTMDSVRSGAFGHLFRPDNFIFGQSGAGNNWAKGH 105

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAELVDSVLDVVRKE E CDC + F
Sbjct: 106 YTEGAELVDSVLDVVRKECENCDCLQGF 133



 Score = 89.8 bits (213), Expect = 7e-18
 Identities = 40/44 (90%), Positives = 41/44 (93%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQL 254
           MREIVHIQAGQCGNQIGAKFWEVISDEHGID +G Y GDSDLQL
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPSGNYVGDSDLQL 44



 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 23/44 (52%), Positives = 24/44 (54%)
 Frame = +1

Query: 511 QGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           QGFQ                   K+REEYPDRIMNTFSVVPS K
Sbjct: 131 QGFQLTHSLGGGTGSGMGTLLISKVREEYPDRIMNTFSVVPSPK 174


>BC001678-1|AAH01678.2|  406|Homo sapiens TUBB3 protein protein.
          Length = 406

 Score =  167 bits (407), Expect = 2e-41
 Identities = 74/88 (84%), Positives = 80/88 (90%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           RI+VYYNEAS  KYVPRA++VDLEPGTMDSVRSG FG +FRPDNF+FGQSGAGNNWAKGH
Sbjct: 2   RISVYYNEASSHKYVPRAILVDLEPGTMDSVRSGAFGHLFRPDNFIFGQSGAGNNWAKGH 61

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAELVDSVLDVVRKE E CDC + F
Sbjct: 62  YTEGAELVDSVLDVVRKECENCDCLQGF 89



 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 23/44 (52%), Positives = 24/44 (54%)
 Frame = +1

Query: 511 QGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           QGFQ                   K+REEYPDRIMNTFSVVPS K
Sbjct: 87  QGFQLTHSLGGGTGSGMGTLLISKVREEYPDRIMNTFSVVPSPK 130


>BC000748-1|AAH00748.1|  450|Homo sapiens tubulin, beta 3 protein.
          Length = 450

 Score =  167 bits (407), Expect = 2e-41
 Identities = 74/88 (84%), Positives = 80/88 (90%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           RI+VYYNEAS  KYVPRA++VDLEPGTMDSVRSG FG +FRPDNF+FGQSGAGNNWAKGH
Sbjct: 46  RISVYYNEASSHKYVPRAILVDLEPGTMDSVRSGAFGHLFRPDNFIFGQSGAGNNWAKGH 105

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAELVDSVLDVVRKE E CDC + F
Sbjct: 106 YTEGAELVDSVLDVVRKECENCDCLQGF 133



 Score = 89.8 bits (213), Expect = 7e-18
 Identities = 40/44 (90%), Positives = 41/44 (93%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQL 254
           MREIVHIQAGQCGNQIGAKFWEVISDEHGID +G Y GDSDLQL
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPSGNYVGDSDLQL 44



 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 23/44 (52%), Positives = 24/44 (54%)
 Frame = +1

Query: 511 QGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           QGFQ                   K+REEYPDRIMNTFSVVPS K
Sbjct: 131 QGFQLTHSLGGGTGSGMGTLLISKVREEYPDRIMNTFSVVPSPK 174


>AK223039-1|BAD96759.1|  450|Homo sapiens tubulin, beta, 4 variant
           protein.
          Length = 450

 Score =  167 bits (407), Expect = 2e-41
 Identities = 74/88 (84%), Positives = 80/88 (90%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           RI+VYYNEAS  KYVPRA++VDLEPGTMDSVRSG FG +FRPDNF+FGQSGAGNNWAKGH
Sbjct: 46  RISVYYNEASSHKYVPRAILVDLEPGTMDSVRSGAFGHLFRPDNFIFGQSGAGNNWAKGH 105

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAELVDSVLDVVRKE E CDC + F
Sbjct: 106 YTEGAELVDSVLDVVRKECENCDCLQGF 133



 Score = 89.8 bits (213), Expect = 7e-18
 Identities = 40/44 (90%), Positives = 41/44 (93%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQL 254
           MREIVHIQAGQCGNQIGAKFWEVISDEHGID +G Y GDSDLQL
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPSGNYVGDSDLQL 44



 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 23/44 (52%), Positives = 24/44 (54%)
 Frame = +1

Query: 511 QGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           QGFQ                   K+REEYPDRIMNTFSVVPS K
Sbjct: 131 QGFQLTHSLGGGTGSGMGTLLISKVREEYPDRIMNTFSVVPSPK 174


>AF427491-1|AAL28094.1|  450|Homo sapiens class III beta tubulin
           protein.
          Length = 450

 Score =  167 bits (407), Expect = 2e-41
 Identities = 74/88 (84%), Positives = 80/88 (90%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           RI+VYYNEAS  KYVPRA++VDLEPGTMDSVRSG FG +FRPDNF+FGQSGAGNNWAKGH
Sbjct: 46  RISVYYNEASSHKYVPRAILVDLEPGTMDSVRSGAFGHLFRPDNFIFGQSGAGNNWAKGH 105

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAELVDSVLDVVRKE E CDC + F
Sbjct: 106 YTEGAELVDSVLDVVRKECENCDCLQGF 133



 Score = 89.8 bits (213), Expect = 7e-18
 Identities = 40/44 (90%), Positives = 41/44 (93%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQL 254
           MREIVHIQAGQCGNQIGAKFWEVISDEHGID +G Y GDSDLQL
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPSGNYVGDSDLQL 44



 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 23/44 (52%), Positives = 24/44 (54%)
 Frame = +1

Query: 511 QGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           QGFQ                   K+REEYPDRIMNTFSVVPS K
Sbjct: 131 QGFQLTHSLGGGTGSGMGTLLISKVREEYPDRIMNTFSVVPSPK 174


>U83110-1|AAB41497.1|  434|Homo sapiens beta-tubulin protein.
          Length = 434

 Score =  157 bits (380), Expect = 4e-38
 Identities = 68/88 (77%), Positives = 80/88 (90%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           RINV+++EASGG+YVPRAV+VDLEPGTMDSVRSGPF ++FRPDNF+  Q GAGNNWAKG 
Sbjct: 46  RINVHHHEASGGRYVPRAVLVDLEPGTMDSVRSGPFAEVFRPDNFISRQCGAGNNWAKGR 105

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAEL++SV+DVVRKEAE CDC + F
Sbjct: 106 YTEGAELMESVMDVVRKEAESCDCLQGF 133



 Score = 78.2 bits (184), Expect = 2e-14
 Identities = 35/44 (79%), Positives = 36/44 (81%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQL 254
           MREIV  Q GQCGNQIGAKFWEVISDEH ID+ G Y GDS LQL
Sbjct: 1   MREIVLTQTGQCGNQIGAKFWEVISDEHAIDSAGTYHGDSHLQL 44



 Score = 43.2 bits (97), Expect = 8e-04
 Identities = 21/44 (47%), Positives = 24/44 (54%)
 Frame = +1

Query: 511 QGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           QGFQ                   KIREEYPDRI+NTFS++PS K
Sbjct: 131 QGFQLTHSLGGGTGSGMGTLLLSKIREEYPDRIINTFSILPSPK 174


>U83668-1|AAB48456.1|  433|Homo sapiens beta-tubulin protein.
          Length = 433

 Score =  150 bits (363), Expect = 5e-36
 Identities = 67/88 (76%), Positives = 79/88 (89%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           RINV+++EASG +YVPRAV+VDLEPGTMDSVRSGPF ++FRPDNF+  Q GAGNNWAKG 
Sbjct: 46  RINVHHHEASG-RYVPRAVLVDLEPGTMDSVRSGPFAEVFRPDNFISRQCGAGNNWAKGR 104

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAEL++SV+DVVRKEAE CDC + F
Sbjct: 105 YTEGAELMESVMDVVRKEAESCDCLQGF 132



 Score = 78.2 bits (184), Expect = 2e-14
 Identities = 35/44 (79%), Positives = 36/44 (81%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQL 254
           MREIV  Q GQCGNQIGAKFWEVISDEH ID+ G Y GDS LQL
Sbjct: 1   MREIVLTQTGQCGNQIGAKFWEVISDEHAIDSAGTYHGDSHLQL 44



 Score = 43.2 bits (97), Expect = 8e-04
 Identities = 21/44 (47%), Positives = 24/44 (54%)
 Frame = +1

Query: 511 QGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           QGFQ                   KIREEYPDRI+NTFS++PS K
Sbjct: 130 QGFQLTHSLGGGTGSGMGTLLLSKIREEYPDRIINTFSILPSPK 173


>BC033679-1|AAH33679.1|  451|Homo sapiens tubulin, beta 1 protein.
          Length = 451

 Score =  147 bits (357), Expect = 3e-35
 Identities = 64/88 (72%), Positives = 76/88 (86%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           RI+VYYNEA G KYVPRAV+VDLEPGTMDS+RS   G +F+PD+FV G SGAGNNWAKGH
Sbjct: 46  RISVYYNEAYGRKYVPRAVLVDLEPGTMDSIRSSKLGALFQPDSFVHGNSGAGNNWAKGH 105

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAEL+++VL+VVR E+E CDC + F
Sbjct: 106 YTEGAELIENVLEVVRHESESCDCLQGF 133



 Score = 74.1 bits (174), Expect = 4e-13
 Identities = 33/44 (75%), Positives = 36/44 (81%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQL 254
           MREIVHIQ GQCGNQIGAKFWE+I +EHGID  G+  G S LQL
Sbjct: 1   MREIVHIQIGQCGNQIGAKFWEMIGEEHGIDLAGSDRGASALQL 44



 Score = 43.6 bits (98), Expect = 6e-04
 Identities = 22/44 (50%), Positives = 24/44 (54%)
 Frame = +1

Query: 511 QGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           QGFQ                   KIREEYPDRIMN+FSV+PS K
Sbjct: 131 QGFQIVHSLGGGTGSGMGTLLMNKIREEYPDRIMNSFSVMPSPK 174


>AL109840-7|CAC09371.2|  451|Homo sapiens tubulin, beta 1 protein.
          Length = 451

 Score =  147 bits (357), Expect = 3e-35
 Identities = 64/88 (72%), Positives = 76/88 (86%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           RI+VYYNEA G KYVPRAV+VDLEPGTMDS+RS   G +F+PD+FV G SGAGNNWAKGH
Sbjct: 46  RISVYYNEAYGRKYVPRAVLVDLEPGTMDSIRSSKLGALFQPDSFVHGNSGAGNNWAKGH 105

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAEL+++VL+VVR E+E CDC + F
Sbjct: 106 YTEGAELIENVLEVVRHESESCDCLQGF 133



 Score = 74.1 bits (174), Expect = 4e-13
 Identities = 33/44 (75%), Positives = 36/44 (81%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQL 254
           MREIVHIQ GQCGNQIGAKFWE+I +EHGID  G+  G S LQL
Sbjct: 1   MREIVHIQIGQCGNQIGAKFWEMIGEEHGIDLAGSDRGASALQL 44



 Score = 43.6 bits (98), Expect = 6e-04
 Identities = 22/44 (50%), Positives = 24/44 (54%)
 Frame = +1

Query: 511 QGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           QGFQ                   KIREEYPDRIMN+FSV+PS K
Sbjct: 131 QGFQIVHSLGGGTGSGMGTLLMNKIREEYPDRIMNSFSVMPSPK 174


>AJ292757-1|CAC16605.1|  451|Homo sapiens protein ( Homo sapiens
           TUBB1 gene for human beta tubulin 1, class VI. ).
          Length = 451

 Score =  147 bits (357), Expect = 3e-35
 Identities = 64/88 (72%), Positives = 76/88 (86%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 436
           RI+VYYNEA G KYVPRAV+VDLEPGTMDS+RS   G +F+PD+FV G SGAGNNWAKGH
Sbjct: 46  RISVYYNEAYGRKYVPRAVLVDLEPGTMDSIRSSKLGALFQPDSFVHGNSGAGNNWAKGH 105

Query: 437 YTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           YTEGAEL+++VL+VVR E+E CDC + F
Sbjct: 106 YTEGAELIENVLEVVRHESESCDCLQGF 133



 Score = 74.1 bits (174), Expect = 4e-13
 Identities = 33/44 (75%), Positives = 36/44 (81%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQL 254
           MREIVHIQ GQCGNQIGAKFWE+I +EHGID  G+  G S LQL
Sbjct: 1   MREIVHIQIGQCGNQIGAKFWEMIGEEHGIDLAGSDRGASALQL 44



 Score = 43.6 bits (98), Expect = 6e-04
 Identities = 22/44 (50%), Positives = 24/44 (54%)
 Frame = +1

Query: 511 QGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           QGFQ                   KIREEYPDRIMN+FSV+PS K
Sbjct: 131 QGFQIVHSLGGGTGSGMGTLLMNKIREEYPDRIMNSFSVMPSPK 174


>BC047518-1|AAH47518.1|  280|Homo sapiens TUBB3 protein protein.
          Length = 280

 Score =  136 bits (330), Expect = 5e-32
 Identities = 59/70 (84%), Positives = 64/70 (91%)
 Frame = +2

Query: 311 VMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKE 490
           ++VDLEPGTMDSVRSG FG +FRPDNF+FGQSGAGNNWAKGHYTEGAELVDSVLDVVRKE
Sbjct: 1   ILVDLEPGTMDSVRSGAFGHLFRPDNFIFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKE 60

Query: 491 AEGCDCCRVF 520
            E CDC + F
Sbjct: 61  CENCDCLQGF 70



 Score = 46.0 bits (104), Expect = 1e-04
 Identities = 23/44 (52%), Positives = 24/44 (54%)
 Frame = +1

Query: 511 QGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           QGFQ                   K+REEYPDRIMNTFSVVPS K
Sbjct: 68  QGFQLTHSLGGGTGSGMGTLLISKVREEYPDRIMNTFSVVPSPK 111


>BX248307-8|CAM25935.1|  372|Homo sapiens tubulin beta polypeptide
           protein.
          Length = 372

 Score =  128 bits (308), Expect = 2e-29
 Identities = 57/61 (93%), Positives = 58/61 (95%)
 Frame = +2

Query: 338 MDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAEGCDCCRV 517
           MDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAE CDC + 
Sbjct: 1   MDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQG 60

Query: 518 F 520
           F
Sbjct: 61  F 61



 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 24/44 (54%), Positives = 24/44 (54%)
 Frame = +1

Query: 511 QGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           QGFQ                   KIREEYPDRIMNTFSVVPS K
Sbjct: 59  QGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPK 102


>AL845353-25|CAI41894.1|  372|Homo sapiens tubulin, beta polypeptide
           protein.
          Length = 372

 Score =  128 bits (308), Expect = 2e-29
 Identities = 57/61 (93%), Positives = 58/61 (95%)
 Frame = +2

Query: 338 MDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAEGCDCCRV 517
           MDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAE CDC + 
Sbjct: 1   MDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQG 60

Query: 518 F 520
           F
Sbjct: 61  F 61



 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 24/44 (54%), Positives = 24/44 (54%)
 Frame = +1

Query: 511 QGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           QGFQ                   KIREEYPDRIMNTFSVVPS K
Sbjct: 59  QGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPK 102


>AL662848-9|CAI17442.1|  372|Homo sapiens tubulin, beta protein.
          Length = 372

 Score =  128 bits (308), Expect = 2e-29
 Identities = 57/61 (93%), Positives = 58/61 (95%)
 Frame = +2

Query: 338 MDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAEGCDCCRV 517
           MDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAE CDC + 
Sbjct: 1   MDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQG 60

Query: 518 F 520
           F
Sbjct: 61  F 61



 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 24/44 (54%), Positives = 24/44 (54%)
 Frame = +1

Query: 511 QGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           QGFQ                   KIREEYPDRIMNTFSVVPS K
Sbjct: 59  QGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPK 102


>AL662797-13|CAI18197.1|  372|Homo sapiens tubulin, beta protein.
          Length = 372

 Score =  128 bits (308), Expect = 2e-29
 Identities = 57/61 (93%), Positives = 58/61 (95%)
 Frame = +2

Query: 338 MDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAEGCDCCRV 517
           MDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAE CDC + 
Sbjct: 1   MDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQG 60

Query: 518 F 520
           F
Sbjct: 61  F 61



 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 24/44 (54%), Positives = 24/44 (54%)
 Frame = +1

Query: 511 QGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           QGFQ                   KIREEYPDRIMNTFSVVPS K
Sbjct: 59  QGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPK 102


>BC127872-1|AAI27873.2|  188|Homo sapiens TUBB2B protein protein.
          Length = 188

 Score =  126 bits (305), Expect = 5e-29
 Identities = 56/61 (91%), Positives = 58/61 (95%)
 Frame = +2

Query: 338 MDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAEGCDCCRV 517
           MDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKE+E CDC + 
Sbjct: 1   MDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQG 60

Query: 518 F 520
           F
Sbjct: 61  F 61



 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 25/53 (47%), Positives = 26/53 (49%)
 Frame = +1

Query: 484 KRSXXXXXXQGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           K S      QGFQ                   KIREEYPDRIMNTFSV+PS K
Sbjct: 50  KESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPK 102


>AL713922-2|CAI16219.1|  227|Homo sapiens novel protein similar to
           beta-tubulin 4Q (TUBB4Q)kinase) II gamma protein.
          Length = 227

 Score =  121 bits (292), Expect = 2e-27
 Identities = 51/61 (83%), Positives = 57/61 (93%)
 Frame = +2

Query: 338 MDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAEGCDCCRV 517
           MDSVRSGPFGQ+FRPDNF+FGQ GAGNNWAKGHYTEGAEL++SV+DVVRKEAE CDC + 
Sbjct: 1   MDSVRSGPFGQVFRPDNFIFGQCGAGNNWAKGHYTEGAELMESVMDVVRKEAESCDCLQG 60

Query: 518 F 520
           F
Sbjct: 61  F 61



 Score = 43.2 bits (97), Expect = 8e-04
 Identities = 21/44 (47%), Positives = 24/44 (54%)
 Frame = +1

Query: 511 QGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           QGFQ                   KIREEYPDRI+NTFS++PS K
Sbjct: 59  QGFQLTHSLGGGTGSGMGTLLLSKIREEYPDRIINTFSILPSPK 102


>X01703-1|CAA25855.1|  451|Homo sapiens alpha-tubulin protein.
          Length = 451

 Score = 97.1 bits (231), Expect = 5e-20
 Identities = 40/80 (50%), Positives = 57/80 (71%)
 Frame = +2

Query: 263 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYT 442
           N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GHYT
Sbjct: 50  NTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYT 109

Query: 443 EGAELVDSVLDVVRKEAEGC 502
            G E++D VLD +RK A+ C
Sbjct: 110 IGKEIIDLVLDRIRKLADQC 129



 Score = 38.7 bits (86), Expect = 0.018
 Identities = 18/42 (42%), Positives = 21/42 (50%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 248
           MRE + I  GQ G QIG   WE+   EHGI   G    D  +
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI 42


>K00558-1|AAA91576.1|  451|Homo sapiens protein ( human
           alpha-tubulin mRNA, complete cds. ).
          Length = 451

 Score = 97.1 bits (231), Expect = 5e-20
 Identities = 40/80 (50%), Positives = 57/80 (71%)
 Frame = +2

Query: 263 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYT 442
           N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GHYT
Sbjct: 50  NTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYT 109

Query: 443 EGAELVDSVLDVVRKEAEGC 502
            G E++D VLD +RK A+ C
Sbjct: 110 IGKEIIDLVLDRIRKLADQC 129



 Score = 38.7 bits (86), Expect = 0.018
 Identities = 18/42 (42%), Positives = 21/42 (50%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 248
           MRE + I  GQ G QIG   WE+   EHGI   G    D  +
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI 42


>DQ400107-1|ABD60581.1|  451|Homo sapiens alpha tubulin protein.
          Length = 451

 Score = 97.1 bits (231), Expect = 5e-20
 Identities = 40/80 (50%), Positives = 57/80 (71%)
 Frame = +2

Query: 263 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYT 442
           N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GHYT
Sbjct: 50  NTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYT 109

Query: 443 EGAELVDSVLDVVRKEAEGC 502
            G E++D VLD +RK A+ C
Sbjct: 110 IGKEIIDLVLDRIRKLADQC 129



 Score = 38.7 bits (86), Expect = 0.018
 Identities = 18/42 (42%), Positives = 21/42 (50%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 248
           MRE + I  GQ G QIG   WE+   EHGI   G    D  +
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI 42


>BC071904-1|AAH71904.1|  451|Homo sapiens tubulin, alpha 1b protein.
          Length = 451

 Score = 97.1 bits (231), Expect = 5e-20
 Identities = 40/80 (50%), Positives = 57/80 (71%)
 Frame = +2

Query: 263 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYT 442
           N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GHYT
Sbjct: 50  NTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYT 109

Query: 443 EGAELVDSVLDVVRKEAEGC 502
            G E++D VLD +RK A+ C
Sbjct: 110 IGKEIIDLVLDRIRKLADQC 129



 Score = 38.7 bits (86), Expect = 0.018
 Identities = 18/42 (42%), Positives = 21/42 (50%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 248
           MRE + I  GQ G QIG   WE+   EHGI   G    D  +
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI 42


>BC063036-1|AAH63036.1|  449|Homo sapiens tubulin, alpha 1c protein.
          Length = 449

 Score = 97.1 bits (231), Expect = 5e-20
 Identities = 40/80 (50%), Positives = 57/80 (71%)
 Frame = +2

Query: 263 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYT 442
           N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GHYT
Sbjct: 50  NTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYT 109

Query: 443 EGAELVDSVLDVVRKEAEGC 502
            G E++D VLD +RK A+ C
Sbjct: 110 IGKEIIDLVLDRIRKLADQC 129



 Score = 38.7 bits (86), Expect = 0.018
 Identities = 18/42 (42%), Positives = 21/42 (50%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 248
           MRE + I  GQ G QIG   WE+   EHGI   G    D  +
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI 42


>BC051297-1|AAH51297.1|  449|Homo sapiens tubulin, alpha 1c protein.
          Length = 449

 Score = 97.1 bits (231), Expect = 5e-20
 Identities = 40/80 (50%), Positives = 57/80 (71%)
 Frame = +2

Query: 263 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYT 442
           N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GHYT
Sbjct: 50  NTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYT 109

Query: 443 EGAELVDSVLDVVRKEAEGC 502
            G E++D VLD +RK A+ C
Sbjct: 110 IGKEIIDLVLDRIRKLADQC 129



 Score = 38.7 bits (86), Expect = 0.018
 Identities = 18/42 (42%), Positives = 21/42 (50%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 248
           MRE + I  GQ G QIG   WE+   EHGI   G    D  +
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI 42


>BC050637-1|AAH50637.1|  451|Homo sapiens tubulin, alpha 1a protein.
          Length = 451

 Score = 97.1 bits (231), Expect = 5e-20
 Identities = 40/80 (50%), Positives = 57/80 (71%)
 Frame = +2

Query: 263 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYT 442
           N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GHYT
Sbjct: 50  NTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYT 109

Query: 443 EGAELVDSVLDVVRKEAEGC 502
            G E++D VLD +RK A+ C
Sbjct: 110 IGKEIIDLVLDRIRKLADQC 129



 Score = 38.7 bits (86), Expect = 0.018
 Identities = 18/42 (42%), Positives = 21/42 (50%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 248
           MRE + I  GQ G QIG   WE+   EHGI   G    D  +
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI 42


>BC030820-1|AAH30820.1|  451|Homo sapiens tubulin, alpha 1b protein.
          Length = 451

 Score = 97.1 bits (231), Expect = 5e-20
 Identities = 40/80 (50%), Positives = 57/80 (71%)
 Frame = +2

Query: 263 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYT 442
           N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GHYT
Sbjct: 50  NTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYT 109

Query: 443 EGAELVDSVLDVVRKEAEGC 502
            G E++D VLD +RK A+ C
Sbjct: 110 IGKEIIDLVLDRIRKLADQC 129



 Score = 38.7 bits (86), Expect = 0.018
 Identities = 18/42 (42%), Positives = 21/42 (50%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 248
           MRE + I  GQ G QIG   WE+   EHGI   G    D  +
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI 42


>BC021088-1|AAH21088.1|  449|Homo sapiens tubulin, alpha 1c protein.
          Length = 449

 Score = 97.1 bits (231), Expect = 5e-20
 Identities = 40/80 (50%), Positives = 57/80 (71%)
 Frame = +2

Query: 263 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYT 442
           N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GHYT
Sbjct: 50  NTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYT 109

Query: 443 EGAELVDSVLDVVRKEAEGC 502
            G E++D VLD +RK A+ C
Sbjct: 110 IGKEIIDLVLDRIRKLADQC 129



 Score = 38.7 bits (86), Expect = 0.018
 Identities = 18/42 (42%), Positives = 21/42 (50%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 248
           MRE + I  GQ G QIG   WE+   EHGI   G    D  +
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI 42


>BC019298-1|AAH19298.1|  449|Homo sapiens tubulin, alpha 1c protein.
          Length = 449

 Score = 97.1 bits (231), Expect = 5e-20
 Identities = 40/80 (50%), Positives = 57/80 (71%)
 Frame = +2

Query: 263 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYT 442
           N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GHYT
Sbjct: 50  NTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYT 109

Query: 443 EGAELVDSVLDVVRKEAEGC 502
            G E++D VLD +RK A+ C
Sbjct: 110 IGKEIIDLVLDRIRKLADQC 129



 Score = 38.7 bits (86), Expect = 0.018
 Identities = 18/42 (42%), Positives = 21/42 (50%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 248
           MRE + I  GQ G QIG   WE+   EHGI   G    D  +
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI 42


>BC017004-1|AAH17004.1|  451|Homo sapiens tubulin, alpha 1b protein.
          Length = 451

 Score = 97.1 bits (231), Expect = 5e-20
 Identities = 40/80 (50%), Positives = 57/80 (71%)
 Frame = +2

Query: 263 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYT 442
           N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GHYT
Sbjct: 50  NTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYT 109

Query: 443 EGAELVDSVLDVVRKEAEGC 502
            G E++D VLD +RK A+ C
Sbjct: 110 IGKEIIDLVLDRIRKLADQC 129



 Score = 38.7 bits (86), Expect = 0.018
 Identities = 18/42 (42%), Positives = 21/42 (50%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 248
           MRE + I  GQ G QIG   WE+   EHGI   G    D  +
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI 42


>BC015883-1|AAH15883.1|  451|Homo sapiens tubulin, alpha 1b protein.
          Length = 451

 Score = 97.1 bits (231), Expect = 5e-20
 Identities = 40/80 (50%), Positives = 57/80 (71%)
 Frame = +2

Query: 263 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYT 442
           N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GHYT
Sbjct: 50  NTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYT 109

Query: 443 EGAELVDSVLDVVRKEAEGC 502
            G E++D VLD +RK A+ C
Sbjct: 110 IGKEIIDLVLDRIRKLADQC 129



 Score = 38.7 bits (86), Expect = 0.018
 Identities = 18/42 (42%), Positives = 21/42 (50%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 248
           MRE + I  GQ G QIG   WE+   EHGI   G    D  +
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI 42


>BC011790-1|AAH11790.1|  449|Homo sapiens tubulin, alpha 1c protein.
          Length = 449

 Score = 97.1 bits (231), Expect = 5e-20
 Identities = 40/80 (50%), Positives = 57/80 (71%)
 Frame = +2

Query: 263 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYT 442
           N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GHYT
Sbjct: 50  NTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYT 109

Query: 443 EGAELVDSVLDVVRKEAEGC 502
            G E++D VLD +RK A+ C
Sbjct: 110 IGKEIIDLVLDRIRKLADQC 129



 Score = 38.7 bits (86), Expect = 0.018
 Identities = 18/42 (42%), Positives = 21/42 (50%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 248
           MRE + I  GQ G QIG   WE+   EHGI   G    D  +
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI 42


>BC011572-1|AAH11572.1|  451|Homo sapiens tubulin, alpha 1b protein.
          Length = 451

 Score = 97.1 bits (231), Expect = 5e-20
 Identities = 40/80 (50%), Positives = 57/80 (71%)
 Frame = +2

Query: 263 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYT 442
           N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GHYT
Sbjct: 50  NTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYT 109

Query: 443 EGAELVDSVLDVVRKEAEGC 502
            G E++D VLD +RK A+ C
Sbjct: 110 IGKEIIDLVLDRIRKLADQC 129



 Score = 38.7 bits (86), Expect = 0.018
 Identities = 18/42 (42%), Positives = 21/42 (50%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 248
           MRE + I  GQ G QIG   WE+   EHGI   G    D  +
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI 42


>BC010494-1|AAH10494.1|  451|Homo sapiens tubulin, alpha 1b protein.
          Length = 451

 Score = 97.1 bits (231), Expect = 5e-20
 Identities = 40/80 (50%), Positives = 57/80 (71%)
 Frame = +2

Query: 263 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYT 442
           N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GHYT
Sbjct: 50  NTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYT 109

Query: 443 EGAELVDSVLDVVRKEAEGC 502
            G E++D VLD +RK A+ C
Sbjct: 110 IGKEIIDLVLDRIRKLADQC 129



 Score = 38.7 bits (86), Expect = 0.018
 Identities = 18/42 (42%), Positives = 21/42 (50%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 248
           MRE + I  GQ G QIG   WE+   EHGI   G    D  +
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI 42


>BC009513-1|AAH09513.1|  451|Homo sapiens tubulin, alpha 1b protein.
          Length = 451

 Score = 97.1 bits (231), Expect = 5e-20
 Identities = 40/80 (50%), Positives = 57/80 (71%)
 Frame = +2

Query: 263 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYT 442
           N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GHYT
Sbjct: 50  NTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYT 109

Query: 443 EGAELVDSVLDVVRKEAEGC 502
            G E++D VLD +RK A+ C
Sbjct: 110 IGKEIIDLVLDRIRKLADQC 129



 Score = 38.7 bits (86), Expect = 0.018
 Identities = 18/42 (42%), Positives = 21/42 (50%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 248
           MRE + I  GQ G QIG   WE+   EHGI   G    D  +
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI 42


>BC009512-1|AAH09512.1|  451|Homo sapiens tubulin, alpha 1b protein.
          Length = 451

 Score = 97.1 bits (231), Expect = 5e-20
 Identities = 40/80 (50%), Positives = 57/80 (71%)
 Frame = +2

Query: 263 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYT 442
           N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GHYT
Sbjct: 50  NTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYT 109

Query: 443 EGAELVDSVLDVVRKEAEGC 502
            G E++D VLD +RK A+ C
Sbjct: 110 IGKEIIDLVLDRIRKLADQC 129



 Score = 38.7 bits (86), Expect = 0.018
 Identities = 18/42 (42%), Positives = 21/42 (50%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 248
           MRE + I  GQ G QIG   WE+   EHGI   G    D  +
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI 42


>BC009509-1|AAH09509.1|  451|Homo sapiens tubulin, alpha 1b protein.
          Length = 451

 Score = 97.1 bits (231), Expect = 5e-20
 Identities = 40/80 (50%), Positives = 57/80 (71%)
 Frame = +2

Query: 263 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYT 442
           N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GHYT
Sbjct: 50  NTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYT 109

Query: 443 EGAELVDSVLDVVRKEAEGC 502
            G E++D VLD +RK A+ C
Sbjct: 110 IGKEIIDLVLDRIRKLADQC 129



 Score = 38.7 bits (86), Expect = 0.018
 Identities = 18/42 (42%), Positives = 21/42 (50%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 248
           MRE + I  GQ G QIG   WE+   EHGI   G    D  +
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI 42


>BC009314-1|AAH09314.1|  451|Homo sapiens tubulin, alpha 1b protein.
          Length = 451

 Score = 97.1 bits (231), Expect = 5e-20
 Identities = 40/80 (50%), Positives = 57/80 (71%)
 Frame = +2

Query: 263 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYT 442
           N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GHYT
Sbjct: 50  NTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYT 109

Query: 443 EGAELVDSVLDVVRKEAEGC 502
            G E++D VLD +RK A+ C
Sbjct: 110 IGKEIIDLVLDRIRKLADQC 129



 Score = 38.7 bits (86), Expect = 0.018
 Identities = 18/42 (42%), Positives = 21/42 (50%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 248
           MRE + I  GQ G QIG   WE+   EHGI   G    D  +
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI 42


>BC008659-1|AAH08659.1|  451|Homo sapiens tubulin, alpha 1b protein.
          Length = 451

 Score = 97.1 bits (231), Expect = 5e-20
 Identities = 40/80 (50%), Positives = 57/80 (71%)
 Frame = +2

Query: 263 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYT 442
           N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GHYT
Sbjct: 50  NTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYT 109

Query: 443 EGAELVDSVLDVVRKEAEGC 502
            G E++D VLD +RK A+ C
Sbjct: 110 IGKEIIDLVLDRIRKLADQC 129



 Score = 38.7 bits (86), Expect = 0.018
 Identities = 18/42 (42%), Positives = 21/42 (50%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 248
           MRE + I  GQ G QIG   WE+   EHGI   G    D  +
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI 42


>BC006481-1|AAH06481.1|  451|Homo sapiens tubulin, alpha 1b protein.
          Length = 451

 Score = 97.1 bits (231), Expect = 5e-20
 Identities = 40/80 (50%), Positives = 57/80 (71%)
 Frame = +2

Query: 263 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYT 442
           N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GHYT
Sbjct: 50  NTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYT 109

Query: 443 EGAELVDSVLDVVRKEAEGC 502
            G E++D VLD +RK A+ C
Sbjct: 110 IGKEIIDLVLDRIRKLADQC 129



 Score = 38.7 bits (86), Expect = 0.018
 Identities = 18/42 (42%), Positives = 21/42 (50%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 248
           MRE + I  GQ G QIG   WE+   EHGI   G    D  +
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI 42


>BC006468-1|AAH06468.1|  451|Homo sapiens tubulin, alpha 1a protein.
          Length = 451

 Score = 97.1 bits (231), Expect = 5e-20
 Identities = 40/80 (50%), Positives = 57/80 (71%)
 Frame = +2

Query: 263 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYT 442
           N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GHYT
Sbjct: 50  NTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYT 109

Query: 443 EGAELVDSVLDVVRKEAEGC 502
            G E++D VLD +RK A+ C
Sbjct: 110 IGKEIIDLVLDRIRKLADQC 129



 Score = 38.7 bits (86), Expect = 0.018
 Identities = 18/42 (42%), Positives = 21/42 (50%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 248
           MRE + I  GQ G QIG   WE+   EHGI   G    D  +
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI 42


>BC006379-1|AAH06379.1|  451|Homo sapiens tubulin, alpha 1b protein.
          Length = 451

 Score = 97.1 bits (231), Expect = 5e-20
 Identities = 40/80 (50%), Positives = 57/80 (71%)
 Frame = +2

Query: 263 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYT 442
           N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GHYT
Sbjct: 50  NTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYT 109

Query: 443 EGAELVDSVLDVVRKEAEGC 502
            G E++D VLD +RK A+ C
Sbjct: 110 IGKEIIDLVLDRIRKLADQC 129



 Score = 38.7 bits (86), Expect = 0.018
 Identities = 18/42 (42%), Positives = 21/42 (50%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 248
           MRE + I  GQ G QIG   WE+   EHGI   G    D  +
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI 42


>BC005946-1|AAH05946.1|  449|Homo sapiens tubulin, alpha 1c protein.
          Length = 449

 Score = 97.1 bits (231), Expect = 5e-20
 Identities = 40/80 (50%), Positives = 57/80 (71%)
 Frame = +2

Query: 263 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYT 442
           N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GHYT
Sbjct: 50  NTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYT 109

Query: 443 EGAELVDSVLDVVRKEAEGC 502
            G E++D VLD +RK A+ C
Sbjct: 110 IGKEIIDLVLDRIRKLADQC 129



 Score = 38.7 bits (86), Expect = 0.018
 Identities = 18/42 (42%), Positives = 21/42 (50%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 248
           MRE + I  GQ G QIG   WE+   EHGI   G    D  +
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI 42


>BC004949-1|AAH04949.1|  449|Homo sapiens tubulin, alpha 1c protein.
          Length = 449

 Score = 97.1 bits (231), Expect = 5e-20
 Identities = 40/80 (50%), Positives = 57/80 (71%)
 Frame = +2

Query: 263 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYT 442
           N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GHYT
Sbjct: 50  NTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYT 109

Query: 443 EGAELVDSVLDVVRKEAEGC 502
            G E++D VLD +RK A+ C
Sbjct: 110 IGKEIIDLVLDRIRKLADQC 129



 Score = 38.7 bits (86), Expect = 0.018
 Identities = 18/42 (42%), Positives = 21/42 (50%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 248
           MRE + I  GQ G QIG   WE+   EHGI   G    D  +
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI 42


>BC001128-1|AAH01128.1|  451|Homo sapiens tubulin, alpha 1b protein.
          Length = 451

 Score = 97.1 bits (231), Expect = 5e-20
 Identities = 40/80 (50%), Positives = 57/80 (71%)
 Frame = +2

Query: 263 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYT 442
           N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GHYT
Sbjct: 50  NTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYT 109

Query: 443 EGAELVDSVLDVVRKEAEGC 502
            G E++D VLD +RK A+ C
Sbjct: 110 IGKEIIDLVLDRIRKLADQC 129



 Score = 38.7 bits (86), Expect = 0.018
 Identities = 18/42 (42%), Positives = 21/42 (50%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 248
           MRE + I  GQ G QIG   WE+   EHGI   G    D  +
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI 42


>BC000696-1|AAH00696.1|  451|Homo sapiens tubulin, alpha 1b protein.
          Length = 451

 Score = 97.1 bits (231), Expect = 5e-20
 Identities = 40/80 (50%), Positives = 57/80 (71%)
 Frame = +2

Query: 263 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYT 442
           N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GHYT
Sbjct: 50  NTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYT 109

Query: 443 EGAELVDSVLDVVRKEAEGC 502
            G E++D VLD +RK A+ C
Sbjct: 110 IGKEIIDLVLDRIRKLADQC 129



 Score = 38.7 bits (86), Expect = 0.018
 Identities = 18/42 (42%), Positives = 21/42 (50%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 248
           MRE + I  GQ G QIG   WE+   EHGI   G    D  +
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI 42


>AK223024-1|BAD96744.1|  449|Homo sapiens tubulin alpha 6 variant
           protein.
          Length = 449

 Score = 97.1 bits (231), Expect = 5e-20
 Identities = 40/80 (50%), Positives = 57/80 (71%)
 Frame = +2

Query: 263 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYT 442
           N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GHYT
Sbjct: 50  NTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYT 109

Query: 443 EGAELVDSVLDVVRKEAEGC 502
            G E++D VLD +RK A+ C
Sbjct: 110 IGKEIIDLVLDRIRKLADQC 129



 Score = 38.7 bits (86), Expect = 0.018
 Identities = 18/42 (42%), Positives = 21/42 (50%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 248
           MRE + I  GQ G QIG   WE+   EHGI   G    D  +
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI 42


>AF141347-1|AAD33871.1|  451|Homo sapiens alpha-tubulin protein.
          Length = 451

 Score = 97.1 bits (231), Expect = 5e-20
 Identities = 40/80 (50%), Positives = 57/80 (71%)
 Frame = +2

Query: 263 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYT 442
           N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GHYT
Sbjct: 50  NTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYT 109

Query: 443 EGAELVDSVLDVVRKEAEGC 502
            G E++D VLD +RK A+ C
Sbjct: 110 IGKEIIDLVLDRIRKLADQC 129



 Score = 38.7 bits (86), Expect = 0.018
 Identities = 18/42 (42%), Positives = 21/42 (50%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 248
           MRE + I  GQ G QIG   WE+   EHGI   G    D  +
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI 42


>AF081484-1|AAC31959.1|  451|Homo sapiens alpha-tubulin isoform 1
           protein.
          Length = 451

 Score = 97.1 bits (231), Expect = 5e-20
 Identities = 40/80 (50%), Positives = 57/80 (71%)
 Frame = +2

Query: 263 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYT 442
           N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GHYT
Sbjct: 50  NTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYT 109

Query: 443 EGAELVDSVLDVVRKEAEGC 502
            G E++D VLD +RK A+ C
Sbjct: 110 IGKEIIDLVLDRIRKLADQC 129



 Score = 38.7 bits (86), Expect = 0.018
 Identities = 18/42 (42%), Positives = 21/42 (50%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 248
           MRE + I  GQ G QIG   WE+   EHGI   G    D  +
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI 42


>DQ422808-1|ABD72607.1|  450|Homo sapiens tubulin, alpha 2 protein.
          Length = 450

 Score = 96.7 bits (230), Expect = 6e-20
 Identities = 41/80 (51%), Positives = 57/80 (71%)
 Frame = +2

Query: 263 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYT 442
           N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GHYT
Sbjct: 50  NTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYT 109

Query: 443 EGAELVDSVLDVVRKEAEGC 502
            G E+VD VLD +RK A+ C
Sbjct: 110 IGKEIVDLVLDRIRKLADLC 129



 Score = 38.7 bits (86), Expect = 0.018
 Identities = 18/42 (42%), Positives = 21/42 (50%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 248
           MRE + I  GQ G QIG   WE+   EHGI   G    D  +
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI 42


>BC057810-1|AAH57810.1|  450|Homo sapiens tubulin, alpha 3d protein.
          Length = 450

 Score = 96.7 bits (230), Expect = 6e-20
 Identities = 41/80 (51%), Positives = 57/80 (71%)
 Frame = +2

Query: 263 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYT 442
           N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GHYT
Sbjct: 50  NTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYT 109

Query: 443 EGAELVDSVLDVVRKEAEGC 502
            G E+VD VLD +RK A+ C
Sbjct: 110 IGKEIVDLVLDRIRKLADLC 129



 Score = 38.7 bits (86), Expect = 0.018
 Identities = 18/42 (42%), Positives = 21/42 (50%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 248
           MRE + I  GQ G QIG   WE+   EHGI   G    D  +
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI 42


>BC011721-1|AAH11721.1|  418|Homo sapiens tubulin, alpha 3c protein.
          Length = 418

 Score = 96.7 bits (230), Expect = 6e-20
 Identities = 41/80 (51%), Positives = 57/80 (71%)
 Frame = +2

Query: 263 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYT 442
           N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GHYT
Sbjct: 50  NTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYT 109

Query: 443 EGAELVDSVLDVVRKEAEGC 502
            G E+VD VLD +RK A+ C
Sbjct: 110 IGKEIVDLVLDRIRKLADLC 129



 Score = 38.7 bits (86), Expect = 0.018
 Identities = 18/42 (42%), Positives = 21/42 (50%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 248
           MRE + I  GQ G QIG   WE+   EHGI   G    D  +
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI 42


>AL139327-3|CAH73534.1|  450|Homo sapiens tubulin, alpha 3c protein.
          Length = 450

 Score = 96.7 bits (230), Expect = 6e-20
 Identities = 41/80 (51%), Positives = 57/80 (71%)
 Frame = +2

Query: 263 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYT 442
           N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GHYT
Sbjct: 50  NTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYT 109

Query: 443 EGAELVDSVLDVVRKEAEGC 502
            G E+VD VLD +RK A+ C
Sbjct: 110 IGKEIVDLVLDRIRKLADLC 129



 Score = 38.7 bits (86), Expect = 0.018
 Identities = 18/42 (42%), Positives = 21/42 (50%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 248
           MRE + I  GQ G QIG   WE+   EHGI   G    D  +
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI 42


>AF005392-1|AAC39578.1|  449|Homo sapiens alpha tubulin protein.
          Length = 449

 Score = 96.7 bits (230), Expect = 6e-20
 Identities = 41/80 (51%), Positives = 57/80 (71%)
 Frame = +2

Query: 263 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYT 442
           N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GHYT
Sbjct: 49  NTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYT 108

Query: 443 EGAELVDSVLDVVRKEAEGC 502
            G E+VD VLD +RK A+ C
Sbjct: 109 IGKEIVDLVLDRIRKLADLC 128



 Score = 36.7 bits (81), Expect = 0.071
 Identities = 17/41 (41%), Positives = 20/41 (48%)
 Frame = +3

Query: 126 REIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 248
           RE + I  GQ G QIG   WE+   EHGI   G    D  +
Sbjct: 1   RECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI 41


>X06956-1|CAA30026.1|  447|Homo sapiens alpha-tubulin protein.
          Length = 447

 Score = 95.1 bits (226), Expect = 2e-19
 Identities = 38/78 (48%), Positives = 56/78 (71%)
 Frame = +2

Query: 269 YYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEG 448
           ++ E   GK+VPRAV VDLEP  +D +R+GP+ Q+F P+  + G+  A NN+A+GHYT G
Sbjct: 51  FFCETGAGKHVPRAVFVDLEPTVIDEIRNGPYRQLFHPEQLITGKEDAANNYARGHYTIG 110

Query: 449 AELVDSVLDVVRKEAEGC 502
            E++D VLD +RK ++ C
Sbjct: 111 KEIIDPVLDRIRKLSDQC 128



 Score = 35.1 bits (77), Expect = 0.22
 Identities = 15/41 (36%), Positives = 20/41 (48%)
 Frame = +3

Query: 126 REIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 248
           RE + +  GQ G Q+G   WE+   EHGI   G    D  +
Sbjct: 1   RECISVHVGQAGVQMGNACWELYCLEHGIQPDGQMPSDKTI 41


>BT006731-1|AAP35377.1|  448|Homo sapiens tubulin, alpha 1 (testis
           specific) protein.
          Length = 448

 Score = 95.1 bits (226), Expect = 2e-19
 Identities = 38/78 (48%), Positives = 56/78 (71%)
 Frame = +2

Query: 269 YYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEG 448
           ++ E   GK+VPRAV VDLEP  +D +R+GP+ Q+F P+  + G+  A NN+A+GHYT G
Sbjct: 52  FFCETGAGKHVPRAVFVDLEPTVIDEIRNGPYRQLFHPEQLITGKEDAANNYARGHYTIG 111

Query: 449 AELVDSVLDVVRKEAEGC 502
            E++D VLD +RK ++ C
Sbjct: 112 KEIIDPVLDRIRKLSDQC 129



 Score = 37.1 bits (82), Expect = 0.054
 Identities = 16/42 (38%), Positives = 21/42 (50%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 248
           MRE + +  GQ G Q+G   WE+   EHGI   G    D  +
Sbjct: 1   MRECISVHVGQAGVQMGNACWELYCLEHGIQPDGQMPSDKTI 42


>BC009238-1|AAH09238.1|  448|Homo sapiens tubulin, alpha 4a protein.
          Length = 448

 Score = 95.1 bits (226), Expect = 2e-19
 Identities = 38/78 (48%), Positives = 56/78 (71%)
 Frame = +2

Query: 269 YYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEG 448
           ++ E   GK+VPRAV VDLEP  +D +R+GP+ Q+F P+  + G+  A NN+A+GHYT G
Sbjct: 52  FFCETGAGKHVPRAVFVDLEPTVIDEIRNGPYRQLFHPEQLITGKEDAANNYARGHYTIG 111

Query: 449 AELVDSVLDVVRKEAEGC 502
            E++D VLD +RK ++ C
Sbjct: 112 KEIIDPVLDRIRKLSDQC 129



 Score = 37.1 bits (82), Expect = 0.054
 Identities = 16/42 (38%), Positives = 21/42 (50%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 248
           MRE + +  GQ G Q+G   WE+   EHGI   G    D  +
Sbjct: 1   MRECISVHVGQAGVQMGNACWELYCLEHGIQPDGQMPSDKTI 42


>AY895018-1|AAW65371.1|  448|Homo sapiens tubulin, alpha 1 (testis
           specific) protein.
          Length = 448

 Score = 95.1 bits (226), Expect = 2e-19
 Identities = 38/78 (48%), Positives = 56/78 (71%)
 Frame = +2

Query: 269 YYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEG 448
           ++ E   GK+VPRAV VDLEP  +D +R+GP+ Q+F P+  + G+  A NN+A+GHYT G
Sbjct: 52  FFCETGAGKHVPRAVFVDLEPTVIDEIRNGPYRQLFHPEQLITGKEDAANNYARGHYTIG 111

Query: 449 AELVDSVLDVVRKEAEGC 502
            E++D VLD +RK ++ C
Sbjct: 112 KEIIDPVLDRIRKLSDQC 129



 Score = 37.1 bits (82), Expect = 0.054
 Identities = 16/42 (38%), Positives = 21/42 (50%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 248
           MRE + +  GQ G Q+G   WE+   EHGI   G    D  +
Sbjct: 1   MRECISVHVGQAGVQMGNACWELYCLEHGIQPDGQMPSDKTI 42


>BC057811-1|AAH57811.1|  450|Homo sapiens tubulin, alpha 3e protein.
          Length = 450

 Score = 94.7 bits (225), Expect = 3e-19
 Identities = 40/80 (50%), Positives = 57/80 (71%)
 Frame = +2

Query: 263 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYT 442
           N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A +N+A+GHYT
Sbjct: 50  NTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAASNYARGHYT 109

Query: 443 EGAELVDSVLDVVRKEAEGC 502
            G E+VD VLD +RK A+ C
Sbjct: 110 IGKEIVDLVLDRIRKLADLC 129



 Score = 38.7 bits (86), Expect = 0.018
 Identities = 18/42 (42%), Positives = 21/42 (50%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 248
           MRE + I  GQ G QIG   WE+   EHGI   G    D  +
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI 42


>CR456600-1|CAG30486.1|  449|Homo sapiens TUBA8 protein.
          Length = 449

 Score = 94.3 bits (224), Expect = 3e-19
 Identities = 38/78 (48%), Positives = 55/78 (70%)
 Frame = +2

Query: 269 YYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEG 448
           +++E   GK+VPRAVM+DLEP  +D VR+G + Q+F P+  + G+  A NN+A+GHYT G
Sbjct: 52  FFSETGNGKHVPRAVMIDLEPTVVDEVRAGTYRQLFHPEQLITGKEDAANNYARGHYTVG 111

Query: 449 AELVDSVLDVVRKEAEGC 502
            E +D VLD +RK  + C
Sbjct: 112 KESIDLVLDRIRKLTDAC 129



 Score = 40.7 bits (91), Expect = 0.004
 Identities = 17/40 (42%), Positives = 22/40 (55%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDS 242
           MRE + +  GQ G QIG   WE+   EHGI A G +   +
Sbjct: 1   MRECISVHVGQAGVQIGNACWELFCLEHGIQADGTFDAQA 40


>BX537702-1|CAD97815.1|  479|Homo sapiens hypothetical protein
           protein.
          Length = 479

 Score = 94.3 bits (224), Expect = 3e-19
 Identities = 38/78 (48%), Positives = 55/78 (70%)
 Frame = +2

Query: 269 YYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEG 448
           +++E   GK+VPRAVM+DLEP  +D VR+G + Q+F P+  + G+  A NN+A+GHYT G
Sbjct: 51  FFSETGNGKHVPRAVMIDLEPTVVDEVRAGTYRQLFHPEQLITGKEDAANNYARGHYTVG 110

Query: 449 AELVDSVLDVVRKEAEGC 502
            E +D VLD +RK  + C
Sbjct: 111 KESIDLVLDRIRKLTDAC 128



 Score = 38.7 bits (86), Expect = 0.018
 Identities = 16/39 (41%), Positives = 21/39 (53%)
 Frame = +3

Query: 126 REIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDS 242
           RE + +  GQ G QIG   WE+   EHGI A G +   +
Sbjct: 1   RECISVHVGQAGVQIGNACWELFCLEHGIQADGTFDAQA 39


>BC104845-1|AAI04846.1|  449|Homo sapiens tubulin, alpha 8 protein.
          Length = 449

 Score = 94.3 bits (224), Expect = 3e-19
 Identities = 38/78 (48%), Positives = 55/78 (70%)
 Frame = +2

Query: 269 YYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEG 448
           +++E   GK+VPRAVM+DLEP  +D VR+G + Q+F P+  + G+  A NN+A+GHYT G
Sbjct: 52  FFSETGNGKHVPRAVMIDLEPTVVDEVRAGTYRQLFHPEQLITGKEDAANNYARGHYTVG 111

Query: 449 AELVDSVLDVVRKEAEGC 502
            E +D VLD +RK  + C
Sbjct: 112 KESIDLVLDRIRKLTDAC 129



 Score = 40.7 bits (91), Expect = 0.004
 Identities = 17/40 (42%), Positives = 22/40 (55%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDS 242
           MRE + +  GQ G QIG   WE+   EHGI A G +   +
Sbjct: 1   MRECISVHVGQAGVQIGNACWELFCLEHGIQADGTFDAQA 40


>BC074827-1|AAH74827.1|  449|Homo sapiens tubulin, alpha 8 protein.
          Length = 449

 Score = 94.3 bits (224), Expect = 3e-19
 Identities = 38/78 (48%), Positives = 55/78 (70%)
 Frame = +2

Query: 269 YYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEG 448
           +++E   GK+VPRAVM+DLEP  +D VR+G + Q+F P+  + G+  A NN+A+GHYT G
Sbjct: 52  FFSETGNGKHVPRAVMIDLEPTVVDEVRAGTYRQLFHPEQLITGKEDAANNYARGHYTVG 111

Query: 449 AELVDSVLDVVRKEAEGC 502
            E +D VLD +RK  + C
Sbjct: 112 KESIDLVLDRIRKLTDAC 129



 Score = 40.7 bits (91), Expect = 0.004
 Identities = 17/40 (42%), Positives = 22/40 (55%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDS 242
           MRE + +  GQ G QIG   WE+   EHGI A G +   +
Sbjct: 1   MRECISVHVGQAGVQIGNACWELFCLEHGIQADGTFDAQA 40


>AJ245922-1|CAB88036.1|  449|Homo sapiens alpha-tubulin 8 protein.
          Length = 449

 Score = 94.3 bits (224), Expect = 3e-19
 Identities = 38/78 (48%), Positives = 55/78 (70%)
 Frame = +2

Query: 269 YYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEG 448
           +++E   GK+VPRAVM+DLEP  +D VR+G + Q+F P+  + G+  A NN+A+GHYT G
Sbjct: 52  FFSETGNGKHVPRAVMIDLEPTVVDEVRAGTYRQLFHPEQLITGKEDAANNYARGHYTVG 111

Query: 449 AELVDSVLDVVRKEAEGC 502
            E +D VLD +RK  + C
Sbjct: 112 KESIDLVLDRIRKLTDAC 129



 Score = 40.7 bits (91), Expect = 0.004
 Identities = 17/40 (42%), Positives = 22/40 (55%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDS 242
           MRE + +  GQ G QIG   WE+   EHGI A G +   +
Sbjct: 1   MRECISVHVGQAGVQIGNACWELFCLEHGIQADGTFDAQA 40


>BC033064-1|AAH33064.1|  325|Homo sapiens TUBA1C protein protein.
          Length = 325

 Score = 91.1 bits (216), Expect = 3e-18
 Identities = 37/75 (49%), Positives = 53/75 (70%)
 Frame = +2

Query: 263 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYT 442
           N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GHYT
Sbjct: 50  NTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYT 109

Query: 443 EGAELVDSVLDVVRK 487
            G E++D VLD + K
Sbjct: 110 IGKEIIDLVLDRIHK 124



 Score = 38.7 bits (86), Expect = 0.018
 Identities = 18/42 (42%), Positives = 21/42 (50%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 248
           MRE + I  GQ G QIG   WE+   EHGI   G    D  +
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI 42


>BC105634-1|AAI05635.1|  446|Homo sapiens tubulin, alpha-like 3
           protein.
          Length = 446

 Score = 81.4 bits (192), Expect = 3e-15
 Identities = 34/80 (42%), Positives = 53/80 (66%)
 Frame = +2

Query: 263 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYT 442
           + ++ E   GK+VPRA+ VDLEP  +D +R+G    +F P+  + G+  A NN+A+G Y+
Sbjct: 57  DTFFCETRAGKHVPRALFVDLEPTVIDGIRTGQHRSLFHPEQLLSGKEDAANNYARGRYS 116

Query: 443 EGAELVDSVLDVVRKEAEGC 502
            G+E++D VL+  RK AE C
Sbjct: 117 VGSEVIDLVLERTRKLAEQC 136



 Score = 37.9 bits (84), Expect = 0.031
 Identities = 22/49 (44%), Positives = 24/49 (48%), Gaps = 1/49 (2%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQL-NASM 266
           MRE + I  GQ G QIG   WE+   EHGI   G        QL NA M
Sbjct: 1   MRECLSIHIGQAGIQIGDACWELYCLEHGIQPNGVVLDTQQDQLENAKM 49


>BC099716-1|AAH99716.1|  446|Homo sapiens tubulin, alpha-like 3
           protein.
          Length = 446

 Score = 81.4 bits (192), Expect = 3e-15
 Identities = 34/80 (42%), Positives = 53/80 (66%)
 Frame = +2

Query: 263 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYT 442
           + ++ E   GK+VPRA+ VDLEP  +D +R+G    +F P+  + G+  A NN+A+G Y+
Sbjct: 57  DTFFCETRAGKHVPRALFVDLEPTVIDGIRTGQHRSLFHPEQLLSGKEDAANNYARGRYS 116

Query: 443 EGAELVDSVLDVVRKEAEGC 502
            G+E++D VL+  RK AE C
Sbjct: 117 VGSEVIDLVLERTRKLAEQC 136



 Score = 37.9 bits (84), Expect = 0.031
 Identities = 22/49 (44%), Positives = 24/49 (48%), Gaps = 1/49 (2%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQL-NASM 266
           MRE + I  GQ G QIG   WE+   EHGI   G        QL NA M
Sbjct: 1   MRECLSIHIGQAGIQIGDACWELYCLEHGIQPNGVVLDTQQDQLENAKM 49


>BC098247-1|AAH98247.1|  406|Homo sapiens TUBAL3 protein protein.
          Length = 406

 Score = 81.4 bits (192), Expect = 3e-15
 Identities = 34/80 (42%), Positives = 53/80 (66%)
 Frame = +2

Query: 263 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYT 442
           + ++ E   GK+VPRA+ VDLEP  +D +R+G    +F P+  + G+  A NN+A+G Y+
Sbjct: 17  DTFFCETRAGKHVPRALFVDLEPTVIDGIRTGQHRSLFHPEQLLSGKEDAANNYARGRYS 76

Query: 443 EGAELVDSVLDVVRKEAEGC 502
            G+E++D VL+  RK AE C
Sbjct: 77  VGSEVIDLVLERTRKLAEQC 96


>AL683826-2|CAI23625.1|  446|Homo sapiens tubulin, alpha-like 3
           protein.
          Length = 446

 Score = 81.4 bits (192), Expect = 3e-15
 Identities = 34/80 (42%), Positives = 53/80 (66%)
 Frame = +2

Query: 263 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYT 442
           + ++ E   GK+VPRA+ VDLEP  +D +R+G    +F P+  + G+  A NN+A+G Y+
Sbjct: 57  DTFFCETRAGKHVPRALFVDLEPTVIDGIRTGQHRSLFHPEQLLSGKEDAANNYARGRYS 116

Query: 443 EGAELVDSVLDVVRKEAEGC 502
            G+E++D VL+  RK AE C
Sbjct: 117 VGSEVIDLVLERTRKLAEQC 136



 Score = 37.9 bits (84), Expect = 0.031
 Identities = 22/49 (44%), Positives = 24/49 (48%), Gaps = 1/49 (2%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQL-NASM 266
           MRE + I  GQ G QIG   WE+   EHGI   G        QL NA M
Sbjct: 1   MRECLSIHIGQAGIQIGDACWELYCLEHGIQPNGVVLDTQQDQLENAKM 49


>AK025318-1|BAB15110.1|  446|Homo sapiens protein ( Homo sapiens
           cDNA: FLJ21665 fis, clone COL08913. ).
          Length = 446

 Score = 81.4 bits (192), Expect = 3e-15
 Identities = 34/80 (42%), Positives = 53/80 (66%)
 Frame = +2

Query: 263 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYT 442
           + ++ E   GK+VPRA+ VDLEP  +D +R+G    +F P+  + G+  A NN+A+G Y+
Sbjct: 57  DTFFCETRAGKHVPRALFVDLEPTVIDGIRTGQHRSLFHPEQLLSGKEDAANNYARGRYS 116

Query: 443 EGAELVDSVLDVVRKEAEGC 502
            G+E++D VL+  RK AE C
Sbjct: 117 VGSEVIDLVLERTRKLAEQC 136



 Score = 37.9 bits (84), Expect = 0.031
 Identities = 22/49 (44%), Positives = 24/49 (48%), Gaps = 1/49 (2%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQL-NASM 266
           MRE + I  GQ G QIG   WE+   EHGI   G        QL NA M
Sbjct: 1   MRECLSIHIGQAGIQIGDACWELYCLEHGIQPNGVVLDTQQDQLENAKM 49


>AL713922-3|CAI16220.1|  410|Homo sapiens novel protein similar to
           beta-tubulin 4Q (TUBB4Q)kinase) II gamma protein.
          Length = 410

 Score = 79.8 bits (188), Expect = 8e-15
 Identities = 34/43 (79%), Positives = 38/43 (88%)
 Frame = +2

Query: 392 VFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           V GQ GAGNNWAKGHYTEGAEL++SV+DVVRKEAE CDC + F
Sbjct: 57  VAGQCGAGNNWAKGHYTEGAELMESVMDVVRKEAESCDCLQGF 99



 Score = 43.2 bits (97), Expect = 8e-04
 Identities = 21/44 (47%), Positives = 24/44 (54%)
 Frame = +1

Query: 511 QGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           QGFQ                   KIREEYPDRI+NTFS++PS K
Sbjct: 97  QGFQLTHSLGGGTGSGMGTLLLSKIREEYPDRIINTFSILPSPK 140


>BC021564-1|AAH21564.1|  335|Homo sapiens TUBA1B protein protein.
          Length = 335

 Score = 79.4 bits (187), Expect = 1e-14
 Identities = 31/73 (42%), Positives = 48/73 (65%)
 Frame = +2

Query: 263 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYT 442
           N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GHYT
Sbjct: 50  NTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYT 109

Query: 443 EGAELVDSVLDVV 481
               L+  ++  +
Sbjct: 110 NLNRLISQIVSSI 122



 Score = 38.7 bits (86), Expect = 0.018
 Identities = 18/42 (42%), Positives = 21/42 (50%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 248
           MRE + I  GQ G QIG   WE+   EHGI   G    D  +
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI 42


>M61764-1|AAA52620.1|  451|Homo sapiens gamma-tubulin protein.
          Length = 451

 Score = 76.6 bits (180), Expect = 7e-14
 Identities = 31/90 (34%), Positives = 58/90 (64%), Gaps = 2/90 (2%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQ--SGAGNNWAK 430
           R +V++ +A    Y+PRAV++DLEP  + S+ + P+ +++ P+N    +   GAGNNWA 
Sbjct: 47  RKDVFFYQADDEHYIPRAVLLDLEPRVIHSILNSPYAKLYNPENIYLSEHGGGAGNNWAS 106

Query: 431 GHYTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           G +++G ++ + + D++ +EA+G D    F
Sbjct: 107 G-FSQGEKIHEDIFDIIDREADGSDSLEGF 135



 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 18/29 (62%), Positives = 23/29 (79%)
 Frame = +3

Query: 126 REIVHIQAGQCGNQIGAKFWEVISDEHGI 212
           REI+ +Q GQCGNQIG +FW+ +  EHGI
Sbjct: 3   REIITLQLGQCGNQIGFEFWKQLCAEHGI 31


>CR407642-1|CAG28570.1|  451|Homo sapiens TUBG1 protein.
          Length = 451

 Score = 76.6 bits (180), Expect = 7e-14
 Identities = 31/90 (34%), Positives = 58/90 (64%), Gaps = 2/90 (2%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQ--SGAGNNWAK 430
           R +V++ +A    Y+PRAV++DLEP  + S+ + P+ +++ P+N    +   GAGNNWA 
Sbjct: 47  RKDVFFYQADDEHYIPRAVLLDLEPRVIHSILNSPYAKLYNPENIYLSEHGGGAGNNWAS 106

Query: 431 GHYTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           G +++G ++ + + D++ +EA+G D    F
Sbjct: 107 G-FSQGEKIHEDIFDIIDREADGSDSLEGF 135



 Score = 48.0 bits (109), Expect = 3e-05
 Identities = 19/33 (57%), Positives = 24/33 (72%)
 Frame = +3

Query: 126 REIVHIQAGQCGNQIGAKFWEVISDEHGIDATG 224
           REI+ +Q GQCGNQIG +FW+ +  EHGI   G
Sbjct: 3   REIITLQLGQCGNQIGFEFWKQLCAEHGISPEG 35


>BT019931-1|AAV38734.1|  451|Homo sapiens tubulin, gamma 1 protein.
          Length = 451

 Score = 76.6 bits (180), Expect = 7e-14
 Identities = 31/90 (34%), Positives = 58/90 (64%), Gaps = 2/90 (2%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQ--SGAGNNWAK 430
           R +V++ +A    Y+PRAV++DLEP  + S+ + P+ +++ P+N    +   GAGNNWA 
Sbjct: 47  RKDVFFYQADDEHYIPRAVLLDLEPRVIHSILNSPYAKLYNPENIYLSEHGGGAGNNWAS 106

Query: 431 GHYTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           G +++G ++ + + D++ +EA+G D    F
Sbjct: 107 G-FSQGEKIHEDIFDIIDREADGSDSLEGF 135



 Score = 48.0 bits (109), Expect = 3e-05
 Identities = 19/33 (57%), Positives = 24/33 (72%)
 Frame = +3

Query: 126 REIVHIQAGQCGNQIGAKFWEVISDEHGIDATG 224
           REI+ +Q GQCGNQIG +FW+ +  EHGI   G
Sbjct: 3   REIITLQLGQCGNQIGFEFWKQLCAEHGISPEG 35


>BC108739-1|AAI08740.1|  451|Homo sapiens tubulin, gamma 2 protein.
          Length = 451

 Score = 76.6 bits (180), Expect = 7e-14
 Identities = 31/90 (34%), Positives = 58/90 (64%), Gaps = 2/90 (2%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQ--SGAGNNWAK 430
           R +V++ +A    Y+PRAV++DLEP  + S+ + P+ +++ P+N    +   GAGNNWA 
Sbjct: 47  RKDVFFYQADDEHYIPRAVLLDLEPRVIHSILNSPYAKLYNPENIYLSEHGGGAGNNWAS 106

Query: 431 GHYTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           G +++G ++ + + D++ +EA+G D    F
Sbjct: 107 G-FSQGEKIHEDIFDIIDREADGSDSLEGF 135



 Score = 48.0 bits (109), Expect = 3e-05
 Identities = 19/33 (57%), Positives = 24/33 (72%)
 Frame = +3

Query: 126 REIVHIQAGQCGNQIGAKFWEVISDEHGIDATG 224
           REI+ +Q GQCGNQIG +FW+ +  EHGI   G
Sbjct: 3   REIITLQLGQCGNQIGFEFWKQLCAEHGISPEG 35


>BC051890-1|AAH51890.1|  451|Homo sapiens tubulin, gamma 2 protein.
          Length = 451

 Score = 76.6 bits (180), Expect = 7e-14
 Identities = 31/90 (34%), Positives = 58/90 (64%), Gaps = 2/90 (2%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQ--SGAGNNWAK 430
           R +V++ +A    Y+PRAV++DLEP  + S+ + P+ +++ P+N    +   GAGNNWA 
Sbjct: 47  RKDVFFYQADDEHYIPRAVLLDLEPRVIHSILNSPYAKLYNPENIYLSEHGGGAGNNWAS 106

Query: 431 GHYTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           G +++G ++ + + D++ +EA+G D    F
Sbjct: 107 G-FSQGEKIHEDIFDIIDREADGSDSLEGF 135



 Score = 48.0 bits (109), Expect = 3e-05
 Identities = 19/33 (57%), Positives = 24/33 (72%)
 Frame = +3

Query: 126 REIVHIQAGQCGNQIGAKFWEVISDEHGIDATG 224
           REI+ +Q GQCGNQIG +FW+ +  EHGI   G
Sbjct: 3   REIITLQLGQCGNQIGFEFWKQLCAEHGISPEG 35


>BC009670-1|AAH09670.1|  451|Homo sapiens tubulin, gamma 2 protein.
          Length = 451

 Score = 76.6 bits (180), Expect = 7e-14
 Identities = 31/90 (34%), Positives = 58/90 (64%), Gaps = 2/90 (2%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQ--SGAGNNWAK 430
           R +V++ +A    Y+PRAV++DLEP  + S+ + P+ +++ P+N    +   GAGNNWA 
Sbjct: 47  RKDVFFYQADDEHYIPRAVLLDLEPRVIHSILNSPYAKLYNPENIYLSEHGGGAGNNWAS 106

Query: 431 GHYTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           G +++G ++ + + D++ +EA+G D    F
Sbjct: 107 G-FSQGEKIHEDIFDIIDREADGSDSLEGF 135



 Score = 48.0 bits (109), Expect = 3e-05
 Identities = 19/33 (57%), Positives = 24/33 (72%)
 Frame = +3

Query: 126 REIVHIQAGQCGNQIGAKFWEVISDEHGIDATG 224
           REI+ +Q GQCGNQIG +FW+ +  EHGI   G
Sbjct: 3   REIITLQLGQCGNQIGFEFWKQLCAEHGISPEG 35


>BC000619-1|AAH00619.1|  451|Homo sapiens tubulin, gamma 1 protein.
          Length = 451

 Score = 76.6 bits (180), Expect = 7e-14
 Identities = 31/90 (34%), Positives = 58/90 (64%), Gaps = 2/90 (2%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQ--SGAGNNWAK 430
           R +V++ +A    Y+PRAV++DLEP  + S+ + P+ +++ P+N    +   GAGNNWA 
Sbjct: 47  RKDVFFYQADDEHYIPRAVLLDLEPRVIHSILNSPYAKLYNPENIYLSEHGGGAGNNWAS 106

Query: 431 GHYTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           G +++G ++ + + D++ +EA+G D    F
Sbjct: 107 G-FSQGEKIHEDIFDIIDREADGSDSLEGF 135



 Score = 48.0 bits (109), Expect = 3e-05
 Identities = 19/33 (57%), Positives = 24/33 (72%)
 Frame = +3

Query: 126 REIVHIQAGQCGNQIGAKFWEVISDEHGIDATG 224
           REI+ +Q GQCGNQIG +FW+ +  EHGI   G
Sbjct: 3   REIITLQLGQCGNQIGFEFWKQLCAEHGISPEG 35


>AK022324-1|BAB14012.1|  451|Homo sapiens protein ( Homo sapiens
           cDNA FLJ12262 fis, clone MAMMA1001576, highly similar to
           Human gamma-tubulin mRNA. ).
          Length = 451

 Score = 76.6 bits (180), Expect = 7e-14
 Identities = 31/90 (34%), Positives = 58/90 (64%), Gaps = 2/90 (2%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQ--SGAGNNWAK 430
           R +V++ +A    Y+PRAV++DLEP  + S+ + P+ +++ P+N    +   GAGNNWA 
Sbjct: 47  RKDVFFYQADDEHYIPRAVLLDLEPRVIHSILNSPYAKLYNPENIYLSEHGGGAGNNWAS 106

Query: 431 GHYTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           G +++G ++ + + D++ +EA+G D    F
Sbjct: 107 G-FSQGEKIHEDIFDIIDREADGSDSLEGF 135



 Score = 48.0 bits (109), Expect = 3e-05
 Identities = 19/33 (57%), Positives = 24/33 (72%)
 Frame = +3

Query: 126 REIVHIQAGQCGNQIGAKFWEVISDEHGIDATG 224
           REI+ +Q GQCGNQIG +FW+ +  EHGI   G
Sbjct: 3   REIITLQLGQCGNQIGFEFWKQLCAEHGISPEG 35


>AF225971-1|AAF34188.1|  451|Homo sapiens gamma-tubulin protein.
          Length = 451

 Score = 76.6 bits (180), Expect = 7e-14
 Identities = 31/90 (34%), Positives = 58/90 (64%), Gaps = 2/90 (2%)
 Frame = +2

Query: 257 RINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQ--SGAGNNWAK 430
           R +V++ +A    Y+PRAV++DLEP  + S+ + P+ +++ P+N    +   GAGNNWA 
Sbjct: 47  RKDVFFYQADDEHYIPRAVLLDLEPRVIHSILNSPYAKLYNPENIYLSEHGGGAGNNWAS 106

Query: 431 GHYTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           G +++G ++ + + D++ +EA+G D    F
Sbjct: 107 G-FSQGEKIHEDIFDIIDREADGSDSLEGF 135



 Score = 48.0 bits (109), Expect = 3e-05
 Identities = 19/33 (57%), Positives = 24/33 (72%)
 Frame = +3

Query: 126 REIVHIQAGQCGNQIGAKFWEVISDEHGIDATG 224
           REI+ +Q GQCGNQIG +FW+ +  EHGI   G
Sbjct: 3   REIITLQLGQCGNQIGFEFWKQLCAEHGISPEG 35


>Z99289-5|CAI42328.1|  163|Homo sapiens tubulin, epsilon 1 protein.
          Length = 163

 Score = 69.3 bits (162), Expect = 1e-11
 Identities = 29/72 (40%), Positives = 42/72 (58%)
 Frame = +2

Query: 305 RAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVR 484
           RAV++D+E G ++ +  GP   +F     +   SG+GNNWA GH   G+   D +L+  R
Sbjct: 70  RAVLIDMEEGVVNEILQGPLRDVFDTKQLITDISGSGNNWAVGHKVFGSLYQDQILEKFR 129

Query: 485 KEAEGCDCCRVF 520
           K AE CDC + F
Sbjct: 130 KSAEHCDCLQCF 141



 Score = 39.5 bits (88), Expect = 0.010
 Identities = 17/37 (45%), Positives = 23/37 (62%), Gaps = 1/37 (2%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEH-GIDATGAY 230
           M + V +Q GQCGNQIG  FW++   EH  ++  G Y
Sbjct: 1   MTQSVVVQVGQCGNQIGCCFWDLALREHAAVNQKGIY 37


>Z99289-4|CAI42327.1|  475|Homo sapiens tubulin, epsilon 1 protein.
          Length = 475

 Score = 69.3 bits (162), Expect = 1e-11
 Identities = 29/72 (40%), Positives = 42/72 (58%)
 Frame = +2

Query: 305 RAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVR 484
           RAV++D+E G ++ +  GP   +F     +   SG+GNNWA GH   G+   D +L+  R
Sbjct: 70  RAVLIDMEEGVVNEILQGPLRDVFDTKQLITDISGSGNNWAVGHKVFGSLYQDQILEKFR 129

Query: 485 KEAEGCDCCRVF 520
           K AE CDC + F
Sbjct: 130 KSAEHCDCLQCF 141



 Score = 39.5 bits (88), Expect = 0.010
 Identities = 17/37 (45%), Positives = 23/37 (62%), Gaps = 1/37 (2%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEH-GIDATGAY 230
           M + V +Q GQCGNQIG  FW++   EH  ++  G Y
Sbjct: 1   MTQSVVVQVGQCGNQIGCCFWDLALREHAAVNQKGIY 37


>Z99289-3|CAI42326.1|  206|Homo sapiens tubulin, epsilon 1 protein.
          Length = 206

 Score = 69.3 bits (162), Expect = 1e-11
 Identities = 29/72 (40%), Positives = 42/72 (58%)
 Frame = +2

Query: 305 RAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVR 484
           RAV++D+E G ++ +  GP   +F     +   SG+GNNWA GH   G+   D +L+  R
Sbjct: 26  RAVLIDMEEGVVNEILQGPLRDVFDTKQLITDISGSGNNWAVGHKVFGSLYQDQILEKFR 85

Query: 485 KEAEGCDCCRVF 520
           K AE CDC + F
Sbjct: 86  KSAEHCDCLQCF 97


>BC025405-1|AAH25405.1|  475|Homo sapiens tubulin, epsilon 1
           protein.
          Length = 475

 Score = 69.3 bits (162), Expect = 1e-11
 Identities = 29/72 (40%), Positives = 42/72 (58%)
 Frame = +2

Query: 305 RAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVR 484
           RAV++D+E G ++ +  GP   +F     +   SG+GNNWA GH   G+   D +L+  R
Sbjct: 70  RAVLIDMEEGVVNEILQGPLRDVFDTKQLITDISGSGNNWAVGHKVFGSLYQDQILEKFR 129

Query: 485 KEAEGCDCCRVF 520
           K AE CDC + F
Sbjct: 130 KSAEHCDCLQCF 141



 Score = 39.5 bits (88), Expect = 0.010
 Identities = 17/37 (45%), Positives = 23/37 (62%), Gaps = 1/37 (2%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEH-GIDATGAY 230
           M + V +Q GQCGNQIG  FW++   EH  ++  G Y
Sbjct: 1   MTQSVVVQVGQCGNQIGCCFWDLALREHAAVNQKGIY 37


>AF201334-1|AAF09585.1|  475|Homo sapiens epsilon-tubulin protein.
          Length = 475

 Score = 69.3 bits (162), Expect = 1e-11
 Identities = 29/72 (40%), Positives = 42/72 (58%)
 Frame = +2

Query: 305 RAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVR 484
           RAV++D+E G ++ +  GP   +F     +   SG+GNNWA GH   G+   D +L+  R
Sbjct: 70  RAVLIDMEEGVVNEILQGPLRDVFDTKQLITDISGSGNNWAVGHKVFGSLYQDQILEKFR 129

Query: 485 KEAEGCDCCRVF 520
           K AE CDC + F
Sbjct: 130 KSAEHCDCLQCF 141



 Score = 39.5 bits (88), Expect = 0.010
 Identities = 17/37 (45%), Positives = 23/37 (62%), Gaps = 1/37 (2%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEH-GIDATGAY 230
           M + V +Q GQCGNQIG  FW++   EH  ++  G Y
Sbjct: 1   MTQSVVVQVGQCGNQIGCCFWDLALREHAAVNQKGIY 37


>BC031101-1|AAH31101.1|  475|Homo sapiens tubulin, epsilon 1
           protein.
          Length = 475

 Score = 68.5 bits (160), Expect = 2e-11
 Identities = 29/72 (40%), Positives = 42/72 (58%)
 Frame = +2

Query: 305 RAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVR 484
           RAV++D+E G ++ +  GP   +F     +   SG+GNNWA GH   G+   D +L+  R
Sbjct: 70  RAVLIDMEEGVVNEILQGPLRGVFDTKQLITDISGSGNNWAVGHKVFGSLYQDQILEKFR 129

Query: 485 KEAEGCDCCRVF 520
           K AE CDC + F
Sbjct: 130 KSAEHCDCLQCF 141



 Score = 39.5 bits (88), Expect = 0.010
 Identities = 17/37 (45%), Positives = 23/37 (62%), Gaps = 1/37 (2%)
 Frame = +3

Query: 123 MREIVHIQAGQCGNQIGAKFWEVISDEH-GIDATGAY 230
           M + V +Q GQCGNQIG  FW++   EH  ++  G Y
Sbjct: 1   MTQSVVVQVGQCGNQIGCCFWDLALREHAAVNQKGIY 37


>AY533484-1|AAS86429.1|   98|Homo sapiens tubulin alpha-1 protein.
          Length = 98

 Score = 61.7 bits (143), Expect = 2e-09
 Identities = 25/55 (45%), Positives = 38/55 (69%)
 Frame = +2

Query: 338 MDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAEGC 502
           +D VR+G + Q+F P+  + G+  A NN+A+GHYT G E++D VL  +RK A+ C
Sbjct: 1   IDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLYRIRKLADQC 55


>AF035316-1|AAB88188.1|  342|Homo sapiens protein ( Homo sapiens
           clone 23678 mRNA, partial cds. ).
          Length = 342

 Score = 58.0 bits (134), Expect = 3e-08
 Identities = 25/30 (83%), Positives = 27/30 (90%)
 Frame = +2

Query: 431 GHYTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           GHYTEGAELVDSVLDVVRKE+E CDC + F
Sbjct: 1   GHYTEGAELVDSVLDVVRKESESCDCLQGF 30



 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 25/53 (47%), Positives = 26/53 (49%)
 Frame = +1

Query: 484 KRSXXXXXXQGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           K S      QGFQ                   KIREEYPDRIMNTFSV+PS K
Sbjct: 19  KESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPK 71


>BC000258-1|AAH00258.1|  398|Homo sapiens TUBD1 protein protein.
          Length = 398

 Score = 57.2 bits (132), Expect = 5e-08
 Identities = 28/82 (34%), Positives = 48/82 (58%), Gaps = 3/82 (3%)
 Frame = +2

Query: 269 YYNEASGGKYVPRAVMVDLEPGTMDSV--RSGPFGQIFRPDNFVFGQS-GAGNNWAKGHY 439
           +++E   G  + RAV+VD+EP  ++ +  ++   GQ     +  F Q  G+GNNWA G+ 
Sbjct: 50  FFSEEENGVPIARAVLVDMEPKVINQMLSKAAQSGQWKYGQHACFCQKQGSGNNWAYGYS 109

Query: 440 TEGAELVDSVLDVVRKEAEGCD 505
             G    +S+++++RKE E CD
Sbjct: 110 VHGPRHEESIMNIIRKEVEKCD 131



 Score = 32.7 bits (71), Expect = 1.2
 Identities = 14/26 (53%), Positives = 20/26 (76%), Gaps = 1/26 (3%)
 Frame = +3

Query: 132 IVHIQAGQCGNQIGAKFWE-VISDEH 206
           IV +Q GQCGNQIG + ++ ++SD H
Sbjct: 3   IVTVQLGQCGNQIGFEVFDALLSDSH 28


>BC001896-1|AAH01896.1|  340|Homo sapiens TUBB protein protein.
          Length = 340

 Score = 56.8 bits (131), Expect = 6e-08
 Identities = 25/29 (86%), Positives = 26/29 (89%)
 Frame = +2

Query: 434 HYTEGAELVDSVLDVVRKEAEGCDCCRVF 520
           HYTEGAELVDSVLDVVRKEAE CDC + F
Sbjct: 1   HYTEGAELVDSVLDVVRKEAESCDCLQGF 29



 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 24/44 (54%), Positives = 24/44 (54%)
 Frame = +1

Query: 511 QGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           QGFQ                   KIREEYPDRIMNTFSVVPS K
Sbjct: 27  QGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPK 70


>AF201333-1|AAF09584.1|  453|Homo sapiens delta-tubulin protein.
          Length = 453

 Score = 56.8 bits (131), Expect = 6e-08
 Identities = 28/82 (34%), Positives = 47/82 (57%), Gaps = 3/82 (3%)
 Frame = +2

Query: 269 YYNEASGGKYVPRAVMVDLEPGTMDSV--RSGPFGQIFRPDNFVFGQS-GAGNNWAKGHY 439
           +++E   G  + RAV+VD+EP  ++    ++   GQ     +  F Q  G+GNNWA G+ 
Sbjct: 50  FFSEEENGVPIARAVLVDMEPKVINQTLSKAAQSGQWKYGQHACFCQKQGSGNNWAYGYS 109

Query: 440 TEGAELVDSVLDVVRKEAEGCD 505
             G    +S+++++RKE E CD
Sbjct: 110 VHGPRHEESIMNIIRKEVEKCD 131



 Score = 32.7 bits (71), Expect = 1.2
 Identities = 14/26 (53%), Positives = 20/26 (76%), Gaps = 1/26 (3%)
 Frame = +3

Query: 132 IVHIQAGQCGNQIGAKFWE-VISDEH 206
           IV +Q GQCGNQIG + ++ ++SD H
Sbjct: 3   IVTVQLGQCGNQIGFEVFDALLSDSH 28


>AB031045-1|BAD83581.1|  351|Homo sapiens delta-tubulin isoform
           protein.
          Length = 351

 Score = 56.8 bits (131), Expect = 6e-08
 Identities = 28/82 (34%), Positives = 47/82 (57%), Gaps = 3/82 (3%)
 Frame = +2

Query: 269 YYNEASGGKYVPRAVMVDLEPGTMDSV--RSGPFGQIFRPDNFVFGQS-GAGNNWAKGHY 439
           +++E   G  + RAV+VD+EP  ++    ++   GQ     +  F Q  G+GNNWA G+ 
Sbjct: 50  FFSEEENGVPIARAVLVDMEPKVINQTLSKAAQSGQWKYGQHACFCQKQGSGNNWAYGYS 109

Query: 440 TEGAELVDSVLDVVRKEAEGCD 505
             G    +S+++++RKE E CD
Sbjct: 110 VHGPRHEESIMNIIRKEVEKCD 131



 Score = 32.7 bits (71), Expect = 1.2
 Identities = 14/26 (53%), Positives = 20/26 (76%), Gaps = 1/26 (3%)
 Frame = +3

Query: 132 IVHIQAGQCGNQIGAKFWE-VISDEH 206
           IV +Q GQCGNQIG + ++ ++SD H
Sbjct: 3   IVTVQLGQCGNQIGFEVFDALLSDSH 28


>AB031044-1|BAD83580.1|  398|Homo sapiens delta-tubulin isoform
           protein.
          Length = 398

 Score = 56.8 bits (131), Expect = 6e-08
 Identities = 28/82 (34%), Positives = 47/82 (57%), Gaps = 3/82 (3%)
 Frame = +2

Query: 269 YYNEASGGKYVPRAVMVDLEPGTMDSV--RSGPFGQIFRPDNFVFGQS-GAGNNWAKGHY 439
           +++E   G  + RAV+VD+EP  ++    ++   GQ     +  F Q  G+GNNWA G+ 
Sbjct: 50  FFSEEENGVPIARAVLVDMEPKVINQTLSKAAQSGQWKYGQHACFCQKQGSGNNWAYGYS 109

Query: 440 TEGAELVDSVLDVVRKEAEGCD 505
             G    +S+++++RKE E CD
Sbjct: 110 VHGPRHEESIMNIIRKEVEKCD 131



 Score = 32.7 bits (71), Expect = 1.2
 Identities = 14/26 (53%), Positives = 20/26 (76%), Gaps = 1/26 (3%)
 Frame = +3

Query: 132 IVHIQAGQCGNQIGAKFWE-VISDEH 206
           IV +Q GQCGNQIG + ++ ++SD H
Sbjct: 3   IVTVQLGQCGNQIGFEVFDALLSDSH 28


>AB030837-1|BAD16590.1|  453|Homo sapiens delta tubulin protein.
          Length = 453

 Score = 56.8 bits (131), Expect = 6e-08
 Identities = 28/82 (34%), Positives = 47/82 (57%), Gaps = 3/82 (3%)
 Frame = +2

Query: 269 YYNEASGGKYVPRAVMVDLEPGTMDSV--RSGPFGQIFRPDNFVFGQS-GAGNNWAKGHY 439
           +++E   G  + RAV+VD+EP  ++    ++   GQ     +  F Q  G+GNNWA G+ 
Sbjct: 50  FFSEEENGVPIARAVLVDMEPKVINQTLSKAAQSGQWKYGQHACFCQKQGSGNNWAYGYS 109

Query: 440 TEGAELVDSVLDVVRKEAEGCD 505
             G    +S+++++RKE E CD
Sbjct: 110 VHGPRHEESIMNIIRKEVEKCD 131



 Score = 32.7 bits (71), Expect = 1.2
 Identities = 14/26 (53%), Positives = 20/26 (76%), Gaps = 1/26 (3%)
 Frame = +3

Query: 132 IVHIQAGQCGNQIGAKFWE-VISDEH 206
           IV +Q GQCGNQIG + ++ ++SD H
Sbjct: 3   IVTVQLGQCGNQIGFEVFDALLSDSH 28


>AK024002-1|BAB14767.1|  241|Homo sapiens protein ( Homo sapiens
           cDNA FLJ13940 fis, clone Y79AA1000833, moderately
           similar to TUBULIN ALPHA-1 CHAIN. ).
          Length = 241

 Score = 56.4 bits (130), Expect = 8e-08
 Identities = 25/59 (42%), Positives = 36/59 (61%)
 Frame = +2

Query: 326 EPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAEGC 502
           +P    S + G + QIF P+  + G+  A NN+A GHYT G E +D +LD +RK A+ C
Sbjct: 10  DPSQPLSRQHGTYRQIFHPEQLITGKEDAANNYAWGHYTIGKEFIDLLLDRIRKLADQC 68


>BC127874-1|AAI27875.1|  151|Homo sapiens Unknown (protein for
           IMAGE:40134249) protein.
          Length = 151

 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 25/53 (47%), Positives = 26/53 (49%)
 Frame = +1

Query: 484 KRSXXXXXXQGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           K S      QGFQ                   KIREEYPDRIMNTFSV+PS K
Sbjct: 8   KESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPK 60


>AL050056-1|CAB43252.1|  325|Homo sapiens hypothetical protein
           protein.
          Length = 325

 Score = 46.4 bits (105), Expect = 9e-05
 Identities = 25/53 (47%), Positives = 26/53 (49%)
 Frame = +1

Query: 484 KRSXXXXXXQGFQXXXXXXXXXXXXXXXXXXXKIREEYPDRIMNTFSVVPSSK 642
           K S      QGFQ                   KIREEYPDRIMNTFSV+PS K
Sbjct: 2   KESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPK 54


>DQ457058-1|ABE96641.1|  208|Homo sapiens XTP3TPA-transactivated
           protein 1 protein.
          Length = 208

 Score = 45.2 bits (102), Expect = 2e-04
 Identities = 20/21 (95%), Positives = 20/21 (95%)
 Frame = +1

Query: 580 KIREEYPDRIMNTFSVVPSSK 642
           KIREEYPDRIMNTFSVVPS K
Sbjct: 8   KIREEYPDRIMNTFSVVPSPK 28


>AK024096-1|BAB14825.1|  199|Homo sapiens protein ( Homo sapiens
           cDNA FLJ14034 fis, clone HEMBA1004499, weakly similar to
           Homo sapiens delta-tubulin mRNA. ).
          Length = 199

 Score = 32.7 bits (71), Expect = 1.2
 Identities = 14/26 (53%), Positives = 20/26 (76%), Gaps = 1/26 (3%)
 Frame = +3

Query: 132 IVHIQAGQCGNQIGAKFWE-VISDEH 206
           IV +Q GQCGNQIG + ++ ++SD H
Sbjct: 3   IVTVQLGQCGNQIGFEVFDALLSDSH 28


>X07882-1|CAA30729.1|  226|Homo sapiens Po protein protein.
          Length = 226

 Score = 30.7 bits (66), Expect = 4.7
 Identities = 18/55 (32%), Positives = 26/55 (47%)
 Frame = -2

Query: 473 PVPNQPVQPPLCNVLSPSYSPPQTVRRRSCPVGRFAQTARNGRSPWFQAQGPPSQ 309
           P P +P +PP     + S  PP    +   P  +    +R+ RSP  + QGPP Q
Sbjct: 115 PPPGKPERPPPQGG-NQSQGPPPHPGKPEGPPPQEGNKSRSARSPPGKPQGPPQQ 168


>X07704-1|CAA30542.1|  234|Homo sapiens Po protein protein.
          Length = 234

 Score = 30.7 bits (66), Expect = 4.7
 Identities = 18/55 (32%), Positives = 26/55 (47%)
 Frame = -2

Query: 473 PVPNQPVQPPLCNVLSPSYSPPQTVRRRSCPVGRFAQTARNGRSPWFQAQGPPSQ 309
           P P +P +PP     + S  PP    +   P  +    +R+ RSP  + QGPP Q
Sbjct: 123 PPPGKPERPPPQGG-NQSQGPPPHPGKPEGPPPQEGNKSRSARSPPGKPQGPPQQ 176


>S80916-1|AAB50687.2|  238|Homo sapiens parotid 'o' protein protein.
          Length = 238

 Score = 30.7 bits (66), Expect = 4.7
 Identities = 18/55 (32%), Positives = 26/55 (47%)
 Frame = -2

Query: 473 PVPNQPVQPPLCNVLSPSYSPPQTVRRRSCPVGRFAQTARNGRSPWFQAQGPPSQ 309
           P P +P +PP     + S  PP    +   P  +    +R+ RSP  + QGPP Q
Sbjct: 127 PPPGKPERPPPQGG-NQSQGPPPHPGKPEGPPPQEGNKSRSARSPPGKPQGPPQQ 180


>S80905-1|AAB50686.1|  382|Homo sapiens Con1 protein.
          Length = 382

 Score = 30.7 bits (66), Expect = 4.7
 Identities = 19/55 (34%), Positives = 24/55 (43%)
 Frame = -2

Query: 473 PVPNQPVQPPLCNVLSPSYSPPQTVRRRSCPVGRFAQTARNGRSPWFQAQGPPSQ 309
           P P +P  PP      P   PP    +   P G     +R+ RSP  + QGPP Q
Sbjct: 286 PPPGKPQGPPPQGGNKPQGPPPPGKPQGPPPQG--GSKSRSARSPPGKPQGPPQQ 338


>K03208-1|AAA60189.1|  251|Homo sapiens PRB2 protein.
          Length = 251

 Score = 30.7 bits (66), Expect = 4.7
 Identities = 19/55 (34%), Positives = 24/55 (43%)
 Frame = -2

Query: 473 PVPNQPVQPPLCNVLSPSYSPPQTVRRRSCPVGRFAQTARNGRSPWFQAQGPPSQ 309
           P P +P  PP      P   PP    +   P G     +R+ RSP  + QGPP Q
Sbjct: 155 PPPGKPQGPPPQGGNKPQGPPPPGKPQGPPPQG--GSKSRSARSPPGKPQGPPQQ 207


>K03207-1|AAA60188.1|  247|Homo sapiens salivary proline-rich
           protein precursor protein.
          Length = 247

 Score = 30.7 bits (66), Expect = 4.7
 Identities = 18/55 (32%), Positives = 26/55 (47%)
 Frame = -2

Query: 473 PVPNQPVQPPLCNVLSPSYSPPQTVRRRSCPVGRFAQTARNGRSPWFQAQGPPSQ 309
           P P +P +PP     + S  PP    +   P  +    +R+ RSP  + QGPP Q
Sbjct: 136 PPPGKPERPPPQGG-NQSQGPPPHPGKPEGPPPQEGNKSRSARSPPGKPQGPPQQ 189


>BC130386-1|AAI30387.1|  268|Homo sapiens PRB4 protein protein.
          Length = 268

 Score = 30.7 bits (66), Expect = 4.7
 Identities = 18/55 (32%), Positives = 26/55 (47%)
 Frame = -2

Query: 473 PVPNQPVQPPLCNVLSPSYSPPQTVRRRSCPVGRFAQTARNGRSPWFQAQGPPSQ 309
           P P +P +PP     + S  PP    +   P  +    +R+ RSP  + QGPP Q
Sbjct: 157 PPPGKPERPPPQGG-NQSQGPPPHPGKPEGPPPQEGNKSRSARSPPGKPQGPPQQ 210


>K02575-1|AAA36502.1|  173|Homo sapiens protein ( Human salivary
           proline-rich protein 1 gene, segment 1. ).
          Length = 173

 Score = 29.9 bits (64), Expect = 8.2
 Identities = 19/55 (34%), Positives = 25/55 (45%)
 Frame = -2

Query: 473 PVPNQPVQPPLCNVLSPSYSPPQTVRRRSCPVGRFAQTARNGRSPWFQAQGPPSQ 309
           P P +P  PP      P   PP    +   P G   + +R+ RSP  + QGPP Q
Sbjct: 35  PPPGKPQGPPPQGGNKPQGPPPPGKPQGPPPQG--GKRSRSPRSPPGKPQGPPPQ 87


>EF064726-1|ABK41909.1|  302|Homo sapiens inducible T-cell
           co-stimulator ligand protein.
          Length = 302

 Score = 29.9 bits (64), Expect = 8.2
 Identities = 10/31 (32%), Positives = 20/31 (64%)
 Frame = -3

Query: 607 YDLDTLHGFWKSKESPYQIQYLLPENELAEN 515
           +DL+ ++ +W++ ES   + Y +P+N   EN
Sbjct: 45  FDLNDVYVYWQTSESKTVVTYHIPQNSSLEN 75


>BC064637-1|AAH64637.1|  302|Homo sapiens ICOSLG protein protein.
          Length = 302

 Score = 29.9 bits (64), Expect = 8.2
 Identities = 10/31 (32%), Positives = 20/31 (64%)
 Frame = -3

Query: 607 YDLDTLHGFWKSKESPYQIQYLLPENELAEN 515
           +DL+ ++ +W++ ES   + Y +P+N   EN
Sbjct: 45  FDLNDVYVYWQTSESKTVVTYHIPQNSSLEN 75


>AF289028-1|AAG01176.1|  302|Homo sapiens transmembrane protein
           B7-H2 ICOS ligand protein.
          Length = 302

 Score = 29.9 bits (64), Expect = 8.2
 Identities = 10/31 (32%), Positives = 20/31 (64%)
 Frame = -3

Query: 607 YDLDTLHGFWKSKESPYQIQYLLPENELAEN 515
           +DL+ ++ +W++ ES   + Y +P+N   EN
Sbjct: 45  FDLNDVYVYWQTSESKTVVTYHIPQNSSLEN 75


>AF216749-1|AAK16241.1|  302|Homo sapiens B7-related protein-1
           protein.
          Length = 302

 Score = 29.9 bits (64), Expect = 8.2
 Identities = 10/31 (32%), Positives = 20/31 (64%)
 Frame = -3

Query: 607 YDLDTLHGFWKSKESPYQIQYLLPENELAEN 515
           +DL+ ++ +W++ ES   + Y +P+N   EN
Sbjct: 45  FDLNDVYVYWQTSESKTVVTYHIPQNSSLEN 75


>AF199028-1|AAF34739.1|  309|Homo sapiens B7-like protein protein.
          Length = 309

 Score = 29.9 bits (64), Expect = 8.2
 Identities = 10/31 (32%), Positives = 20/31 (64%)
 Frame = -3

Query: 607 YDLDTLHGFWKSKESPYQIQYLLPENELAEN 515
           +DL+ ++ +W++ ES   + Y +P+N   EN
Sbjct: 45  FDLNDVYVYWQTSESKTVVTYHIPQNSSLEN 75


>AB014553-1|BAA31628.1|  558|Homo sapiens KIAA0653 protein protein.
          Length = 558

 Score = 29.9 bits (64), Expect = 8.2
 Identities = 10/31 (32%), Positives = 20/31 (64%)
 Frame = -3

Query: 607 YDLDTLHGFWKSKESPYQIQYLLPENELAEN 515
           +DL+ ++ +W++ ES   + Y +P+N   EN
Sbjct: 87  FDLNDVYVYWQTSESKTVVTYHIPQNSSLEN 117


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 101,568,859
Number of Sequences: 237096
Number of extensions: 2234104
Number of successful extensions: 14570
Number of sequences better than 10.0: 181
Number of HSP's better than 10.0 without gapping: 13750
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 14539
length of database: 76,859,062
effective HSP length: 87
effective length of database: 56,231,710
effective search space used: 7197658880
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).