SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0035
         (648 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB208913-1|BAD92150.1| 1515|Homo sapiens integrin beta 4 isoform...    33   1.2  
X98507-1|CAA67131.1| 1028|Homo sapiens myosin I beta protein.          32   1.5  
BC068013-1|AAH68013.1| 1028|Homo sapiens myosin IC protein.            32   1.5  
BC044891-1|AAH44891.2| 1028|Homo sapiens MYO1C protein protein.        32   1.5  
AB210015-1|BAE06097.1| 1097|Homo sapiens MYO1C variant protein p...    32   1.5  
BC117697-1|AAI17698.1| 1690|Homo sapiens COL11A1 protein protein.      31   4.7  

>AB208913-1|BAD92150.1| 1515|Homo sapiens integrin beta 4 isoform 3
           precursor variant protein.
          Length = 1515

 Score = 32.7 bits (71), Expect = 1.2
 Identities = 22/72 (30%), Positives = 32/72 (44%), Gaps = 1/72 (1%)
 Frame = +3

Query: 435 GQQNEPNPAVVGMSGIQQTP-VGGEPRVRRLLEYLTAEEQRMAAILAAVGLSTTPRRRCR 611
           G +    P     +G QQ P + G  R R      +   + + A L +V LS T   RC+
Sbjct: 4   GAEGASPPRGRSRTGAQQQPRLAGRGRKRMAGPRPSPWARLLLAALISVSLSGTLANRCK 63

Query: 612 TAPDESAPQCTR 647
            AP +S  +C R
Sbjct: 64  KAPVKSCTECVR 75


>X98507-1|CAA67131.1| 1028|Homo sapiens myosin I beta protein.
          Length = 1028

 Score = 32.3 bits (70), Expect = 1.5
 Identities = 14/26 (53%), Positives = 17/26 (65%)
 Frame = +1

Query: 97  VLPALSAEDVSYQACVDKYSRKGYQP 174
           VL AL +E + Y   V KY RKGY+P
Sbjct: 875 VLQALGSEPIQYAVPVVKYDRKGYKP 900


>BC068013-1|AAH68013.1| 1028|Homo sapiens myosin IC protein.
          Length = 1028

 Score = 32.3 bits (70), Expect = 1.5
 Identities = 14/26 (53%), Positives = 17/26 (65%)
 Frame = +1

Query: 97  VLPALSAEDVSYQACVDKYSRKGYQP 174
           VL AL +E + Y   V KY RKGY+P
Sbjct: 875 VLQALGSEPIQYAVPVVKYDRKGYKP 900


>BC044891-1|AAH44891.2| 1028|Homo sapiens MYO1C protein protein.
          Length = 1028

 Score = 32.3 bits (70), Expect = 1.5
 Identities = 14/26 (53%), Positives = 17/26 (65%)
 Frame = +1

Query: 97  VLPALSAEDVSYQACVDKYSRKGYQP 174
           VL AL +E + Y   V KY RKGY+P
Sbjct: 875 VLQALGSEPIQYAVPVVKYDRKGYKP 900


>AB210015-1|BAE06097.1| 1097|Homo sapiens MYO1C variant protein
            protein.
          Length = 1097

 Score = 32.3 bits (70), Expect = 1.5
 Identities = 14/26 (53%), Positives = 17/26 (65%)
 Frame = +1

Query: 97   VLPALSAEDVSYQACVDKYSRKGYQP 174
            VL AL +E + Y   V KY RKGY+P
Sbjct: 944  VLQALGSEPIQYAVPVVKYDRKGYKP 969


>BC117697-1|AAI17698.1| 1690|Homo sapiens COL11A1 protein protein.
          Length = 1690

 Score = 30.7 bits (66), Expect = 4.7
 Identities = 23/66 (34%), Positives = 29/66 (43%), Gaps = 1/66 (1%)
 Frame = +3

Query: 300 EYIEDENV-EFPTCCARLRCVVEVNGERIVQTRGQPGELFPDKPWKGQQNEPNPAVVGMS 476
           EY E E+V E PT         E+NG      +GQ GE    +P    +  P PA  G +
Sbjct: 277 EYKEAESVTEGPTVTEETIAQTEINGHGAYGEKGQKGEPAVVEPGMLVEGPPGPA--GPA 334

Query: 477 GIQQTP 494
           GI   P
Sbjct: 335 GIMGPP 340


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 109,278,764
Number of Sequences: 237096
Number of extensions: 2781156
Number of successful extensions: 11035
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 10636
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 11031
length of database: 76,859,062
effective HSP length: 87
effective length of database: 56,231,710
effective search space used: 7197658880
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).