SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0033
         (698 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BC013683-1|AAH13683.1|  444|Homo sapiens tubulin, beta 4 protein.     175   1e-43
BC006570-1|AAH06570.1|  444|Homo sapiens TUBB4 protein protein.       175   1e-43
X02344-1|CAA26203.1|  445|Homo sapiens beta-tubulin protein.          175   2e-43
BX255925-3|CAM24148.1|  445|Homo sapiens tubulin, beta 2C protein.    175   2e-43
BC071889-1|AAH71889.1|  445|Homo sapiens tubulin, beta 2C protein.    175   2e-43
BC039175-1|AAH39175.1|  445|Homo sapiens tubulin, beta 2C protein.    175   2e-43
BC029529-1|AAH29529.1|  445|Homo sapiens tubulin, beta 2C protein.    175   2e-43
BC024038-1|AAH24038.1|  445|Homo sapiens tubulin, beta 2C protein.    175   2e-43
BC019829-1|AAH19829.1|  445|Homo sapiens tubulin, beta 2C protein.    175   2e-43
BC019359-1|AAH19359.1|  445|Homo sapiens tubulin, beta 2C protein.    175   2e-43
BC012835-1|AAH12835.1|  445|Homo sapiens tubulin, beta 2C protein.    175   2e-43
BC008006-1|AAH08006.1|  227|Homo sapiens TUBB2C protein protein.      175   2e-43
BC007889-1|AAH07889.1|  445|Homo sapiens tubulin, beta 2C protein.    175   2e-43
BC004188-1|AAH04188.1|  445|Homo sapiens tubulin, beta 2C protein.    175   2e-43
BC002885-1|AAH02885.1|  445|Homo sapiens tubulin, beta 2C protein.    175   2e-43
BC002783-1|AAH02783.1|  445|Homo sapiens tubulin, beta 2C protein.    175   2e-43
BC001911-1|AAH01911.1|  445|Homo sapiens tubulin, beta 2C protein.    175   2e-43
AY167990-1|AAN87335.1|  445|Homo sapiens class IVb beta tubulin ...   175   2e-43
X79535-1|CAA56071.1|  445|Homo sapiens beta tubulin protein.          174   3e-43
CR456788-1|CAG33069.1|  445|Homo sapiens MGC8685 protein.             174   3e-43
BT019930-1|AAV38733.1|  445|Homo sapiens tubulin, beta polypepti...   174   3e-43
BC063610-1|AAH63610.1|  445|Homo sapiens tubulin, beta 2B protein.    174   3e-43
BC018780-1|AAH18780.1|  445|Homo sapiens tubulin, beta 2A protein.    174   3e-43
BC001352-1|AAH01352.1|  445|Homo sapiens tubulin, beta 2B protein.    174   3e-43
BC001194-1|AAH01194.1|  445|Homo sapiens tubulin, beta 2A protein.    174   3e-43
AY159127-1|AAN85571.1|  445|Homo sapiens class II beta tubulin i...   174   3e-43
AL445309-1|CAI40952.1|  445|Homo sapiens RP11-506K6.1 protein.        174   3e-43
AL050056-1|CAB43252.1|  325|Homo sapiens hypothetical protein pr...   174   3e-43
AL031963-6|CAD70628.1|  445|Homo sapiens protein ( Human DNA seq...   174   3e-43
AF035316-1|AAB88188.1|  342|Homo sapiens protein ( Homo sapiens ...   174   3e-43
DQ457058-1|ABE96641.1|  208|Homo sapiens XTP3TPA-transactivated ...   173   5e-43
BX248307-8|CAM25935.1|  372|Homo sapiens tubulin beta polypeptid...   173   5e-43
BX248307-7|CAM25934.1|  426|Homo sapiens tubulin beta polypeptid...   173   5e-43
BX248307-6|CAM25933.1|  444|Homo sapiens tubulin beta polypeptid...   173   5e-43
BC103746-1|AAI03747.1|  444|Homo sapiens tubulin, beta protein.       173   5e-43
BC070326-1|AAH70326.1|  444|Homo sapiens tubulin, beta protein.       173   5e-43
BC021909-1|AAH21909.1|  444|Homo sapiens tubulin, beta protein.       173   5e-43
BC019924-1|AAH19924.1|  444|Homo sapiens tubulin, beta protein.       173   5e-43
BC015889-1|AAH15889.1|  266|Homo sapiens TUBB protein protein.        173   5e-43
BC013374-1|AAH13374.1|  444|Homo sapiens tubulin, beta protein.       173   5e-43
BC007605-1|AAH07605.1|  444|Homo sapiens tubulin, beta protein.       173   5e-43
BC005838-1|AAH05838.1|  444|Homo sapiens tubulin, beta protein.       173   5e-43
BC002347-1|AAH02347.1|  444|Homo sapiens tubulin, beta protein.       173   5e-43
BC001938-1|AAH01938.1|  444|Homo sapiens tubulin, beta protein.       173   5e-43
BC001896-1|AAH01896.1|  340|Homo sapiens TUBB protein protein.        173   5e-43
BA000025-69|BAB63321.1|  444|Homo sapiens Beta-tubulin protein.       173   5e-43
AL845353-25|CAI41894.1|  372|Homo sapiens tubulin, beta polypept...   173   5e-43
AL845353-24|CAI41893.1|  426|Homo sapiens tubulin, beta polypept...   173   5e-43
AL845353-23|CAI41892.1|  444|Homo sapiens tubulin, beta polypept...   173   5e-43
AL662848-9|CAI17442.1|  372|Homo sapiens tubulin, beta protein.       173   5e-43
AL662848-8|CAM24851.1|  426|Homo sapiens tubulin, beta protein.       173   5e-43
AL662848-7|CAI17441.1|  444|Homo sapiens tubulin, beta protein.       173   5e-43
AL662797-13|CAI18197.1|  372|Homo sapiens tubulin, beta protein.      173   5e-43
AL662797-12|CAM25516.1|  426|Homo sapiens tubulin, beta protein.      173   5e-43
AL662797-11|CAI18196.1|  444|Homo sapiens tubulin, beta protein.      173   5e-43
AF141349-1|AAD33873.1|  444|Homo sapiens beta-tubulin protein.        173   5e-43
AF070600-1|AAC28654.1|  444|Homo sapiens beta-tubulin protein.        173   5e-43
AF070593-1|AAC28650.1|  444|Homo sapiens beta-tubulin protein.        173   5e-43
AF070561-1|AAC28642.1|  444|Homo sapiens beta-tubulin protein.        173   5e-43
AB202098-1|BAE78618.1|  444|Homo sapiens beta 5-tubulin protein.      173   5e-43
AB103606-1|BAF31267.1|  444|Homo sapiens beta-tubulin protein pr...   173   5e-43
AB088100-1|BAC54932.1|  444|Homo sapiens tubulin, beta polypepti...   173   5e-43
AB062393-1|BAB93480.1|  444|Homo sapiens beta 5-tubulin protein.      173   5e-43
CR541958-1|CAG46756.1|  445|Homo sapiens TUBB protein.                173   7e-43
BT006971-1|AAP35617.1|  797|Homo sapiens tubulin, beta, 4 protein.    173   7e-43
BC047518-1|AAH47518.1|  280|Homo sapiens TUBB3 protein protein.       173   7e-43
BC003021-1|AAH03021.2|  450|Homo sapiens tubulin, beta 3 protein.     173   7e-43
BC001678-1|AAH01678.2|  406|Homo sapiens TUBB3 protein protein.       173   7e-43
BC000748-1|AAH00748.1|  450|Homo sapiens tubulin, beta 3 protein.     173   7e-43
AK223039-1|BAD96759.1|  450|Homo sapiens tubulin, beta, 4 varian...   173   7e-43
AF427491-1|AAL28094.1|  450|Homo sapiens class III beta tubulin ...   173   7e-43
BC002654-1|AAH02654.1|  446|Homo sapiens tubulin, beta 6 protein.     172   9e-43
AK022340-1|BAB14016.1|  446|Homo sapiens protein ( Homo sapiens ...   172   9e-43
U47634-1|AAC52035.1|  450|Homo sapiens beta-tubulin protein.          172   1e-42
BC111374-1|AAI11375.1|  447|Homo sapiens TUBB6 protein protein.       172   1e-42
X00734-1|CAA25318.1|  444|Homo sapiens tubulin 5-beta protein.        171   2e-42
BC020946-1|AAH20946.1|  444|Homo sapiens tubulin, beta protein.       171   2e-42
BC101271-1|AAI01272.1|  441|Homo sapiens TUBB8 protein protein.       170   4e-42
BC101270-1|AAI01271.1|  441|Homo sapiens TUBB8 protein protein.       170   4e-42
AL713922-4|CAI16221.1|  435|Homo sapiens novel protein similar t...   170   4e-42
AL713922-3|CAI16220.1|  410|Homo sapiens novel protein similar t...   170   4e-42
AF355127-1|AAL32434.1|  444|Homo sapiens beta-tubulin 4Q protein.     170   4e-42
V00599-1|CAA23844.1|  437|Homo sapiens protein ( Human mRNA frag...   168   2e-41
J00314-1|AAB59507.1|  444|Homo sapiens protein ( Human beta-tubu...   168   2e-41
U83668-1|AAB48456.1|  433|Homo sapiens beta-tubulin protein.          161   3e-39
U83110-1|AAB41497.1|  434|Homo sapiens beta-tubulin protein.          161   3e-39
BC062532-1|AAH62532.1|  124|Homo sapiens TUBB protein protein.        159   9e-39
BC033679-1|AAH33679.1|  451|Homo sapiens tubulin, beta 1 protein.     153   4e-37
AL109840-7|CAC09371.2|  451|Homo sapiens tubulin, beta 1 protein.     153   4e-37
AJ292757-1|CAC16605.1|  451|Homo sapiens protein ( Homo sapiens ...   153   4e-37
AL713922-2|CAI16219.1|  227|Homo sapiens novel protein similar t...   132   2e-30
EF036499-1|ABO65085.1|   88|Homo sapiens tubulin beta 2C protein.     110   5e-24
BC063036-1|AAH63036.1|  449|Homo sapiens tubulin, alpha 1c protein.    93   1e-18
BC051297-1|AAH51297.1|  449|Homo sapiens tubulin, alpha 1c protein.    93   1e-18
BC021088-1|AAH21088.1|  449|Homo sapiens tubulin, alpha 1c protein.    93   1e-18
BC019298-1|AAH19298.1|  449|Homo sapiens tubulin, alpha 1c protein.    93   1e-18
BC011790-1|AAH11790.1|  449|Homo sapiens tubulin, alpha 1c protein.    93   1e-18
BC005946-1|AAH05946.1|  449|Homo sapiens tubulin, alpha 1c protein.    93   1e-18
BC004949-1|AAH04949.1|  449|Homo sapiens tubulin, alpha 1c protein.    93   1e-18
AK223024-1|BAD96744.1|  449|Homo sapiens tubulin alpha 6 variant...    93   1e-18
X06956-1|CAA30026.1|  447|Homo sapiens alpha-tubulin protein.          91   3e-18
DQ422808-1|ABD72607.1|  450|Homo sapiens tubulin, alpha 2 protein.     91   3e-18
DQ400107-1|ABD60581.1|  451|Homo sapiens alpha tubulin protein.        91   3e-18
BT006731-1|AAP35377.1|  448|Homo sapiens tubulin, alpha 1 (testi...    91   3e-18
BC071904-1|AAH71904.1|  451|Homo sapiens tubulin, alpha 1b protein.    91   3e-18
BC057811-1|AAH57811.1|  450|Homo sapiens tubulin, alpha 3e protein.    91   3e-18
BC050637-1|AAH50637.1|  451|Homo sapiens tubulin, alpha 1a protein.    91   3e-18
BC030820-1|AAH30820.1|  451|Homo sapiens tubulin, alpha 1b protein.    91   3e-18
BC021564-1|AAH21564.1|  335|Homo sapiens TUBA1B protein protein.       91   3e-18
BC017004-1|AAH17004.1|  451|Homo sapiens tubulin, alpha 1b protein.    91   3e-18
BC015883-1|AAH15883.1|  451|Homo sapiens tubulin, alpha 1b protein.    91   3e-18
BC011721-1|AAH11721.1|  418|Homo sapiens tubulin, alpha 3c protein.    91   3e-18
BC011572-1|AAH11572.1|  451|Homo sapiens tubulin, alpha 1b protein.    91   3e-18
BC010494-1|AAH10494.1|  451|Homo sapiens tubulin, alpha 1b protein.    91   3e-18
BC009513-1|AAH09513.1|  451|Homo sapiens tubulin, alpha 1b protein.    91   3e-18
BC009512-1|AAH09512.1|  451|Homo sapiens tubulin, alpha 1b protein.    91   3e-18
BC009509-1|AAH09509.1|  451|Homo sapiens tubulin, alpha 1b protein.    91   3e-18
BC009314-1|AAH09314.1|  451|Homo sapiens tubulin, alpha 1b protein.    91   3e-18
BC009238-1|AAH09238.1|  448|Homo sapiens tubulin, alpha 4a protein.    91   3e-18
BC008659-1|AAH08659.1|  451|Homo sapiens tubulin, alpha 1b protein.    91   3e-18
BC006481-1|AAH06481.1|  451|Homo sapiens tubulin, alpha 1b protein.    91   3e-18
BC006468-1|AAH06468.1|  451|Homo sapiens tubulin, alpha 1a protein.    91   3e-18
BC006379-1|AAH06379.1|  451|Homo sapiens tubulin, alpha 1b protein.    91   3e-18
BC001128-1|AAH01128.1|  451|Homo sapiens tubulin, alpha 1b protein.    91   3e-18
BC000696-1|AAH00696.1|  451|Homo sapiens tubulin, alpha 1b protein.    91   3e-18
AY895018-1|AAW65371.1|  448|Homo sapiens tubulin, alpha 1 (testi...    91   3e-18
AL139327-3|CAH73534.1|  450|Homo sapiens tubulin, alpha 3c protein.    91   3e-18
AF141348-1|AAD33872.1|  328|Homo sapiens alpha-tubulin protein.        91   3e-18
AF141347-1|AAD33871.1|  451|Homo sapiens alpha-tubulin protein.        91   3e-18
AF081484-1|AAC31959.1|  451|Homo sapiens alpha-tubulin isoform 1...    91   3e-18
AF005392-1|AAC39578.1|  449|Homo sapiens alpha tubulin protein.        91   3e-18
CR456600-1|CAG30486.1|  449|Homo sapiens TUBA8 protein.                89   1e-17
BX537702-1|CAD97815.1|  479|Homo sapiens hypothetical protein pr...    89   1e-17
BC104845-1|AAI04846.1|  449|Homo sapiens tubulin, alpha 8 protein.     89   1e-17
BC074827-1|AAH74827.1|  449|Homo sapiens tubulin, alpha 8 protein.     89   1e-17
AJ245922-1|CAB88036.1|  449|Homo sapiens alpha-tubulin 8 protein.      89   1e-17
X01703-1|CAA25855.1|  451|Homo sapiens alpha-tubulin protein.          88   2e-17
K00558-1|AAA91576.1|  451|Homo sapiens protein ( human alpha-tub...    87   6e-17
K00557-1|AAA91575.1|  342|Homo sapiens alpha-tubulin protein.          87   6e-17
BC057810-1|AAH57810.1|  450|Homo sapiens tubulin, alpha 3d protein.    87   8e-17
BC105634-1|AAI05635.1|  446|Homo sapiens tubulin, alpha-like 3 p...    86   1e-16
BC099716-1|AAH99716.1|  446|Homo sapiens tubulin, alpha-like 3 p...    86   1e-16
BC098247-1|AAH98247.1|  406|Homo sapiens TUBAL3 protein protein.       86   1e-16
AL683826-2|CAI23625.1|  446|Homo sapiens tubulin, alpha-like 3 p...    86   1e-16
AK025318-1|BAB15110.1|  446|Homo sapiens protein ( Homo sapiens ...    86   1e-16
EF036509-1|ABO65095.1|   82|Homo sapiens beta-4 tubulin protein.       79   2e-14
BC001805-1|AAH01805.1|  198|Homo sapiens Unknown (protein for IM...    71   4e-12
M61764-1|AAA52620.1|  451|Homo sapiens gamma-tubulin protein.          60   7e-09
CR407642-1|CAG28570.1|  451|Homo sapiens TUBG1 protein.                60   7e-09
BT019931-1|AAV38734.1|  451|Homo sapiens tubulin, gamma 1 protein.     60   7e-09
BC141925-1|AAI41926.1|  253|Homo sapiens TUBB2A protein protein.       60   7e-09
BC127872-1|AAI27873.2|  188|Homo sapiens TUBB2B protein protein.       60   7e-09
BC108739-1|AAI08740.1|  451|Homo sapiens tubulin, gamma 2 protein.     60   7e-09
BC051890-1|AAH51890.1|  451|Homo sapiens tubulin, gamma 2 protein.     60   7e-09
BC009670-1|AAH09670.1|  451|Homo sapiens tubulin, gamma 2 protein.     60   7e-09
BC000619-1|AAH00619.1|  451|Homo sapiens tubulin, gamma 1 protein.     60   7e-09
AK022324-1|BAB14012.1|  451|Homo sapiens protein ( Homo sapiens ...    60   7e-09
AF225971-1|AAF34188.1|  451|Homo sapiens gamma-tubulin protein.        60   7e-09
Z99289-4|CAI42327.1|  475|Homo sapiens tubulin, epsilon 1 protein.     60   1e-08
BC031101-1|AAH31101.1|  475|Homo sapiens tubulin, epsilon 1 prot...    60   1e-08
BC025405-1|AAH25405.1|  475|Homo sapiens tubulin, epsilon 1 prot...    60   1e-08
AF201334-1|AAF09585.1|  475|Homo sapiens epsilon-tubulin protein.      60   1e-08
BC033064-1|AAH33064.1|  325|Homo sapiens TUBA1C protein protein.       58   2e-08
BC141924-1|AAI41925.1|  253|Homo sapiens TUBB2A protein protein.       58   3e-08
BC127874-1|AAI27875.1|  151|Homo sapiens Unknown (protein for IM...    57   7e-08
K03460-1|AAA36785.1|   98|Homo sapiens protein ( Human alpha-tub...    44   4e-04
L11645-1|AAA35521.1|   98|Homo sapiens alpha-tubulin protein.          44   5e-04
AJ400879-3|CAC35389.1| 1214|Homo sapiens KIAA0298 protein protein.     30   6.9  
AK024002-1|BAB14767.1|  241|Homo sapiens protein ( Homo sapiens ...    30   9.1  

>BC013683-1|AAH13683.1|  444|Homo sapiens tubulin, beta 4 protein.
          Length = 444

 Score =  175 bits (426), Expect = 1e-43
 Identities = 80/105 (76%), Positives = 89/105 (84%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLTSRG+QQYRALTVPELT QM
Sbjct: 234 SGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQM 293

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTKTA 316
           FDAKNMM ACDPRHGRYLTVA +FRG    K++       ++K +
Sbjct: 294 FDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLSVQSKNS 338



 Score =  161 bits (391), Expect = 2e-39
 Identities = 70/85 (82%), Positives = 80/85 (94%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GRMSMKEVDEQ+ ++Q+KNS+YFVEWIPNN K AVCDIPPRGLKMA+TFIGN+TAIQ +
Sbjct: 318 RGRMSMKEVDEQMLSVQSKNSSYFVEWIPNNVKTAVCDIPPRGLKMAATFIGNSTAIQEL 377

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           FKR+SEQF AMFRRKAFLHWYTGEG
Sbjct: 378 FKRISEQFTAMFRRKAFLHWYTGEG 402



 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 393 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 426


>BC006570-1|AAH06570.1|  444|Homo sapiens TUBB4 protein protein.
          Length = 444

 Score =  175 bits (426), Expect = 1e-43
 Identities = 80/105 (76%), Positives = 89/105 (84%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLTSRG+QQYRALTVPELT QM
Sbjct: 234 SGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQM 293

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTKTA 316
           FDAKNMM ACDPRHGRYLTVA +FRG    K++       ++K +
Sbjct: 294 FDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLSVQSKNS 338



 Score =  161 bits (391), Expect = 2e-39
 Identities = 70/85 (82%), Positives = 80/85 (94%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GRMSMKEVDEQ+ ++Q+KNS+YFVEWIPNN K AVCDIPPRGLKMA+TFIGN+TAIQ +
Sbjct: 318 RGRMSMKEVDEQMLSVQSKNSSYFVEWIPNNVKTAVCDIPPRGLKMAATFIGNSTAIQEL 377

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           FKR+SEQF AMFRRKAFLHWYTGEG
Sbjct: 378 FKRISEQFTAMFRRKAFLHWYTGEG 402



 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 393 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 426


>X02344-1|CAA26203.1|  445|Homo sapiens beta-tubulin protein.
          Length = 445

 Score =  175 bits (425), Expect = 2e-43
 Identities = 78/86 (90%), Positives = 82/86 (95%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLTSRG+QQYRALTVPELT QM
Sbjct: 234 SGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQM 293

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRG 259
           FDAKNMM ACDPRHGRYLTVA +FRG
Sbjct: 294 FDAKNMMAACDPRHGRYLTVAAVFRG 319



 Score =  164 bits (398), Expect = 3e-40
 Identities = 71/85 (83%), Positives = 80/85 (94%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GRMSMKEVDEQ+ N+QNKNS+YFVEWIPNN K AVCDIPPRGLKM++TFIGN+TAIQ +
Sbjct: 318 RGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQEL 377

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           FKR+SEQF AMFRRKAFLHWYTGEG
Sbjct: 378 FKRISEQFTAMFRRKAFLHWYTGEG 402



 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 393 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 426


>BX255925-3|CAM24148.1|  445|Homo sapiens tubulin, beta 2C protein.
          Length = 445

 Score =  175 bits (425), Expect = 2e-43
 Identities = 78/86 (90%), Positives = 82/86 (95%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLTSRG+QQYRALTVPELT QM
Sbjct: 234 SGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQM 293

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRG 259
           FDAKNMM ACDPRHGRYLTVA +FRG
Sbjct: 294 FDAKNMMAACDPRHGRYLTVAAVFRG 319



 Score =  164 bits (398), Expect = 3e-40
 Identities = 71/85 (83%), Positives = 80/85 (94%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GRMSMKEVDEQ+ N+QNKNS+YFVEWIPNN K AVCDIPPRGLKM++TFIGN+TAIQ +
Sbjct: 318 RGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQEL 377

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           FKR+SEQF AMFRRKAFLHWYTGEG
Sbjct: 378 FKRISEQFTAMFRRKAFLHWYTGEG 402



 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 393 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 426


>BC071889-1|AAH71889.1|  445|Homo sapiens tubulin, beta 2C protein.
          Length = 445

 Score =  175 bits (425), Expect = 2e-43
 Identities = 78/86 (90%), Positives = 82/86 (95%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLTSRG+QQYRALTVPELT QM
Sbjct: 234 SGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQM 293

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRG 259
           FDAKNMM ACDPRHGRYLTVA +FRG
Sbjct: 294 FDAKNMMAACDPRHGRYLTVAAVFRG 319



 Score =  164 bits (398), Expect = 3e-40
 Identities = 71/85 (83%), Positives = 80/85 (94%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GRMSMKEVDEQ+ N+QNKNS+YFVEWIPNN K AVCDIPPRGLKM++TFIGN+TAIQ +
Sbjct: 318 RGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQEL 377

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           FKR+SEQF AMFRRKAFLHWYTGEG
Sbjct: 378 FKRISEQFTAMFRRKAFLHWYTGEG 402



 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 393 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 426


>BC039175-1|AAH39175.1|  445|Homo sapiens tubulin, beta 2C protein.
          Length = 445

 Score =  175 bits (425), Expect = 2e-43
 Identities = 78/86 (90%), Positives = 82/86 (95%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLTSRG+QQYRALTVPELT QM
Sbjct: 234 SGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQM 293

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRG 259
           FDAKNMM ACDPRHGRYLTVA +FRG
Sbjct: 294 FDAKNMMAACDPRHGRYLTVAAVFRG 319



 Score =  164 bits (398), Expect = 3e-40
 Identities = 71/85 (83%), Positives = 80/85 (94%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GRMSMKEVDEQ+ N+QNKNS+YFVEWIPNN K AVCDIPPRGLKM++TFIGN+TAIQ +
Sbjct: 318 RGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQEL 377

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           FKR+SEQF AMFRRKAFLHWYTGEG
Sbjct: 378 FKRISEQFTAMFRRKAFLHWYTGEG 402



 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 393 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 426


>BC029529-1|AAH29529.1|  445|Homo sapiens tubulin, beta 2C protein.
          Length = 445

 Score =  175 bits (425), Expect = 2e-43
 Identities = 78/86 (90%), Positives = 82/86 (95%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLTSRG+QQYRALTVPELT QM
Sbjct: 234 SGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQM 293

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRG 259
           FDAKNMM ACDPRHGRYLTVA +FRG
Sbjct: 294 FDAKNMMAACDPRHGRYLTVAAVFRG 319



 Score =  164 bits (398), Expect = 3e-40
 Identities = 71/85 (83%), Positives = 80/85 (94%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GRMSMKEVDEQ+ N+QNKNS+YFVEWIPNN K AVCDIPPRGLKM++TFIGN+TAIQ +
Sbjct: 318 RGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQEL 377

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           FKR+SEQF AMFRRKAFLHWYTGEG
Sbjct: 378 FKRISEQFTAMFRRKAFLHWYTGEG 402



 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 393 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 426


>BC024038-1|AAH24038.1|  445|Homo sapiens tubulin, beta 2C protein.
          Length = 445

 Score =  175 bits (425), Expect = 2e-43
 Identities = 78/86 (90%), Positives = 82/86 (95%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLTSRG+QQYRALTVPELT QM
Sbjct: 234 SGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQM 293

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRG 259
           FDAKNMM ACDPRHGRYLTVA +FRG
Sbjct: 294 FDAKNMMAACDPRHGRYLTVAAVFRG 319



 Score =  164 bits (398), Expect = 3e-40
 Identities = 71/85 (83%), Positives = 80/85 (94%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GRMSMKEVDEQ+ N+QNKNS+YFVEWIPNN K AVCDIPPRGLKM++TFIGN+TAIQ +
Sbjct: 318 RGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQEL 377

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           FKR+SEQF AMFRRKAFLHWYTGEG
Sbjct: 378 FKRISEQFTAMFRRKAFLHWYTGEG 402



 Score = 52.4 bits (120), Expect = 1e-06
 Identities = 25/34 (73%), Positives = 27/34 (79%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQ YQ
Sbjct: 393 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQHYQ 426


>BC019829-1|AAH19829.1|  445|Homo sapiens tubulin, beta 2C protein.
          Length = 445

 Score =  175 bits (425), Expect = 2e-43
 Identities = 78/86 (90%), Positives = 82/86 (95%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLTSRG+QQYRALTVPELT QM
Sbjct: 234 SGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQM 293

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRG 259
           FDAKNMM ACDPRHGRYLTVA +FRG
Sbjct: 294 FDAKNMMAACDPRHGRYLTVAAVFRG 319



 Score =  164 bits (398), Expect = 3e-40
 Identities = 71/85 (83%), Positives = 80/85 (94%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GRMSMKEVDEQ+ N+QNKNS+YFVEWIPNN K AVCDIPPRGLKM++TFIGN+TAIQ +
Sbjct: 318 RGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQEL 377

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           FKR+SEQF AMFRRKAFLHWYTGEG
Sbjct: 378 FKRISEQFTAMFRRKAFLHWYTGEG 402



 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 393 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 426


>BC019359-1|AAH19359.1|  445|Homo sapiens tubulin, beta 2C protein.
          Length = 445

 Score =  175 bits (425), Expect = 2e-43
 Identities = 78/86 (90%), Positives = 82/86 (95%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLTSRG+QQYRALTVPELT QM
Sbjct: 234 SGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQM 293

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRG 259
           FDAKNMM ACDPRHGRYLTVA +FRG
Sbjct: 294 FDAKNMMAACDPRHGRYLTVAAVFRG 319



 Score =  164 bits (398), Expect = 3e-40
 Identities = 71/85 (83%), Positives = 80/85 (94%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GRMSMKEVDEQ+ N+QNKNS+YFVEWIPNN K AVCDIPPRGLKM++TFIGN+TAIQ +
Sbjct: 318 RGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQEL 377

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           FKR+SEQF AMFRRKAFLHWYTGEG
Sbjct: 378 FKRISEQFTAMFRRKAFLHWYTGEG 402



 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 393 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 426


>BC012835-1|AAH12835.1|  445|Homo sapiens tubulin, beta 2C protein.
          Length = 445

 Score =  175 bits (425), Expect = 2e-43
 Identities = 78/86 (90%), Positives = 82/86 (95%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLTSRG+QQYRALTVPELT QM
Sbjct: 234 SGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQM 293

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRG 259
           FDAKNMM ACDPRHGRYLTVA +FRG
Sbjct: 294 FDAKNMMAACDPRHGRYLTVAAVFRG 319



 Score =  164 bits (398), Expect = 3e-40
 Identities = 71/85 (83%), Positives = 80/85 (94%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GRMSMKEVDEQ+ N+QNKNS+YFVEWIPNN K AVCDIPPRGLKM++TFIGN+TAIQ +
Sbjct: 318 RGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQEL 377

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           FKR+SEQF AMFRRKAFLHWYTGEG
Sbjct: 378 FKRISEQFTAMFRRKAFLHWYTGEG 402



 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 393 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 426


>BC008006-1|AAH08006.1|  227|Homo sapiens TUBB2C protein protein.
          Length = 227

 Score =  175 bits (425), Expect = 2e-43
 Identities = 78/86 (90%), Positives = 82/86 (95%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLTSRG+QQYRALTVPELT QM
Sbjct: 16  SGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQM 75

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRG 259
           FDAKNMM ACDPRHGRYLTVA +FRG
Sbjct: 76  FDAKNMMAACDPRHGRYLTVAAVFRG 101



 Score =  164 bits (398), Expect = 3e-40
 Identities = 71/85 (83%), Positives = 80/85 (94%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GRMSMKEVDEQ+ N+QNKNS+YFVEWIPNN K AVCDIPPRGLKM++TFIGN+TAIQ +
Sbjct: 100 RGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQEL 159

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           FKR+SEQF AMFRRKAFLHWYTGEG
Sbjct: 160 FKRISEQFTAMFRRKAFLHWYTGEG 184



 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 175 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 208


>BC007889-1|AAH07889.1|  445|Homo sapiens tubulin, beta 2C protein.
          Length = 445

 Score =  175 bits (425), Expect = 2e-43
 Identities = 78/86 (90%), Positives = 82/86 (95%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLTSRG+QQYRALTVPELT QM
Sbjct: 234 SGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQM 293

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRG 259
           FDAKNMM ACDPRHGRYLTVA +FRG
Sbjct: 294 FDAKNMMAACDPRHGRYLTVAAVFRG 319



 Score =  164 bits (398), Expect = 3e-40
 Identities = 71/85 (83%), Positives = 80/85 (94%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GRMSMKEVDEQ+ N+QNKNS+YFVEWIPNN K AVCDIPPRGLKM++TFIGN+TAIQ +
Sbjct: 318 RGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQEL 377

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           FKR+SEQF AMFRRKAFLHWYTGEG
Sbjct: 378 FKRISEQFTAMFRRKAFLHWYTGEG 402



 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 393 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 426


>BC004188-1|AAH04188.1|  445|Homo sapiens tubulin, beta 2C protein.
          Length = 445

 Score =  175 bits (425), Expect = 2e-43
 Identities = 78/86 (90%), Positives = 82/86 (95%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLTSRG+QQYRALTVPELT QM
Sbjct: 234 SGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQM 293

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRG 259
           FDAKNMM ACDPRHGRYLTVA +FRG
Sbjct: 294 FDAKNMMAACDPRHGRYLTVAAVFRG 319



 Score =  164 bits (398), Expect = 3e-40
 Identities = 71/85 (83%), Positives = 80/85 (94%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GRMSMKEVDEQ+ N+QNKNS+YFVEWIPNN K AVCDIPPRGLKM++TFIGN+TAIQ +
Sbjct: 318 RGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQEL 377

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           FKR+SEQF AMFRRKAFLHWYTGEG
Sbjct: 378 FKRISEQFTAMFRRKAFLHWYTGEG 402



 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 393 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 426


>BC002885-1|AAH02885.1|  445|Homo sapiens tubulin, beta 2C protein.
          Length = 445

 Score =  175 bits (425), Expect = 2e-43
 Identities = 78/86 (90%), Positives = 82/86 (95%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLTSRG+QQYRALTVPELT QM
Sbjct: 234 SGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQM 293

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRG 259
           FDAKNMM ACDPRHGRYLTVA +FRG
Sbjct: 294 FDAKNMMAACDPRHGRYLTVAAVFRG 319



 Score =  164 bits (398), Expect = 3e-40
 Identities = 71/85 (83%), Positives = 80/85 (94%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GRMSMKEVDEQ+ N+QNKNS+YFVEWIPNN K AVCDIPPRGLKM++TFIGN+TAIQ +
Sbjct: 318 RGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQEL 377

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           FKR+SEQF AMFRRKAFLHWYTGEG
Sbjct: 378 FKRISEQFTAMFRRKAFLHWYTGEG 402



 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 393 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 426


>BC002783-1|AAH02783.1|  445|Homo sapiens tubulin, beta 2C protein.
          Length = 445

 Score =  175 bits (425), Expect = 2e-43
 Identities = 78/86 (90%), Positives = 82/86 (95%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLTSRG+QQYRALTVPELT QM
Sbjct: 234 SGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQM 293

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRG 259
           FDAKNMM ACDPRHGRYLTVA +FRG
Sbjct: 294 FDAKNMMAACDPRHGRYLTVAAVFRG 319



 Score =  164 bits (398), Expect = 3e-40
 Identities = 71/85 (83%), Positives = 80/85 (94%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GRMSMKEVDEQ+ N+QNKNS+YFVEWIPNN K AVCDIPPRGLKM++TFIGN+TAIQ +
Sbjct: 318 RGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQEL 377

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           FKR+SEQF AMFRRKAFLHWYTGEG
Sbjct: 378 FKRISEQFTAMFRRKAFLHWYTGEG 402



 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 393 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 426


>BC001911-1|AAH01911.1|  445|Homo sapiens tubulin, beta 2C protein.
          Length = 445

 Score =  175 bits (425), Expect = 2e-43
 Identities = 78/86 (90%), Positives = 82/86 (95%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLTSRG+QQYRALTVPELT QM
Sbjct: 234 SGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQM 293

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRG 259
           FDAKNMM ACDPRHGRYLTVA +FRG
Sbjct: 294 FDAKNMMAACDPRHGRYLTVAAVFRG 319



 Score =  164 bits (398), Expect = 3e-40
 Identities = 71/85 (83%), Positives = 80/85 (94%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GRMSMKEVDEQ+ N+QNKNS+YFVEWIPNN K AVCDIPPRGLKM++TFIGN+TAIQ +
Sbjct: 318 RGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQEL 377

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           FKR+SEQF AMFRRKAFLHWYTGEG
Sbjct: 378 FKRISEQFTAMFRRKAFLHWYTGEG 402



 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 393 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 426


>AY167990-1|AAN87335.1|  445|Homo sapiens class IVb beta tubulin
           protein.
          Length = 445

 Score =  175 bits (425), Expect = 2e-43
 Identities = 78/86 (90%), Positives = 82/86 (95%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLTSRG+QQYRALTVPELT QM
Sbjct: 234 SGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQM 293

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRG 259
           FDAKNMM ACDPRHGRYLTVA +FRG
Sbjct: 294 FDAKNMMAACDPRHGRYLTVAAVFRG 319



 Score =  160 bits (389), Expect = 4e-39
 Identities = 70/85 (82%), Positives = 78/85 (91%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GRMSMKEVDEQ+ N+QNKNS+YFVEWIPNN K AVCDIPPRGLKM +TFIGN+TAIQ +
Sbjct: 318 RGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMPATFIGNSTAIQEL 377

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           FKR+SEQF AMFRRKAF HWYTGEG
Sbjct: 378 FKRISEQFTAMFRRKAFPHWYTGEG 402



 Score = 53.2 bits (122), Expect = 9e-07
 Identities = 26/34 (76%), Positives = 27/34 (79%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A  HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 393 AFPHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 426


>X79535-1|CAA56071.1|  445|Homo sapiens beta tubulin protein.
          Length = 445

 Score =  174 bits (423), Expect = 3e-43
 Identities = 78/86 (90%), Positives = 82/86 (95%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLTSRG+QQYRALTVPELT QM
Sbjct: 234 SGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQM 293

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRG 259
           FD+KNMM ACDPRHGRYLTVA IFRG
Sbjct: 294 FDSKNMMAACDPRHGRYLTVAAIFRG 319



 Score =  164 bits (398), Expect = 3e-40
 Identities = 71/85 (83%), Positives = 80/85 (94%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GRMSMKEVDEQ+ N+QNKNS+YFVEWIPNN K AVCDIPPRGLKM++TFIGN+TAIQ +
Sbjct: 318 RGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQEL 377

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           FKR+SEQF AMFRRKAFLHWYTGEG
Sbjct: 378 FKRISEQFTAMFRRKAFLHWYTGEG 402



 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 393 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 426


>CR456788-1|CAG33069.1|  445|Homo sapiens MGC8685 protein.
          Length = 445

 Score =  174 bits (423), Expect = 3e-43
 Identities = 78/86 (90%), Positives = 82/86 (95%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLTSRG+QQYRALTVPELT QM
Sbjct: 234 SGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQM 293

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRG 259
           FD+KNMM ACDPRHGRYLTVA IFRG
Sbjct: 294 FDSKNMMAACDPRHGRYLTVAAIFRG 319



 Score =  164 bits (398), Expect = 3e-40
 Identities = 71/85 (83%), Positives = 80/85 (94%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GRMSMKEVDEQ+ N+QNKNS+YFVEWIPNN K AVCDIPPRGLKM++TFIGN+TAIQ +
Sbjct: 318 RGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQEL 377

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           FKR+SEQF AMFRRKAFLHWYTGEG
Sbjct: 378 FKRISEQFTAMFRRKAFLHWYTGEG 402



 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 393 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 426


>BT019930-1|AAV38733.1|  445|Homo sapiens tubulin, beta polypeptide
           paralog protein.
          Length = 445

 Score =  174 bits (423), Expect = 3e-43
 Identities = 78/86 (90%), Positives = 82/86 (95%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLTSRG+QQYRALTVPELT QM
Sbjct: 234 SGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQM 293

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRG 259
           FD+KNMM ACDPRHGRYLTVA IFRG
Sbjct: 294 FDSKNMMAACDPRHGRYLTVAAIFRG 319



 Score =  164 bits (398), Expect = 3e-40
 Identities = 71/85 (83%), Positives = 80/85 (94%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GRMSMKEVDEQ+ N+QNKNS+YFVEWIPNN K AVCDIPPRGLKM++TFIGN+TAIQ +
Sbjct: 318 RGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQEL 377

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           FKR+SEQF AMFRRKAFLHWYTGEG
Sbjct: 378 FKRISEQFTAMFRRKAFLHWYTGEG 402



 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 393 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 426


>BC063610-1|AAH63610.1|  445|Homo sapiens tubulin, beta 2B protein.
          Length = 445

 Score =  174 bits (423), Expect = 3e-43
 Identities = 78/86 (90%), Positives = 82/86 (95%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLTSRG+QQYRALTVPELT QM
Sbjct: 234 SGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQM 293

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRG 259
           FD+KNMM ACDPRHGRYLTVA IFRG
Sbjct: 294 FDSKNMMAACDPRHGRYLTVAAIFRG 319



 Score =  164 bits (398), Expect = 3e-40
 Identities = 71/85 (83%), Positives = 80/85 (94%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GRMSMKEVDEQ+ N+QNKNS+YFVEWIPNN K AVCDIPPRGLKM++TFIGN+TAIQ +
Sbjct: 318 RGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQEL 377

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           FKR+SEQF AMFRRKAFLHWYTGEG
Sbjct: 378 FKRISEQFTAMFRRKAFLHWYTGEG 402



 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 393 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 426


>BC018780-1|AAH18780.1|  445|Homo sapiens tubulin, beta 2A protein.
          Length = 445

 Score =  174 bits (423), Expect = 3e-43
 Identities = 78/86 (90%), Positives = 82/86 (95%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLTSRG+QQYRALTVPELT QM
Sbjct: 234 SGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQM 293

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRG 259
           FD+KNMM ACDPRHGRYLTVA IFRG
Sbjct: 294 FDSKNMMAACDPRHGRYLTVAAIFRG 319



 Score =  164 bits (398), Expect = 3e-40
 Identities = 71/85 (83%), Positives = 80/85 (94%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GRMSMKEVDEQ+ N+QNKNS+YFVEWIPNN K AVCDIPPRGLKM++TFIGN+TAIQ +
Sbjct: 318 RGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQEL 377

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           FKR+SEQF AMFRRKAFLHWYTGEG
Sbjct: 378 FKRISEQFTAMFRRKAFLHWYTGEG 402



 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 393 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 426


>BC001352-1|AAH01352.1|  445|Homo sapiens tubulin, beta 2B protein.
          Length = 445

 Score =  174 bits (423), Expect = 3e-43
 Identities = 78/86 (90%), Positives = 82/86 (95%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLTSRG+QQYRALTVPELT QM
Sbjct: 234 SGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQM 293

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRG 259
           FD+KNMM ACDPRHGRYLTVA IFRG
Sbjct: 294 FDSKNMMAACDPRHGRYLTVAAIFRG 319



 Score =  164 bits (398), Expect = 3e-40
 Identities = 71/85 (83%), Positives = 80/85 (94%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GRMSMKEVDEQ+ N+QNKNS+YFVEWIPNN K AVCDIPPRGLKM++TFIGN+TAIQ +
Sbjct: 318 RGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQEL 377

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           FKR+SEQF AMFRRKAFLHWYTGEG
Sbjct: 378 FKRISEQFTAMFRRKAFLHWYTGEG 402



 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 393 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 426


>BC001194-1|AAH01194.1|  445|Homo sapiens tubulin, beta 2A protein.
          Length = 445

 Score =  174 bits (423), Expect = 3e-43
 Identities = 78/86 (90%), Positives = 82/86 (95%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLTSRG+QQYRALTVPELT QM
Sbjct: 234 SGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQM 293

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRG 259
           FD+KNMM ACDPRHGRYLTVA IFRG
Sbjct: 294 FDSKNMMAACDPRHGRYLTVAAIFRG 319



 Score =  164 bits (398), Expect = 3e-40
 Identities = 71/85 (83%), Positives = 80/85 (94%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GRMSMKEVDEQ+ N+QNKNS+YFVEWIPNN K AVCDIPPRGLKM++TFIGN+TAIQ +
Sbjct: 318 RGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQEL 377

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           FKR+SEQF AMFRRKAFLHWYTGEG
Sbjct: 378 FKRISEQFTAMFRRKAFLHWYTGEG 402



 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 393 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 426


>AY159127-1|AAN85571.1|  445|Homo sapiens class II beta tubulin
           isotype protein.
          Length = 445

 Score =  174 bits (423), Expect = 3e-43
 Identities = 78/86 (90%), Positives = 82/86 (95%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLTSRG+QQYRALTVPELT QM
Sbjct: 234 SGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQM 293

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRG 259
           FD+KNMM ACDPRHGRYLTVA IFRG
Sbjct: 294 FDSKNMMAACDPRHGRYLTVAAIFRG 319



 Score =  164 bits (398), Expect = 3e-40
 Identities = 71/85 (83%), Positives = 80/85 (94%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GRMSMKEVDEQ+ N+QNKNS+YFVEWIPNN K AVCDIPPRGLKM++TFIGN+TAIQ +
Sbjct: 318 RGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQEL 377

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           FKR+SEQF AMFRRKAFLHWYTGEG
Sbjct: 378 FKRISEQFTAMFRRKAFLHWYTGEG 402



 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 393 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 426


>AL445309-1|CAI40952.1|  445|Homo sapiens RP11-506K6.1 protein.
          Length = 445

 Score =  174 bits (423), Expect = 3e-43
 Identities = 78/86 (90%), Positives = 82/86 (95%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLTSRG+QQYRALTVPELT QM
Sbjct: 234 SGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQM 293

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRG 259
           FD+KNMM ACDPRHGRYLTVA IFRG
Sbjct: 294 FDSKNMMAACDPRHGRYLTVAAIFRG 319



 Score =  164 bits (398), Expect = 3e-40
 Identities = 71/85 (83%), Positives = 80/85 (94%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GRMSMKEVDEQ+ N+QNKNS+YFVEWIPNN K AVCDIPPRGLKM++TFIGN+TAIQ +
Sbjct: 318 RGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQEL 377

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           FKR+SEQF AMFRRKAFLHWYTGEG
Sbjct: 378 FKRISEQFTAMFRRKAFLHWYTGEG 402



 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 393 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 426


>AL050056-1|CAB43252.1|  325|Homo sapiens hypothetical protein
           protein.
          Length = 325

 Score =  174 bits (423), Expect = 3e-43
 Identities = 78/86 (90%), Positives = 82/86 (95%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLTSRG+QQYRALTVPELT QM
Sbjct: 114 SGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQM 173

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRG 259
           FD+KNMM ACDPRHGRYLTVA IFRG
Sbjct: 174 FDSKNMMAACDPRHGRYLTVAAIFRG 199



 Score =  162 bits (394), Expect = 9e-40
 Identities = 70/85 (82%), Positives = 79/85 (92%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GRMSMKEVDEQ+ N+QNKNS+YFVEWIPNN K AVCDIPPRGLKM++TFIGN+TAIQ +
Sbjct: 198 RGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQEL 257

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           FKR+SEQF  MFRRKAFLHWYTGEG
Sbjct: 258 FKRISEQFTTMFRRKAFLHWYTGEG 282



 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 273 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 306


>AL031963-6|CAD70628.1|  445|Homo sapiens protein ( Human DNA
           sequence from clone RP1-40E16 on chromosome 6p24.1-25.3 
           Contains the gene for a novel protein similar to D.
           melanogaster  ).
          Length = 445

 Score =  174 bits (423), Expect = 3e-43
 Identities = 78/86 (90%), Positives = 82/86 (95%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLTSRG+QQYRALTVPELT QM
Sbjct: 234 SGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQM 293

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRG 259
           FD+KNMM ACDPRHGRYLTVA IFRG
Sbjct: 294 FDSKNMMAACDPRHGRYLTVAAIFRG 319



 Score =  164 bits (398), Expect = 3e-40
 Identities = 71/85 (83%), Positives = 80/85 (94%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GRMSMKEVDEQ+ N+QNKNS+YFVEWIPNN K AVCDIPPRGLKM++TFIGN+TAIQ +
Sbjct: 318 RGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQEL 377

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           FKR+SEQF AMFRRKAFLHWYTGEG
Sbjct: 378 FKRISEQFTAMFRRKAFLHWYTGEG 402



 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 393 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 426


>AF035316-1|AAB88188.1|  342|Homo sapiens protein ( Homo sapiens
           clone 23678 mRNA, partial cds. ).
          Length = 342

 Score =  174 bits (423), Expect = 3e-43
 Identities = 78/86 (90%), Positives = 82/86 (95%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLTSRG+QQYRALTVPELT QM
Sbjct: 131 SGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQM 190

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRG 259
           FD+KNMM ACDPRHGRYLTVA IFRG
Sbjct: 191 FDSKNMMAACDPRHGRYLTVAAIFRG 216



 Score =  164 bits (398), Expect = 3e-40
 Identities = 71/85 (83%), Positives = 80/85 (94%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GRMSMKEVDEQ+ N+QNKNS+YFVEWIPNN K AVCDIPPRGLKM++TFIGN+TAIQ +
Sbjct: 215 RGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQEL 274

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           FKR+SEQF AMFRRKAFLHWYTGEG
Sbjct: 275 FKRISEQFTAMFRRKAFLHWYTGEG 299



 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 290 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 323


>DQ457058-1|ABE96641.1|  208|Homo sapiens XTP3TPA-transactivated
           protein 1 protein.
          Length = 208

 Score =  173 bits (421), Expect = 5e-43
 Identities = 77/86 (89%), Positives = 82/86 (95%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLTSRG+QQYRALTVPELT Q+
Sbjct: 88  SGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQV 147

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRG 259
           FDAKNMM ACDPRHGRYLTVA +FRG
Sbjct: 148 FDAKNMMAACDPRHGRYLTVAAVFRG 173



 Score = 59.7 bits (138), Expect = 1e-08
 Identities = 24/33 (72%), Positives = 29/33 (87%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCK 351
           +GRMSMKEVDEQ+ N+QNKNS+YFVEW P  C+
Sbjct: 172 RGRMSMKEVDEQMLNVQNKNSSYFVEWNPPQCQ 204


>BX248307-8|CAM25935.1|  372|Homo sapiens tubulin beta polypeptide
           protein.
          Length = 372

 Score =  173 bits (421), Expect = 5e-43
 Identities = 77/86 (89%), Positives = 82/86 (95%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLTSRG+QQYRALTVPELT Q+
Sbjct: 162 SGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQV 221

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRG 259
           FDAKNMM ACDPRHGRYLTVA +FRG
Sbjct: 222 FDAKNMMAACDPRHGRYLTVAAVFRG 247



 Score =  164 bits (398), Expect = 3e-40
 Identities = 72/85 (84%), Positives = 79/85 (92%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GRMSMKEVDEQ+ N+QNKNS+YFVEWIPNN K AVCDIPPRGLKMA TFIGN+TAIQ +
Sbjct: 246 RGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNSTAIQEL 305

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           FKR+SEQF AMFRRKAFLHWYTGEG
Sbjct: 306 FKRISEQFTAMFRRKAFLHWYTGEG 330



 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 321 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 354


>BX248307-7|CAM25934.1|  426|Homo sapiens tubulin beta polypeptide
           protein.
          Length = 426

 Score =  173 bits (421), Expect = 5e-43
 Identities = 77/86 (89%), Positives = 82/86 (95%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLTSRG+QQYRALTVPELT Q+
Sbjct: 216 SGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQV 275

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRG 259
           FDAKNMM ACDPRHGRYLTVA +FRG
Sbjct: 276 FDAKNMMAACDPRHGRYLTVAAVFRG 301



 Score =  164 bits (398), Expect = 3e-40
 Identities = 72/85 (84%), Positives = 79/85 (92%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GRMSMKEVDEQ+ N+QNKNS+YFVEWIPNN K AVCDIPPRGLKMA TFIGN+TAIQ +
Sbjct: 300 RGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNSTAIQEL 359

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           FKR+SEQF AMFRRKAFLHWYTGEG
Sbjct: 360 FKRISEQFTAMFRRKAFLHWYTGEG 384



 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 375 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 408


>BX248307-6|CAM25933.1|  444|Homo sapiens tubulin beta polypeptide
           protein.
          Length = 444

 Score =  173 bits (421), Expect = 5e-43
 Identities = 77/86 (89%), Positives = 82/86 (95%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLTSRG+QQYRALTVPELT Q+
Sbjct: 234 SGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQV 293

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRG 259
           FDAKNMM ACDPRHGRYLTVA +FRG
Sbjct: 294 FDAKNMMAACDPRHGRYLTVAAVFRG 319



 Score =  164 bits (398), Expect = 3e-40
 Identities = 72/85 (84%), Positives = 79/85 (92%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GRMSMKEVDEQ+ N+QNKNS+YFVEWIPNN K AVCDIPPRGLKMA TFIGN+TAIQ +
Sbjct: 318 RGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNSTAIQEL 377

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           FKR+SEQF AMFRRKAFLHWYTGEG
Sbjct: 378 FKRISEQFTAMFRRKAFLHWYTGEG 402



 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 393 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 426


>BC103746-1|AAI03747.1|  444|Homo sapiens tubulin, beta protein.
          Length = 444

 Score =  173 bits (421), Expect = 5e-43
 Identities = 77/86 (89%), Positives = 82/86 (95%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLTSRG+QQYRALTVPELT Q+
Sbjct: 234 SGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQV 293

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRG 259
           FDAKNMM ACDPRHGRYLTVA +FRG
Sbjct: 294 FDAKNMMAACDPRHGRYLTVAAVFRG 319



 Score =  164 bits (398), Expect = 3e-40
 Identities = 72/85 (84%), Positives = 79/85 (92%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GRMSMKEVDEQ+ N+QNKNS+YFVEWIPNN K AVCDIPPRGLKMA TFIGN+TAIQ +
Sbjct: 318 RGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNSTAIQEL 377

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           FKR+SEQF AMFRRKAFLHWYTGEG
Sbjct: 378 FKRISEQFTAMFRRKAFLHWYTGEG 402



 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 393 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 426


>BC070326-1|AAH70326.1|  444|Homo sapiens tubulin, beta protein.
          Length = 444

 Score =  173 bits (421), Expect = 5e-43
 Identities = 77/86 (89%), Positives = 82/86 (95%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLTSRG+QQYRALTVPELT Q+
Sbjct: 234 SGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQV 293

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRG 259
           FDAKNMM ACDPRHGRYLTVA +FRG
Sbjct: 294 FDAKNMMAACDPRHGRYLTVAAVFRG 319



 Score =  164 bits (398), Expect = 3e-40
 Identities = 72/85 (84%), Positives = 79/85 (92%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GRMSMKEVDEQ+ N+QNKNS+YFVEWIPNN K AVCDIPPRGLKMA TFIGN+TAIQ +
Sbjct: 318 RGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNSTAIQEL 377

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           FKR+SEQF AMFRRKAFLHWYTGEG
Sbjct: 378 FKRISEQFTAMFRRKAFLHWYTGEG 402



 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 393 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 426


>BC021909-1|AAH21909.1|  444|Homo sapiens tubulin, beta protein.
          Length = 444

 Score =  173 bits (421), Expect = 5e-43
 Identities = 77/86 (89%), Positives = 82/86 (95%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLTSRG+QQYRALTVPELT Q+
Sbjct: 234 SGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQV 293

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRG 259
           FDAKNMM ACDPRHGRYLTVA +FRG
Sbjct: 294 FDAKNMMAACDPRHGRYLTVAAVFRG 319



 Score =  164 bits (398), Expect = 3e-40
 Identities = 72/85 (84%), Positives = 79/85 (92%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GRMSMKEVDEQ+ N+QNKNS+YFVEWIPNN K AVCDIPPRGLKMA TFIGN+TAIQ +
Sbjct: 318 RGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNSTAIQEL 377

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           FKR+SEQF AMFRRKAFLHWYTGEG
Sbjct: 378 FKRISEQFTAMFRRKAFLHWYTGEG 402



 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 393 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 426


>BC019924-1|AAH19924.1|  444|Homo sapiens tubulin, beta protein.
          Length = 444

 Score =  173 bits (421), Expect = 5e-43
 Identities = 77/86 (89%), Positives = 82/86 (95%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLTSRG+QQYRALTVPELT Q+
Sbjct: 234 SGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQV 293

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRG 259
           FDAKNMM ACDPRHGRYLTVA +FRG
Sbjct: 294 FDAKNMMAACDPRHGRYLTVAAVFRG 319



 Score =  164 bits (398), Expect = 3e-40
 Identities = 72/85 (84%), Positives = 79/85 (92%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GRMSMKEVDEQ+ N+QNKNS+YFVEWIPNN K AVCDIPPRGLKMA TFIGN+TAIQ +
Sbjct: 318 RGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNSTAIQEL 377

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           FKR+SEQF AMFRRKAFLHWYTGEG
Sbjct: 378 FKRISEQFTAMFRRKAFLHWYTGEG 402



 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 393 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 426


>BC015889-1|AAH15889.1|  266|Homo sapiens TUBB protein protein.
          Length = 266

 Score =  173 bits (421), Expect = 5e-43
 Identities = 77/86 (89%), Positives = 82/86 (95%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLTSRG+QQYRALTVPELT Q+
Sbjct: 56  SGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQV 115

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRG 259
           FDAKNMM ACDPRHGRYLTVA +FRG
Sbjct: 116 FDAKNMMAACDPRHGRYLTVAAVFRG 141



 Score =  164 bits (398), Expect = 3e-40
 Identities = 72/85 (84%), Positives = 79/85 (92%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GRMSMKEVDEQ+ N+QNKNS+YFVEWIPNN K AVCDIPPRGLKMA TFIGN+TAIQ +
Sbjct: 140 RGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNSTAIQEL 199

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           FKR+SEQF AMFRRKAFLHWYTGEG
Sbjct: 200 FKRISEQFTAMFRRKAFLHWYTGEG 224



 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 215 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 248


>BC013374-1|AAH13374.1|  444|Homo sapiens tubulin, beta protein.
          Length = 444

 Score =  173 bits (421), Expect = 5e-43
 Identities = 77/86 (89%), Positives = 82/86 (95%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLTSRG+QQYRALTVPELT Q+
Sbjct: 234 SGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQV 293

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRG 259
           FDAKNMM ACDPRHGRYLTVA +FRG
Sbjct: 294 FDAKNMMAACDPRHGRYLTVAAVFRG 319



 Score =  164 bits (398), Expect = 3e-40
 Identities = 72/85 (84%), Positives = 79/85 (92%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GRMSMKEVDEQ+ N+QNKNS+YFVEWIPNN K AVCDIPPRGLKMA TFIGN+TAIQ +
Sbjct: 318 RGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNSTAIQEL 377

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           FKR+SEQF AMFRRKAFLHWYTGEG
Sbjct: 378 FKRISEQFTAMFRRKAFLHWYTGEG 402



 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 393 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 426


>BC007605-1|AAH07605.1|  444|Homo sapiens tubulin, beta protein.
          Length = 444

 Score =  173 bits (421), Expect = 5e-43
 Identities = 77/86 (89%), Positives = 82/86 (95%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLTSRG+QQYRALTVPELT Q+
Sbjct: 234 SGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQV 293

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRG 259
           FDAKNMM ACDPRHGRYLTVA +FRG
Sbjct: 294 FDAKNMMAACDPRHGRYLTVAAVFRG 319



 Score =  164 bits (398), Expect = 3e-40
 Identities = 72/85 (84%), Positives = 79/85 (92%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GRMSMKEVDEQ+ N+QNKNS+YFVEWIPNN K AVCDIPPRGLKMA TFIGN+TAIQ +
Sbjct: 318 RGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNSTAIQEL 377

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           FKR+SEQF AMFRRKAFLHWYTGEG
Sbjct: 378 FKRISEQFTAMFRRKAFLHWYTGEG 402



 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 393 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 426


>BC005838-1|AAH05838.1|  444|Homo sapiens tubulin, beta protein.
          Length = 444

 Score =  173 bits (421), Expect = 5e-43
 Identities = 77/86 (89%), Positives = 82/86 (95%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLTSRG+QQYRALTVPELT Q+
Sbjct: 234 SGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQV 293

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRG 259
           FDAKNMM ACDPRHGRYLTVA +FRG
Sbjct: 294 FDAKNMMAACDPRHGRYLTVAAVFRG 319



 Score =  164 bits (398), Expect = 3e-40
 Identities = 72/85 (84%), Positives = 79/85 (92%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GRMSMKEVDEQ+ N+QNKNS+YFVEWIPNN K AVCDIPPRGLKMA TFIGN+TAIQ +
Sbjct: 318 RGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNSTAIQEL 377

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           FKR+SEQF AMFRRKAFLHWYTGEG
Sbjct: 378 FKRISEQFTAMFRRKAFLHWYTGEG 402



 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 393 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 426


>BC002347-1|AAH02347.1|  444|Homo sapiens tubulin, beta protein.
          Length = 444

 Score =  173 bits (421), Expect = 5e-43
 Identities = 77/86 (89%), Positives = 82/86 (95%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLTSRG+QQYRALTVPELT Q+
Sbjct: 234 SGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQV 293

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRG 259
           FDAKNMM ACDPRHGRYLTVA +FRG
Sbjct: 294 FDAKNMMAACDPRHGRYLTVAAVFRG 319



 Score =  164 bits (398), Expect = 3e-40
 Identities = 72/85 (84%), Positives = 79/85 (92%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GRMSMKEVDEQ+ N+QNKNS+YFVEWIPNN K AVCDIPPRGLKMA TFIGN+TAIQ +
Sbjct: 318 RGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNSTAIQEL 377

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           FKR+SEQF AMFRRKAFLHWYTGEG
Sbjct: 378 FKRISEQFTAMFRRKAFLHWYTGEG 402



 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 393 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 426


>BC001938-1|AAH01938.1|  444|Homo sapiens tubulin, beta protein.
          Length = 444

 Score =  173 bits (421), Expect = 5e-43
 Identities = 77/86 (89%), Positives = 82/86 (95%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLTSRG+QQYRALTVPELT Q+
Sbjct: 234 SGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQV 293

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRG 259
           FDAKNMM ACDPRHGRYLTVA +FRG
Sbjct: 294 FDAKNMMAACDPRHGRYLTVAAVFRG 319



 Score =  164 bits (398), Expect = 3e-40
 Identities = 72/85 (84%), Positives = 79/85 (92%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GRMSMKEVDEQ+ N+QNKNS+YFVEWIPNN K AVCDIPPRGLKMA TFIGN+TAIQ +
Sbjct: 318 RGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNSTAIQEL 377

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           FKR+SEQF AMFRRKAFLHWYTGEG
Sbjct: 378 FKRISEQFTAMFRRKAFLHWYTGEG 402



 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 393 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 426


>BC001896-1|AAH01896.1|  340|Homo sapiens TUBB protein protein.
          Length = 340

 Score =  173 bits (421), Expect = 5e-43
 Identities = 77/86 (89%), Positives = 82/86 (95%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLTSRG+QQYRALTVPELT Q+
Sbjct: 130 SGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQV 189

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRG 259
           FDAKNMM ACDPRHGRYLTVA +FRG
Sbjct: 190 FDAKNMMAACDPRHGRYLTVAAVFRG 215



 Score =  164 bits (398), Expect = 3e-40
 Identities = 72/85 (84%), Positives = 79/85 (92%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GRMSMKEVDEQ+ N+QNKNS+YFVEWIPNN K AVCDIPPRGLKMA TFIGN+TAIQ +
Sbjct: 214 RGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNSTAIQEL 273

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           FKR+SEQF AMFRRKAFLHWYTGEG
Sbjct: 274 FKRISEQFTAMFRRKAFLHWYTGEG 298



 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 289 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 322


>BA000025-69|BAB63321.1|  444|Homo sapiens Beta-tubulin protein.
          Length = 444

 Score =  173 bits (421), Expect = 5e-43
 Identities = 77/86 (89%), Positives = 82/86 (95%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLTSRG+QQYRALTVPELT Q+
Sbjct: 234 SGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQV 293

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRG 259
           FDAKNMM ACDPRHGRYLTVA +FRG
Sbjct: 294 FDAKNMMAACDPRHGRYLTVAAVFRG 319



 Score =  164 bits (398), Expect = 3e-40
 Identities = 72/85 (84%), Positives = 79/85 (92%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GRMSMKEVDEQ+ N+QNKNS+YFVEWIPNN K AVCDIPPRGLKMA TFIGN+TAIQ +
Sbjct: 318 RGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNSTAIQEL 377

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           FKR+SEQF AMFRRKAFLHWYTGEG
Sbjct: 378 FKRISEQFTAMFRRKAFLHWYTGEG 402



 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 393 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 426


>AL845353-25|CAI41894.1|  372|Homo sapiens tubulin, beta polypeptide
           protein.
          Length = 372

 Score =  173 bits (421), Expect = 5e-43
 Identities = 77/86 (89%), Positives = 82/86 (95%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLTSRG+QQYRALTVPELT Q+
Sbjct: 162 SGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQV 221

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRG 259
           FDAKNMM ACDPRHGRYLTVA +FRG
Sbjct: 222 FDAKNMMAACDPRHGRYLTVAAVFRG 247



 Score =  164 bits (398), Expect = 3e-40
 Identities = 72/85 (84%), Positives = 79/85 (92%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GRMSMKEVDEQ+ N+QNKNS+YFVEWIPNN K AVCDIPPRGLKMA TFIGN+TAIQ +
Sbjct: 246 RGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNSTAIQEL 305

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           FKR+SEQF AMFRRKAFLHWYTGEG
Sbjct: 306 FKRISEQFTAMFRRKAFLHWYTGEG 330



 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 321 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 354


>AL845353-24|CAI41893.1|  426|Homo sapiens tubulin, beta polypeptide
           protein.
          Length = 426

 Score =  173 bits (421), Expect = 5e-43
 Identities = 77/86 (89%), Positives = 82/86 (95%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLTSRG+QQYRALTVPELT Q+
Sbjct: 216 SGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQV 275

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRG 259
           FDAKNMM ACDPRHGRYLTVA +FRG
Sbjct: 276 FDAKNMMAACDPRHGRYLTVAAVFRG 301



 Score =  164 bits (398), Expect = 3e-40
 Identities = 72/85 (84%), Positives = 79/85 (92%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GRMSMKEVDEQ+ N+QNKNS+YFVEWIPNN K AVCDIPPRGLKMA TFIGN+TAIQ +
Sbjct: 300 RGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNSTAIQEL 359

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           FKR+SEQF AMFRRKAFLHWYTGEG
Sbjct: 360 FKRISEQFTAMFRRKAFLHWYTGEG 384



 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 375 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 408


>AL845353-23|CAI41892.1|  444|Homo sapiens tubulin, beta polypeptide
           protein.
          Length = 444

 Score =  173 bits (421), Expect = 5e-43
 Identities = 77/86 (89%), Positives = 82/86 (95%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLTSRG+QQYRALTVPELT Q+
Sbjct: 234 SGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQV 293

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRG 259
           FDAKNMM ACDPRHGRYLTVA +FRG
Sbjct: 294 FDAKNMMAACDPRHGRYLTVAAVFRG 319



 Score =  164 bits (398), Expect = 3e-40
 Identities = 72/85 (84%), Positives = 79/85 (92%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GRMSMKEVDEQ+ N+QNKNS+YFVEWIPNN K AVCDIPPRGLKMA TFIGN+TAIQ +
Sbjct: 318 RGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNSTAIQEL 377

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           FKR+SEQF AMFRRKAFLHWYTGEG
Sbjct: 378 FKRISEQFTAMFRRKAFLHWYTGEG 402



 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 393 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 426


>AL662848-9|CAI17442.1|  372|Homo sapiens tubulin, beta protein.
          Length = 372

 Score =  173 bits (421), Expect = 5e-43
 Identities = 77/86 (89%), Positives = 82/86 (95%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLTSRG+QQYRALTVPELT Q+
Sbjct: 162 SGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQV 221

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRG 259
           FDAKNMM ACDPRHGRYLTVA +FRG
Sbjct: 222 FDAKNMMAACDPRHGRYLTVAAVFRG 247



 Score =  164 bits (398), Expect = 3e-40
 Identities = 72/85 (84%), Positives = 79/85 (92%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GRMSMKEVDEQ+ N+QNKNS+YFVEWIPNN K AVCDIPPRGLKMA TFIGN+TAIQ +
Sbjct: 246 RGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNSTAIQEL 305

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           FKR+SEQF AMFRRKAFLHWYTGEG
Sbjct: 306 FKRISEQFTAMFRRKAFLHWYTGEG 330



 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 321 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 354


>AL662848-8|CAM24851.1|  426|Homo sapiens tubulin, beta protein.
          Length = 426

 Score =  173 bits (421), Expect = 5e-43
 Identities = 77/86 (89%), Positives = 82/86 (95%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLTSRG+QQYRALTVPELT Q+
Sbjct: 216 SGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQV 275

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRG 259
           FDAKNMM ACDPRHGRYLTVA +FRG
Sbjct: 276 FDAKNMMAACDPRHGRYLTVAAVFRG 301



 Score =  164 bits (398), Expect = 3e-40
 Identities = 72/85 (84%), Positives = 79/85 (92%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GRMSMKEVDEQ+ N+QNKNS+YFVEWIPNN K AVCDIPPRGLKMA TFIGN+TAIQ +
Sbjct: 300 RGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNSTAIQEL 359

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           FKR+SEQF AMFRRKAFLHWYTGEG
Sbjct: 360 FKRISEQFTAMFRRKAFLHWYTGEG 384



 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 375 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 408


>AL662848-7|CAI17441.1|  444|Homo sapiens tubulin, beta protein.
          Length = 444

 Score =  173 bits (421), Expect = 5e-43
 Identities = 77/86 (89%), Positives = 82/86 (95%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLTSRG+QQYRALTVPELT Q+
Sbjct: 234 SGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQV 293

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRG 259
           FDAKNMM ACDPRHGRYLTVA +FRG
Sbjct: 294 FDAKNMMAACDPRHGRYLTVAAVFRG 319



 Score =  164 bits (398), Expect = 3e-40
 Identities = 72/85 (84%), Positives = 79/85 (92%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GRMSMKEVDEQ+ N+QNKNS+YFVEWIPNN K AVCDIPPRGLKMA TFIGN+TAIQ +
Sbjct: 318 RGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNSTAIQEL 377

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           FKR+SEQF AMFRRKAFLHWYTGEG
Sbjct: 378 FKRISEQFTAMFRRKAFLHWYTGEG 402



 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 393 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 426


>AL662797-13|CAI18197.1|  372|Homo sapiens tubulin, beta protein.
          Length = 372

 Score =  173 bits (421), Expect = 5e-43
 Identities = 77/86 (89%), Positives = 82/86 (95%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLTSRG+QQYRALTVPELT Q+
Sbjct: 162 SGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQV 221

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRG 259
           FDAKNMM ACDPRHGRYLTVA +FRG
Sbjct: 222 FDAKNMMAACDPRHGRYLTVAAVFRG 247



 Score =  164 bits (398), Expect = 3e-40
 Identities = 72/85 (84%), Positives = 79/85 (92%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GRMSMKEVDEQ+ N+QNKNS+YFVEWIPNN K AVCDIPPRGLKMA TFIGN+TAIQ +
Sbjct: 246 RGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNSTAIQEL 305

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           FKR+SEQF AMFRRKAFLHWYTGEG
Sbjct: 306 FKRISEQFTAMFRRKAFLHWYTGEG 330



 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 321 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 354


>AL662797-12|CAM25516.1|  426|Homo sapiens tubulin, beta protein.
          Length = 426

 Score =  173 bits (421), Expect = 5e-43
 Identities = 77/86 (89%), Positives = 82/86 (95%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLTSRG+QQYRALTVPELT Q+
Sbjct: 216 SGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQV 275

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRG 259
           FDAKNMM ACDPRHGRYLTVA +FRG
Sbjct: 276 FDAKNMMAACDPRHGRYLTVAAVFRG 301



 Score =  164 bits (398), Expect = 3e-40
 Identities = 72/85 (84%), Positives = 79/85 (92%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GRMSMKEVDEQ+ N+QNKNS+YFVEWIPNN K AVCDIPPRGLKMA TFIGN+TAIQ +
Sbjct: 300 RGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNSTAIQEL 359

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           FKR+SEQF AMFRRKAFLHWYTGEG
Sbjct: 360 FKRISEQFTAMFRRKAFLHWYTGEG 384



 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 375 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 408


>AL662797-11|CAI18196.1|  444|Homo sapiens tubulin, beta protein.
          Length = 444

 Score =  173 bits (421), Expect = 5e-43
 Identities = 77/86 (89%), Positives = 82/86 (95%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLTSRG+QQYRALTVPELT Q+
Sbjct: 234 SGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQV 293

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRG 259
           FDAKNMM ACDPRHGRYLTVA +FRG
Sbjct: 294 FDAKNMMAACDPRHGRYLTVAAVFRG 319



 Score =  164 bits (398), Expect = 3e-40
 Identities = 72/85 (84%), Positives = 79/85 (92%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GRMSMKEVDEQ+ N+QNKNS+YFVEWIPNN K AVCDIPPRGLKMA TFIGN+TAIQ +
Sbjct: 318 RGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNSTAIQEL 377

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           FKR+SEQF AMFRRKAFLHWYTGEG
Sbjct: 378 FKRISEQFTAMFRRKAFLHWYTGEG 402



 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 393 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 426


>AF141349-1|AAD33873.1|  444|Homo sapiens beta-tubulin protein.
          Length = 444

 Score =  173 bits (421), Expect = 5e-43
 Identities = 77/86 (89%), Positives = 82/86 (95%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLTSRG+QQYRALTVPELT Q+
Sbjct: 234 SGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQV 293

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRG 259
           FDAKNMM ACDPRHGRYLTVA +FRG
Sbjct: 294 FDAKNMMAACDPRHGRYLTVAAVFRG 319



 Score =  164 bits (398), Expect = 3e-40
 Identities = 72/85 (84%), Positives = 79/85 (92%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GRMSMKEVDEQ+ N+QNKNS+YFVEWIPNN K AVCDIPPRGLKMA TFIGN+TAIQ +
Sbjct: 318 RGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNSTAIQEL 377

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           FKR+SEQF AMFRRKAFLHWYTGEG
Sbjct: 378 FKRISEQFTAMFRRKAFLHWYTGEG 402



 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 393 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 426


>AF070600-1|AAC28654.1|  444|Homo sapiens beta-tubulin protein.
          Length = 444

 Score =  173 bits (421), Expect = 5e-43
 Identities = 77/86 (89%), Positives = 82/86 (95%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLTSRG+QQYRALTVPELT Q+
Sbjct: 234 SGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQV 293

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRG 259
           FDAKNMM ACDPRHGRYLTVA +FRG
Sbjct: 294 FDAKNMMAACDPRHGRYLTVAAVFRG 319



 Score =  164 bits (398), Expect = 3e-40
 Identities = 72/85 (84%), Positives = 79/85 (92%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GRMSMKEVDEQ+ N+QNKNS+YFVEWIPNN K AVCDIPPRGLKMA TFIGN+TAIQ +
Sbjct: 318 RGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNSTAIQEL 377

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           FKR+SEQF AMFRRKAFLHWYTGEG
Sbjct: 378 FKRISEQFTAMFRRKAFLHWYTGEG 402



 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 393 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 426


>AF070593-1|AAC28650.1|  444|Homo sapiens beta-tubulin protein.
          Length = 444

 Score =  173 bits (421), Expect = 5e-43
 Identities = 77/86 (89%), Positives = 82/86 (95%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLTSRG+QQYRALTVPELT Q+
Sbjct: 234 SGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQV 293

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRG 259
           FDAKNMM ACDPRHGRYLTVA +FRG
Sbjct: 294 FDAKNMMAACDPRHGRYLTVAAVFRG 319



 Score =  164 bits (398), Expect = 3e-40
 Identities = 72/85 (84%), Positives = 79/85 (92%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GRMSMKEVDEQ+ N+QNKNS+YFVEWIPNN K AVCDIPPRGLKMA TFIGN+TAIQ +
Sbjct: 318 RGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNSTAIQEL 377

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           FKR+SEQF AMFRRKAFLHWYTGEG
Sbjct: 378 FKRISEQFTAMFRRKAFLHWYTGEG 402



 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 393 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 426


>AF070561-1|AAC28642.1|  444|Homo sapiens beta-tubulin protein.
          Length = 444

 Score =  173 bits (421), Expect = 5e-43
 Identities = 77/86 (89%), Positives = 82/86 (95%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLTSRG+QQYRALTVPELT Q+
Sbjct: 234 SGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQV 293

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRG 259
           FDAKNMM ACDPRHGRYLTVA +FRG
Sbjct: 294 FDAKNMMAACDPRHGRYLTVAAVFRG 319



 Score =  164 bits (398), Expect = 3e-40
 Identities = 72/85 (84%), Positives = 79/85 (92%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GRMSMKEVDEQ+ N+QNKNS+YFVEWIPNN K AVCDIPPRGLKMA TFIGN+TAIQ +
Sbjct: 318 RGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNSTAIQEL 377

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           FKR+SEQF AMFRRKAFLHWYTGEG
Sbjct: 378 FKRISEQFTAMFRRKAFLHWYTGEG 402



 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 393 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 426


>AB202098-1|BAE78618.1|  444|Homo sapiens beta 5-tubulin protein.
          Length = 444

 Score =  173 bits (421), Expect = 5e-43
 Identities = 77/86 (89%), Positives = 82/86 (95%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLTSRG+QQYRALTVPELT Q+
Sbjct: 234 SGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQV 293

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRG 259
           FDAKNMM ACDPRHGRYLTVA +FRG
Sbjct: 294 FDAKNMMAACDPRHGRYLTVAAVFRG 319



 Score =  164 bits (398), Expect = 3e-40
 Identities = 72/85 (84%), Positives = 79/85 (92%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GRMSMKEVDEQ+ N+QNKNS+YFVEWIPNN K AVCDIPPRGLKMA TFIGN+TAIQ +
Sbjct: 318 RGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNSTAIQEL 377

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           FKR+SEQF AMFRRKAFLHWYTGEG
Sbjct: 378 FKRISEQFTAMFRRKAFLHWYTGEG 402



 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 393 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 426


>AB103606-1|BAF31267.1|  444|Homo sapiens beta-tubulin protein
           protein.
          Length = 444

 Score =  173 bits (421), Expect = 5e-43
 Identities = 77/86 (89%), Positives = 82/86 (95%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLTSRG+QQYRALTVPELT Q+
Sbjct: 234 SGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQV 293

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRG 259
           FDAKNMM ACDPRHGRYLTVA +FRG
Sbjct: 294 FDAKNMMAACDPRHGRYLTVAAVFRG 319



 Score =  164 bits (398), Expect = 3e-40
 Identities = 72/85 (84%), Positives = 79/85 (92%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GRMSMKEVDEQ+ N+QNKNS+YFVEWIPNN K AVCDIPPRGLKMA TFIGN+TAIQ +
Sbjct: 318 RGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNSTAIQEL 377

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           FKR+SEQF AMFRRKAFLHWYTGEG
Sbjct: 378 FKRISEQFTAMFRRKAFLHWYTGEG 402



 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 393 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 426


>AB088100-1|BAC54932.1|  444|Homo sapiens tubulin, beta polypeptide
           protein.
          Length = 444

 Score =  173 bits (421), Expect = 5e-43
 Identities = 77/86 (89%), Positives = 82/86 (95%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLTSRG+QQYRALTVPELT Q+
Sbjct: 234 SGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQV 293

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRG 259
           FDAKNMM ACDPRHGRYLTVA +FRG
Sbjct: 294 FDAKNMMAACDPRHGRYLTVAAVFRG 319



 Score =  164 bits (398), Expect = 3e-40
 Identities = 72/85 (84%), Positives = 79/85 (92%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GRMSMKEVDEQ+ N+QNKNS+YFVEWIPNN K AVCDIPPRGLKMA TFIGN+TAIQ +
Sbjct: 318 RGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNSTAIQEL 377

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           FKR+SEQF AMFRRKAFLHWYTGEG
Sbjct: 378 FKRISEQFTAMFRRKAFLHWYTGEG 402



 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 393 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 426


>AB062393-1|BAB93480.1|  444|Homo sapiens beta 5-tubulin protein.
          Length = 444

 Score =  173 bits (421), Expect = 5e-43
 Identities = 77/86 (89%), Positives = 82/86 (95%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLTSRG+QQYRALTVPELT Q+
Sbjct: 234 SGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQV 293

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRG 259
           FDAKNMM ACDPRHGRYLTVA +FRG
Sbjct: 294 FDAKNMMAACDPRHGRYLTVAAVFRG 319



 Score =  164 bits (398), Expect = 3e-40
 Identities = 72/85 (84%), Positives = 79/85 (92%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GRMSMKEVDEQ+ N+QNKNS+YFVEWIPNN K AVCDIPPRGLKMA TFIGN+TAIQ +
Sbjct: 318 RGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNSTAIQEL 377

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           FKR+SEQF AMFRRKAFLHWYTGEG
Sbjct: 378 FKRISEQFTAMFRRKAFLHWYTGEG 402



 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 393 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 426


>CR541958-1|CAG46756.1|  445|Homo sapiens TUBB protein.
          Length = 445

 Score =  173 bits (420), Expect = 7e-43
 Identities = 77/86 (89%), Positives = 82/86 (95%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TTCLRFPGQLNADLRKLAVNMVPFPR+HF+ PGFAPLTSRG+QQYRALTVPELT QM
Sbjct: 234 SGVTTCLRFPGQLNADLRKLAVNMVPFPRVHFFMPGFAPLTSRGSQQYRALTVPELTQQM 293

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRG 259
           FD+KNMM ACDPRHGRYLTVA IFRG
Sbjct: 294 FDSKNMMAACDPRHGRYLTVAAIFRG 319



 Score =  164 bits (398), Expect = 3e-40
 Identities = 71/85 (83%), Positives = 80/85 (94%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GRMSMKEVDEQ+ N+QNKNS+YFVEWIPNN K AVCDIPPRGLKM++TFIGN+TAIQ +
Sbjct: 318 RGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQEL 377

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           FKR+SEQF AMFRRKAFLHWYTGEG
Sbjct: 378 FKRISEQFTAMFRRKAFLHWYTGEG 402



 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 393 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 426


>BT006971-1|AAP35617.1|  797|Homo sapiens tubulin, beta, 4 protein.
          Length = 797

 Score =  173 bits (420), Expect = 7e-43
 Identities = 79/105 (75%), Positives = 89/105 (84%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TT LRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLT+RG+QQYRALTVPELT QM
Sbjct: 581 SGVTTSLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTARGSQQYRALTVPELTQQM 640

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTKTA 316
           FDAKNMM ACDPRHGRYLTVAT+FRG    K++       ++K +
Sbjct: 641 FDAKNMMAACDPRHGRYLTVATVFRGRMSMKEVDEQMLAIQSKNS 685



 Score =  162 bits (393), Expect = 1e-39
 Identities = 71/85 (83%), Positives = 80/85 (94%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GRMSMKEVDEQ+  IQ+KNS+YFVEWIPNN K+AVCDIPPRGLKM+STFIGN+TAIQ +
Sbjct: 665 RGRMSMKEVDEQMLAIQSKNSSYFVEWIPNNVKVAVCDIPPRGLKMSSTFIGNSTAIQEL 724

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           FKR+SEQF AMFRRKAFLHWYTGEG
Sbjct: 725 FKRISEQFTAMFRRKAFLHWYTGEG 749



 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 740 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 773


>BC047518-1|AAH47518.1|  280|Homo sapiens TUBB3 protein protein.
          Length = 280

 Score =  173 bits (420), Expect = 7e-43
 Identities = 79/105 (75%), Positives = 89/105 (84%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TT LRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLT+RG+QQYRALTVPELT QM
Sbjct: 171 SGVTTSLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTARGSQQYRALTVPELTQQM 230

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTKTA 316
           FDAKNMM ACDPRHGRYLTVAT+FRG    K++       ++K +
Sbjct: 231 FDAKNMMAACDPRHGRYLTVATVFRGRMSMKEVDEQMLAIQSKNS 275



 Score = 45.6 bits (103), Expect = 2e-04
 Identities = 20/26 (76%), Positives = 24/26 (92%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVE 330
           +GRMSMKEVDEQ+  IQ+KNS+YFVE
Sbjct: 255 RGRMSMKEVDEQMLAIQSKNSSYFVE 280


>BC003021-1|AAH03021.2|  450|Homo sapiens tubulin, beta 3 protein.
          Length = 450

 Score =  173 bits (420), Expect = 7e-43
 Identities = 79/105 (75%), Positives = 89/105 (84%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TT LRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLT+RG+QQYRALTVPELT QM
Sbjct: 234 SGVTTSLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTARGSQQYRALTVPELTQQM 293

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTKTA 316
           FDAKNMM ACDPRHGRYLTVAT+FRG    K++       ++K +
Sbjct: 294 FDAKNMMAACDPRHGRYLTVATVFRGRMSMKEVDEQMLAIQSKNS 338



 Score =  162 bits (393), Expect = 1e-39
 Identities = 71/85 (83%), Positives = 80/85 (94%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GRMSMKEVDEQ+  IQ+KNS+YFVEWIPNN K+AVCDIPPRGLKM+STFIGN+TAIQ +
Sbjct: 318 RGRMSMKEVDEQMLAIQSKNSSYFVEWIPNNVKVAVCDIPPRGLKMSSTFIGNSTAIQEL 377

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           FKR+SEQF AMFRRKAFLHWYTGEG
Sbjct: 378 FKRISEQFTAMFRRKAFLHWYTGEG 402



 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 393 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 426


>BC001678-1|AAH01678.2|  406|Homo sapiens TUBB3 protein protein.
          Length = 406

 Score =  173 bits (420), Expect = 7e-43
 Identities = 79/105 (75%), Positives = 89/105 (84%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TT LRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLT+RG+QQYRALTVPELT QM
Sbjct: 190 SGVTTSLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTARGSQQYRALTVPELTQQM 249

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTKTA 316
           FDAKNMM ACDPRHGRYLTVAT+FRG    K++       ++K +
Sbjct: 250 FDAKNMMAACDPRHGRYLTVATVFRGRMSMKEVDEQMLAIQSKNS 294



 Score =  162 bits (393), Expect = 1e-39
 Identities = 71/85 (83%), Positives = 80/85 (94%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GRMSMKEVDEQ+  IQ+KNS+YFVEWIPNN K+AVCDIPPRGLKM+STFIGN+TAIQ +
Sbjct: 274 RGRMSMKEVDEQMLAIQSKNSSYFVEWIPNNVKVAVCDIPPRGLKMSSTFIGNSTAIQEL 333

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           FKR+SEQF AMFRRKAFLHWYTGEG
Sbjct: 334 FKRISEQFTAMFRRKAFLHWYTGEG 358



 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 349 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 382


>BC000748-1|AAH00748.1|  450|Homo sapiens tubulin, beta 3 protein.
          Length = 450

 Score =  173 bits (420), Expect = 7e-43
 Identities = 79/105 (75%), Positives = 89/105 (84%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TT LRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLT+RG+QQYRALTVPELT QM
Sbjct: 234 SGVTTSLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTARGSQQYRALTVPELTQQM 293

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTKTA 316
           FDAKNMM ACDPRHGRYLTVAT+FRG    K++       ++K +
Sbjct: 294 FDAKNMMAACDPRHGRYLTVATVFRGRMSMKEVDEQMLAIQSKNS 338



 Score =  162 bits (393), Expect = 1e-39
 Identities = 71/85 (83%), Positives = 80/85 (94%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GRMSMKEVDEQ+  IQ+KNS+YFVEWIPNN K+AVCDIPPRGLKM+STFIGN+TAIQ +
Sbjct: 318 RGRMSMKEVDEQMLAIQSKNSSYFVEWIPNNVKVAVCDIPPRGLKMSSTFIGNSTAIQEL 377

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           FKR+SEQF AMFRRKAFLHWYTGEG
Sbjct: 378 FKRISEQFTAMFRRKAFLHWYTGEG 402



 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 393 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 426


>AK223039-1|BAD96759.1|  450|Homo sapiens tubulin, beta, 4 variant
           protein.
          Length = 450

 Score =  173 bits (420), Expect = 7e-43
 Identities = 79/105 (75%), Positives = 89/105 (84%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TT LRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLT+RG+QQYRALTVPELT QM
Sbjct: 234 SGVTTSLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTARGSQQYRALTVPELTQQM 293

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTKTA 316
           FDAKNMM ACDPRHGRYLTVAT+FRG    K++       ++K +
Sbjct: 294 FDAKNMMAACDPRHGRYLTVATVFRGRMSMKEVDEQMLAIQSKNS 338



 Score =  158 bits (384), Expect = 2e-38
 Identities = 70/85 (82%), Positives = 79/85 (92%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GRMSMKEVDEQ+  IQ+KNS+ FVEWIPNN K+AVCDIPPRGLKM+STFIGN+TAIQ +
Sbjct: 318 RGRMSMKEVDEQMLAIQSKNSSCFVEWIPNNVKVAVCDIPPRGLKMSSTFIGNSTAIQEL 377

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           FKR+SEQF AMFRRKAFLHWYTGEG
Sbjct: 378 FKRISEQFTAMFRRKAFLHWYTGEG 402



 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 393 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 426


>AF427491-1|AAL28094.1|  450|Homo sapiens class III beta tubulin
           protein.
          Length = 450

 Score =  173 bits (420), Expect = 7e-43
 Identities = 79/105 (75%), Positives = 89/105 (84%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TT LRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLT+RG+QQYRALTVPELT QM
Sbjct: 234 SGVTTSLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTARGSQQYRALTVPELTQQM 293

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTKTA 316
           FDAKNMM ACDPRHGRYLTVAT+FRG    K++       ++K +
Sbjct: 294 FDAKNMMAACDPRHGRYLTVATVFRGRMSMKEVDEQMLAIQSKNS 338



 Score =  162 bits (393), Expect = 1e-39
 Identities = 71/85 (83%), Positives = 80/85 (94%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GRMSMKEVDEQ+  IQ+KNS+YFVEWIPNN K+AVCDIPPRGLKM+STFIGN+TAIQ +
Sbjct: 318 RGRMSMKEVDEQMLAIQSKNSSYFVEWIPNNVKVAVCDIPPRGLKMSSTFIGNSTAIQEL 377

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           FKR+SEQF AMFRRKAFLHWYTGEG
Sbjct: 378 FKRISEQFTAMFRRKAFLHWYTGEG 402



 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 393 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 426


>BC002654-1|AAH02654.1|  446|Homo sapiens tubulin, beta 6 protein.
          Length = 446

 Score =  172 bits (419), Expect = 9e-43
 Identities = 79/105 (75%), Positives = 89/105 (84%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TT LRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLTSRG+QQYRALTVPELT QM
Sbjct: 234 SGVTTSLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQM 293

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTKTA 316
           FDA+NMM ACDPRHGRYLTVAT+FRG    K++       ++K +
Sbjct: 294 FDARNMMAACDPRHGRYLTVATVFRGPMSMKEVDEQMLAIQSKNS 338



 Score =  158 bits (383), Expect = 2e-38
 Identities = 70/85 (82%), Positives = 79/85 (92%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +G MSMKEVDEQ+  IQ+KNS+YFVEWIPNN K+AVCDIPPRGLKMASTFIGN+TAIQ +
Sbjct: 318 RGPMSMKEVDEQMLAIQSKNSSYFVEWIPNNVKVAVCDIPPRGLKMASTFIGNSTAIQEL 377

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           FKR+SEQF AMFRRKAFLHW+TGEG
Sbjct: 378 FKRISEQFSAMFRRKAFLHWFTGEG 402



 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 393 AFLHWFTGEGMDEMEFTEAESNMNDLVSEYQQYQ 426


>AK022340-1|BAB14016.1|  446|Homo sapiens protein ( Homo sapiens
           cDNA FLJ12278 fis, clone MAMMA1001735, highly similar to
           TUBULIN BETA-5 CHAIN. ).
          Length = 446

 Score =  172 bits (419), Expect = 9e-43
 Identities = 79/105 (75%), Positives = 89/105 (84%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TT LRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLTSRG+QQYRALTVPELT QM
Sbjct: 234 SGVTTSLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQM 293

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTKTA 316
           FDA+NMM ACDPRHGRYLTVAT+FRG    K++       ++K +
Sbjct: 294 FDARNMMAACDPRHGRYLTVATVFRGPMSMKEVDEQMLAIQSKNS 338



 Score =  158 bits (383), Expect = 2e-38
 Identities = 70/85 (82%), Positives = 79/85 (92%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +G MSMKEVDEQ+  IQ+KNS+YFVEWIPNN K+AVCDIPPRGLKMASTFIGN+TAIQ +
Sbjct: 318 RGPMSMKEVDEQMLAIQSKNSSYFVEWIPNNVKVAVCDIPPRGLKMASTFIGNSTAIQEL 377

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           FKR+SEQF AMFRRKAFLHW+TGEG
Sbjct: 378 FKRISEQFSAMFRRKAFLHWFTGEG 402



 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 393 AFLHWFTGEGMDEMEFTEAESNMNDLVSEYQQYQ 426


>U47634-1|AAC52035.1|  450|Homo sapiens beta-tubulin protein.
          Length = 450

 Score =  172 bits (418), Expect = 1e-42
 Identities = 79/105 (75%), Positives = 88/105 (83%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TT LRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLT RG+QQYRALTVPELT QM
Sbjct: 234 SGVTTSLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTRRGSQQYRALTVPELTQQM 293

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTKTA 316
           FDAKNMM ACDPRHGRYLTVAT+FRG    K++       ++K +
Sbjct: 294 FDAKNMMAACDPRHGRYLTVATVFRGRMSMKEVDEQMLAIQSKNS 338



 Score =  162 bits (393), Expect = 1e-39
 Identities = 71/85 (83%), Positives = 80/85 (94%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GRMSMKEVDEQ+  IQ+KNS+YFVEWIPNN K+AVCDIPPRGLKM+STFIGN+TAIQ +
Sbjct: 318 RGRMSMKEVDEQMLAIQSKNSSYFVEWIPNNVKVAVCDIPPRGLKMSSTFIGNSTAIQEL 377

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           FKR+SEQF AMFRRKAFLHWYTGEG
Sbjct: 378 FKRISEQFTAMFRRKAFLHWYTGEG 402



 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 393 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 426


>BC111374-1|AAI11375.1|  447|Homo sapiens TUBB6 protein protein.
          Length = 447

 Score =  172 bits (418), Expect = 1e-42
 Identities = 79/105 (75%), Positives = 88/105 (83%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TT LRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLT+RG+QQYRALTVPELT QM
Sbjct: 234 SGVTTSLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTARGSQQYRALTVPELTQQM 293

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTKTA 316
           FDAKNMM ACDPRHGRYLTVAT+FRG    K++       + K +
Sbjct: 294 FDAKNMMAACDPRHGRYLTVATVFRGPMSMKEVDEQMLAIQNKNS 338



 Score =  160 bits (388), Expect = 5e-39
 Identities = 71/85 (83%), Positives = 79/85 (92%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +G MSMKEVDEQ+  IQNKNS+YFVEWIPNN K+AVCDIPPRGLKMASTFIGN+TAIQ +
Sbjct: 318 RGPMSMKEVDEQMLAIQNKNSSYFVEWIPNNVKVAVCDIPPRGLKMASTFIGNSTAIQEL 377

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           FKR+SEQF AMFRRKAFLHW+TGEG
Sbjct: 378 FKRISEQFSAMFRRKAFLHWFTGEG 402



 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 393 AFLHWFTGEGMDEMEFTEAESNMNDLVSEYQQYQ 426


>X00734-1|CAA25318.1|  444|Homo sapiens tubulin 5-beta protein.
          Length = 444

 Score =  171 bits (416), Expect = 2e-42
 Identities = 78/105 (74%), Positives = 87/105 (82%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ P FAPLTSRG+QQYR LTVPELT QM
Sbjct: 234 SGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPAFAPLTSRGSQQYRGLTVPELTQQM 293

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTKTA 316
           FDAKNMM ACDPRHGRYLTVA +FRG    K++       ++K +
Sbjct: 294 FDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLSVQSKNS 338



 Score =  160 bits (388), Expect = 5e-39
 Identities = 70/85 (82%), Positives = 79/85 (92%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GRMSMKEVDEQ+ ++Q+KNS+YFVEWIPNN K AVCDIPPRGLKMA TFIGN+TAIQ +
Sbjct: 318 RGRMSMKEVDEQMLSVQSKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNSTAIQEL 377

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           FKR+SEQF AMFRRKAFLHWYTGEG
Sbjct: 378 FKRISEQFTAMFRRKAFLHWYTGEG 402



 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 393 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 426


>BC020946-1|AAH20946.1|  444|Homo sapiens tubulin, beta protein.
          Length = 444

 Score =  171 bits (416), Expect = 2e-42
 Identities = 76/86 (88%), Positives = 82/86 (95%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLTSRG+QQYRALTVPELT Q+
Sbjct: 234 SGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQV 293

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRG 259
           FDAK+MM ACDPRHGRYLTVA +FRG
Sbjct: 294 FDAKDMMAACDPRHGRYLTVAAVFRG 319



 Score =  164 bits (398), Expect = 3e-40
 Identities = 72/85 (84%), Positives = 79/85 (92%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GRMSMKEVDEQ+ N+QNKNS+YFVEWIPNN K AVCDIPPRGLKMA TFIGN+TAIQ +
Sbjct: 318 RGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNSTAIQEL 377

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           FKR+SEQF AMFRRKAFLHWYTGEG
Sbjct: 378 FKRISEQFTAMFRRKAFLHWYTGEG 402



 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 393 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 426


>BC101271-1|AAI01272.1|  441|Homo sapiens TUBB8 protein protein.
          Length = 441

 Score =  170 bits (414), Expect = 4e-42
 Identities = 77/86 (89%), Positives = 80/86 (93%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLTSRG+QQYRALTV ELT QM
Sbjct: 231 SGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVAELTQQM 290

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRG 259
           FDAKNMM ACDPRHGRYLT A IFRG
Sbjct: 291 FDAKNMMAACDPRHGRYLTAAAIFRG 316



 Score =  155 bits (376), Expect = 1e-37
 Identities = 67/85 (78%), Positives = 77/85 (90%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GRM M+EVDEQ+ NIQ+KNS+YF +W+PNN K AVCDIPPRGLKM++TFIGN TAIQ +
Sbjct: 315 RGRMPMREVDEQMFNIQDKNSSYFADWLPNNVKTAVCDIPPRGLKMSATFIGNNTAIQEL 374

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           FKRVSEQF AMFRRKAFLHWYTGEG
Sbjct: 375 FKRVSEQFTAMFRRKAFLHWYTGEG 399



 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 390 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 423


>BC101270-1|AAI01271.1|  441|Homo sapiens TUBB8 protein protein.
          Length = 441

 Score =  170 bits (414), Expect = 4e-42
 Identities = 77/86 (89%), Positives = 80/86 (93%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLTSRG+QQYRALTV ELT QM
Sbjct: 231 SGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVAELTQQM 290

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRG 259
           FDAKNMM ACDPRHGRYLT A IFRG
Sbjct: 291 FDAKNMMAACDPRHGRYLTAAAIFRG 316



 Score =  155 bits (376), Expect = 1e-37
 Identities = 67/85 (78%), Positives = 77/85 (90%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GRM M+EVDEQ+ NIQ+KNS+YF +W+PNN K AVCDIPPRGLKM++TFIGN TAIQ +
Sbjct: 315 RGRMPMREVDEQMFNIQDKNSSYFADWLPNNVKTAVCDIPPRGLKMSATFIGNNTAIQEL 374

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           FKRVSEQF AMFRRKAFLHWYTGEG
Sbjct: 375 FKRVSEQFTAMFRRKAFLHWYTGEG 399



 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 390 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 423


>AL713922-4|CAI16221.1|  435|Homo sapiens novel protein similar to
           beta-tubulin 4Q (TUBB4Q)kinase) II gamma protein.
          Length = 435

 Score =  170 bits (414), Expect = 4e-42
 Identities = 77/86 (89%), Positives = 80/86 (93%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLTSRG+QQYRALTV ELT QM
Sbjct: 234 SGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVAELTQQM 293

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRG 259
           FDAKNMM ACDPRHGRYLT A IFRG
Sbjct: 294 FDAKNMMAACDPRHGRYLTAAAIFRG 319



 Score =  155 bits (376), Expect = 1e-37
 Identities = 67/85 (78%), Positives = 77/85 (90%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GRM M+EVDEQ+ NIQ+KNS+YF +W+PNN K AVCDIPPRGLKM++TFIGN TAIQ +
Sbjct: 318 RGRMPMREVDEQMFNIQDKNSSYFADWLPNNVKTAVCDIPPRGLKMSATFIGNNTAIQEL 377

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           FKRVSEQF AMFRRKAFLHWYTGEG
Sbjct: 378 FKRVSEQFTAMFRRKAFLHWYTGEG 402



 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 393 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 426


>AL713922-3|CAI16220.1|  410|Homo sapiens novel protein similar to
           beta-tubulin 4Q (TUBB4Q)kinase) II gamma protein.
          Length = 410

 Score =  170 bits (414), Expect = 4e-42
 Identities = 77/86 (89%), Positives = 80/86 (93%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLTSRG+QQYRALTV ELT QM
Sbjct: 200 SGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVAELTQQM 259

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRG 259
           FDAKNMM ACDPRHGRYLT A IFRG
Sbjct: 260 FDAKNMMAACDPRHGRYLTAAAIFRG 285



 Score =  155 bits (376), Expect = 1e-37
 Identities = 67/85 (78%), Positives = 77/85 (90%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GRM M+EVDEQ+ NIQ+KNS+YF +W+PNN K AVCDIPPRGLKM++TFIGN TAIQ +
Sbjct: 284 RGRMPMREVDEQMFNIQDKNSSYFADWLPNNVKTAVCDIPPRGLKMSATFIGNNTAIQEL 343

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           FKRVSEQF AMFRRKAFLHWYTGEG
Sbjct: 344 FKRVSEQFTAMFRRKAFLHWYTGEG 368



 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 359 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 392


>AF355127-1|AAL32434.1|  444|Homo sapiens beta-tubulin 4Q protein.
          Length = 444

 Score =  170 bits (414), Expect = 4e-42
 Identities = 77/86 (89%), Positives = 80/86 (93%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLTSRG+QQYRALTV ELT QM
Sbjct: 234 SGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVAELTQQM 293

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRG 259
           FDAKNMM ACDPRHGRYLT A IFRG
Sbjct: 294 FDAKNMMAACDPRHGRYLTAAAIFRG 319



 Score =  155 bits (376), Expect = 1e-37
 Identities = 67/85 (78%), Positives = 77/85 (90%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GRM M+EVDEQ+ NIQ+KNS+YF +W+PNN K AVCDIPPRGLKM++TFIGN TAIQ +
Sbjct: 318 RGRMPMREVDEQMFNIQDKNSSYFADWLPNNVKTAVCDIPPRGLKMSATFIGNNTAIQEL 377

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           FKRVSEQF AMFRRKAFLHWYTGEG
Sbjct: 378 FKRVSEQFTAMFRRKAFLHWYTGEG 402



 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 393 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 426


>V00599-1|CAA23844.1|  437|Homo sapiens protein ( Human mRNA
           fragment encoding beta-tubulin. (from clone D-beta-1).
           ).
          Length = 437

 Score =  168 bits (408), Expect = 2e-41
 Identities = 74/84 (88%), Positives = 80/84 (95%)
 Frame = +2

Query: 8   ITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQMFD 187
           +TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLTSRG+QQYRALTVP+LT Q+FD
Sbjct: 229 VTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPDLTQQVFD 288

Query: 188 AKNMMVACDPRHGRYLTVATIFRG 259
           AKNMM ACDPRHGRYLTVA +FRG
Sbjct: 289 AKNMMAACDPRHGRYLTVAAVFRG 312



 Score =  164 bits (398), Expect = 3e-40
 Identities = 72/85 (84%), Positives = 79/85 (92%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GRMSMKEVDEQ+ N+QNKNS+YFVEWIPNN K AVCDIPPRGLKMA TFIGN+TAIQ +
Sbjct: 311 RGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNSTAIQEL 370

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           FKR+SEQF AMFRRKAFLHWYTGEG
Sbjct: 371 FKRISEQFTAMFRRKAFLHWYTGEG 395



 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 386 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 419


>J00314-1|AAB59507.1|  444|Homo sapiens protein ( Human beta-tubulin
           gene, clone m40. ).
          Length = 444

 Score =  168 bits (408), Expect = 2e-41
 Identities = 74/84 (88%), Positives = 80/84 (95%)
 Frame = +2

Query: 8   ITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQMFD 187
           +TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLTSRG+QQYRALTVP+LT Q+FD
Sbjct: 236 VTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPDLTQQVFD 295

Query: 188 AKNMMVACDPRHGRYLTVATIFRG 259
           AKNMM ACDPRHGRYLTVA +FRG
Sbjct: 296 AKNMMAACDPRHGRYLTVAAVFRG 319



 Score =  164 bits (398), Expect = 3e-40
 Identities = 72/85 (84%), Positives = 79/85 (92%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GRMSMKEVDEQ+ N+QNKNS+YFVEWIPNN K AVCDIPPRGLKMA TFIGN+TAIQ +
Sbjct: 318 RGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNSTAIQEL 377

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           FKR+SEQF AMFRRKAFLHWYTGEG
Sbjct: 378 FKRISEQFTAMFRRKAFLHWYTGEG 402



 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 393 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 426


>U83668-1|AAB48456.1|  433|Homo sapiens beta-tubulin protein.
          Length = 433

 Score =  161 bits (390), Expect = 3e-39
 Identities = 74/86 (86%), Positives = 78/86 (90%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLTS+G+QQYRALTV ELT QM
Sbjct: 233 SGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSQGSQQYRALTVAELTQQM 292

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRG 259
           FDAKNMM A DPRHG YLT A IFRG
Sbjct: 293 FDAKNMMAARDPRHGCYLTAAAIFRG 318



 Score =  139 bits (336), Expect = 1e-32
 Identities = 62/85 (72%), Positives = 72/85 (84%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GRM M+EVDEQ+ NIQ+KNS+YF +W+PNN K AVCDIPP GLKM+ TF GN TA+Q +
Sbjct: 317 RGRMPMREVDEQMFNIQDKNSSYFADWLPNNIKTAVCDIPPWGLKMSVTFTGNNTAVQEL 376

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
            KRVSEQF A FRRKAFLHWYTGEG
Sbjct: 377 -KRVSEQFTATFRRKAFLHWYTGEG 400



 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 391 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 424


>U83110-1|AAB41497.1|  434|Homo sapiens beta-tubulin protein.
          Length = 434

 Score =  161 bits (390), Expect = 3e-39
 Identities = 74/86 (86%), Positives = 78/86 (90%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLTS+G+QQYRALTV ELT QM
Sbjct: 234 SGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSQGSQQYRALTVAELTQQM 293

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRG 259
           FDAKNMM A DPRHG YLT A IFRG
Sbjct: 294 FDAKNMMAARDPRHGCYLTAAAIFRG 319



 Score =  139 bits (336), Expect = 1e-32
 Identities = 62/85 (72%), Positives = 72/85 (84%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GRM M+EVDEQ+ NIQ+KNS+YF +W+PNN K AVCDIPP GLKM+ TF GN TA+Q +
Sbjct: 318 RGRMPMREVDEQMFNIQDKNSSYFADWLPNNIKTAVCDIPPWGLKMSVTFTGNNTAVQEL 377

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
            KRVSEQF A FRRKAFLHWYTGEG
Sbjct: 378 -KRVSEQFTATFRRKAFLHWYTGEG 401



 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 392 AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 425


>BC062532-1|AAH62532.1|  124|Homo sapiens TUBB protein protein.
          Length = 124

 Score =  159 bits (386), Expect = 9e-39
 Identities = 70/82 (85%), Positives = 76/82 (92%)
 Frame = +1

Query: 262 MSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTIFKR 441
           MSMKEVDEQ+ N+QNKNS+YFVEWIPNN K AVCDIPPRGLKMA TFIGN+TAIQ +FKR
Sbjct: 1   MSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNSTAIQELFKR 60

Query: 442 VSEQFVAMFRRKAFLHWYTGEG 507
           +SEQF AMFRRKAFLHWYTGEG
Sbjct: 61  ISEQFTAMFRRKAFLHWYTGEG 82



 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 73  AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 106


>BC033679-1|AAH33679.1|  451|Homo sapiens tubulin, beta 1 protein.
          Length = 451

 Score =  153 bits (372), Expect = 4e-37
 Identities = 73/105 (69%), Positives = 85/105 (80%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SGITT LRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLT++G+QQYRAL+V ELT QM
Sbjct: 234 SGITTSLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTAQGSQQYRALSVAELTQQM 293

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTKTA 316
           FDA+N M ACD R GRYLTVA IFRG+   K++       +T+ +
Sbjct: 294 FDARNTMAACDLRRGRYLTVACIFRGKMSTKEVDQQLLSVQTRNS 338



 Score =  142 bits (345), Expect = 8e-34
 Identities = 62/85 (72%), Positives = 73/85 (85%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +G+MS KEVD+QL ++Q +NS+ FVEWIPNN K+AVCDIPPRGL MA+TFIGN TAIQ I
Sbjct: 318 RGKMSTKEVDQQLLSVQTRNSSCFVEWIPNNVKVAVCDIPPRGLSMAATFIGNNTAIQEI 377

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           F RVSE F AMF+RKAF+HWYT EG
Sbjct: 378 FNRVSEHFSAMFKRKAFVHWYTSEG 402



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 20/34 (58%), Positives = 25/34 (73%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A VHW    G D  EF EAE+N++DL+SEYQQ+Q
Sbjct: 393 AFVHWYTSEGMDINEFGEAENNIHDLVSEYQQFQ 426


>AL109840-7|CAC09371.2|  451|Homo sapiens tubulin, beta 1 protein.
          Length = 451

 Score =  153 bits (372), Expect = 4e-37
 Identities = 73/105 (69%), Positives = 85/105 (80%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SGITT LRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLT++G+QQYRAL+V ELT QM
Sbjct: 234 SGITTSLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTAQGSQQYRALSVAELTQQM 293

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTKTA 316
           FDA+N M ACD R GRYLTVA IFRG+   K++       +T+ +
Sbjct: 294 FDARNTMAACDLRRGRYLTVACIFRGKMSTKEVDQQLLSVQTRNS 338



 Score =  142 bits (345), Expect = 8e-34
 Identities = 62/85 (72%), Positives = 73/85 (85%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +G+MS KEVD+QL ++Q +NS+ FVEWIPNN K+AVCDIPPRGL MA+TFIGN TAIQ I
Sbjct: 318 RGKMSTKEVDQQLLSVQTRNSSCFVEWIPNNVKVAVCDIPPRGLSMAATFIGNNTAIQEI 377

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           F RVSE F AMF+RKAF+HWYT EG
Sbjct: 378 FNRVSEHFSAMFKRKAFVHWYTSEG 402



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 20/34 (58%), Positives = 25/34 (73%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A VHW    G D  EF EAE+N++DL+SEYQQ+Q
Sbjct: 393 AFVHWYTSEGMDINEFGEAENNIHDLVSEYQQFQ 426


>AJ292757-1|CAC16605.1|  451|Homo sapiens protein ( Homo sapiens
           TUBB1 gene for human beta tubulin 1, class VI. ).
          Length = 451

 Score =  153 bits (372), Expect = 4e-37
 Identities = 73/105 (69%), Positives = 85/105 (80%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SGITT LRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLT++G+QQYRAL+V ELT QM
Sbjct: 234 SGITTSLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTAQGSQQYRALSVAELTQQM 293

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTKTA 316
           FDA+N M ACD R GRYLTVA IFRG+   K++       +T+ +
Sbjct: 294 FDARNTMAACDLRRGRYLTVACIFRGKMSTKEVDQQLLSVQTRNS 338



 Score =  142 bits (345), Expect = 8e-34
 Identities = 62/85 (72%), Positives = 73/85 (85%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +G+MS KEVD+QL ++Q +NS+ FVEWIPNN K+AVCDIPPRGL MA+TFIGN TAIQ I
Sbjct: 318 RGKMSTKEVDQQLLSVQTRNSSCFVEWIPNNVKVAVCDIPPRGLSMAATFIGNNTAIQEI 377

Query: 433 FKRVSEQFVAMFRRKAFLHWYTGEG 507
           F RVSE F AMF+RKAF+HWYT EG
Sbjct: 378 FNRVSEHFSAMFKRKAFVHWYTSEG 402



 Score = 40.3 bits (90), Expect = 0.006
 Identities = 20/34 (58%), Positives = 25/34 (73%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A VHW    G D  EF EAE+N++DL+SEYQQ+Q
Sbjct: 393 AFVHWYTSEGMDINEFGEAENNIHDLVSEYQQFQ 426


>AL713922-2|CAI16219.1|  227|Homo sapiens novel protein similar to
           beta-tubulin 4Q (TUBB4Q)kinase) II gamma protein.
          Length = 227

 Score =  132 bits (318), Expect = 2e-30
 Identities = 60/66 (90%), Positives = 63/66 (95%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           SG+TTCLRFPGQLNADLRKLAVNMVPFPRLHF+ PGFAPLTSRG+QQYRALTV ELT QM
Sbjct: 162 SGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVAELTQQM 221

Query: 182 FDAKNM 199
           FDAKNM
Sbjct: 222 FDAKNM 227


>EF036499-1|ABO65085.1|   88|Homo sapiens tubulin beta 2C protein.
          Length = 88

 Score =  110 bits (264), Expect = 5e-24
 Identities = 48/62 (77%), Positives = 55/62 (88%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTI 432
           +GRMSMKEVDEQ+ N+QNKNS+YFVEWIPNN K AVCDIPPRGLKM+ TFIGN+TA Q +
Sbjct: 27  RGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSXTFIGNSTAXQEL 86

Query: 433 FK 438
            K
Sbjct: 87  XK 88



 Score = 60.9 bits (141), Expect = 4e-09
 Identities = 25/28 (89%), Positives = 26/28 (92%)
 Frame = +2

Query: 176 QMFDAKNMMVACDPRHGRYLTVATIFRG 259
           QMFDAKNMM ACDPRHGRYLTVA +FRG
Sbjct: 1   QMFDAKNMMAACDPRHGRYLTVAAVFRG 28


>BC063036-1|AAH63036.1|  449|Homo sapiens tubulin, alpha 1c protein.
          Length = 449

 Score = 92.7 bits (220), Expect = 1e-18
 Identities = 42/103 (40%), Positives = 60/103 (58%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S IT  LRF G LN DL +   N+VP+PR+HF    +AP+ S     +  LTV E+T   
Sbjct: 236 SSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLTVAEITNAC 295

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTK 310
           F+  N MV CDPRHG+Y+    ++RG+ + K + +     +TK
Sbjct: 296 FEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTK 338



 Score = 60.5 bits (140), Expect = 6e-09
 Identities = 29/93 (31%), Positives = 50/93 (53%), Gaps = 8/93 (8%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPR--------GLKMASTFIG 408
           +G +  K+V+  +A I+ K +  FV+W P   K+ +   PP          ++ A   + 
Sbjct: 320 RGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLS 379

Query: 409 NTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
           NTTA+   + R+  +F  M+ ++AF+HWY GEG
Sbjct: 380 NTTAVAEAWARLDHKFDLMYAKRAFVHWYVGEG 412


>BC051297-1|AAH51297.1|  449|Homo sapiens tubulin, alpha 1c protein.
          Length = 449

 Score = 92.7 bits (220), Expect = 1e-18
 Identities = 42/103 (40%), Positives = 60/103 (58%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S IT  LRF G LN DL +   N+VP+PR+HF    +AP+ S     +  LTV E+T   
Sbjct: 236 SSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLTVAEITNAC 295

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTK 310
           F+  N MV CDPRHG+Y+    ++RG+ + K + +     +TK
Sbjct: 296 FEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTK 338



 Score = 60.5 bits (140), Expect = 6e-09
 Identities = 29/93 (31%), Positives = 50/93 (53%), Gaps = 8/93 (8%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPR--------GLKMASTFIG 408
           +G +  K+V+  +A I+ K +  FV+W P   K+ +   PP          ++ A   + 
Sbjct: 320 RGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLS 379

Query: 409 NTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
           NTTA+   + R+  +F  M+ ++AF+HWY GEG
Sbjct: 380 NTTAVAEAWARLDHKFDLMYAKRAFVHWYVGEG 412


>BC021088-1|AAH21088.1|  449|Homo sapiens tubulin, alpha 1c protein.
          Length = 449

 Score = 92.7 bits (220), Expect = 1e-18
 Identities = 42/103 (40%), Positives = 60/103 (58%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S IT  LRF G LN DL +   N+VP+PR+HF    +AP+ S     +  LTV E+T   
Sbjct: 236 SSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLTVAEITNAC 295

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTK 310
           F+  N MV CDPRHG+Y+    ++RG+ + K + +     +TK
Sbjct: 296 FEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTK 338



 Score = 60.5 bits (140), Expect = 6e-09
 Identities = 29/93 (31%), Positives = 50/93 (53%), Gaps = 8/93 (8%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPR--------GLKMASTFIG 408
           +G +  K+V+  +A I+ K +  FV+W P   K+ +   PP          ++ A   + 
Sbjct: 320 RGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLS 379

Query: 409 NTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
           NTTA+   + R+  +F  M+ ++AF+HWY GEG
Sbjct: 380 NTTAVAEAWARLDHKFDLMYAKRAFVHWYVGEG 412


>BC019298-1|AAH19298.1|  449|Homo sapiens tubulin, alpha 1c protein.
          Length = 449

 Score = 92.7 bits (220), Expect = 1e-18
 Identities = 42/103 (40%), Positives = 60/103 (58%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S IT  LRF G LN DL +   N+VP+PR+HF    +AP+ S     +  LTV E+T   
Sbjct: 236 SSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLTVAEITNAC 295

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTK 310
           F+  N MV CDPRHG+Y+    ++RG+ + K + +     +TK
Sbjct: 296 FEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTK 338



 Score = 60.5 bits (140), Expect = 6e-09
 Identities = 29/93 (31%), Positives = 50/93 (53%), Gaps = 8/93 (8%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPR--------GLKMASTFIG 408
           +G +  K+V+  +A I+ K +  FV+W P   K+ +   PP          ++ A   + 
Sbjct: 320 RGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLS 379

Query: 409 NTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
           NTTA+   + R+  +F  M+ ++AF+HWY GEG
Sbjct: 380 NTTAVAEAWARLDHKFDLMYAKRAFVHWYVGEG 412


>BC011790-1|AAH11790.1|  449|Homo sapiens tubulin, alpha 1c protein.
          Length = 449

 Score = 92.7 bits (220), Expect = 1e-18
 Identities = 42/103 (40%), Positives = 60/103 (58%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S IT  LRF G LN DL +   N+VP+PR+HF    +AP+ S     +  LTV E+T   
Sbjct: 236 SSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLTVAEITNAC 295

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTK 310
           F+  N MV CDPRHG+Y+    ++RG+ + K + +     +TK
Sbjct: 296 FEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTK 338



 Score = 60.5 bits (140), Expect = 6e-09
 Identities = 29/93 (31%), Positives = 50/93 (53%), Gaps = 8/93 (8%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPR--------GLKMASTFIG 408
           +G +  K+V+  +A I+ K +  FV+W P   K+ +   PP          ++ A   + 
Sbjct: 320 RGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLS 379

Query: 409 NTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
           NTTA+   + R+  +F  M+ ++AF+HWY GEG
Sbjct: 380 NTTAVAEAWARLDHKFDLMYAKRAFVHWYVGEG 412


>BC005946-1|AAH05946.1|  449|Homo sapiens tubulin, alpha 1c protein.
          Length = 449

 Score = 92.7 bits (220), Expect = 1e-18
 Identities = 42/103 (40%), Positives = 60/103 (58%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S IT  LRF G LN DL +   N+VP+PR+HF    +AP+ S     +  LTV E+T   
Sbjct: 236 SSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLTVAEITNAC 295

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTK 310
           F+  N MV CDPRHG+Y+    ++RG+ + K + +     +TK
Sbjct: 296 FEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTK 338



 Score = 60.5 bits (140), Expect = 6e-09
 Identities = 29/93 (31%), Positives = 50/93 (53%), Gaps = 8/93 (8%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPR--------GLKMASTFIG 408
           +G +  K+V+  +A I+ K +  FV+W P   K+ +   PP          ++ A   + 
Sbjct: 320 RGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLS 379

Query: 409 NTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
           NTTA+   + R+  +F  M+ ++AF+HWY GEG
Sbjct: 380 NTTAVAEAWARLDHKFDLMYAKRAFVHWYVGEG 412


>BC004949-1|AAH04949.1|  449|Homo sapiens tubulin, alpha 1c protein.
          Length = 449

 Score = 92.7 bits (220), Expect = 1e-18
 Identities = 42/103 (40%), Positives = 60/103 (58%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S IT  LRF G LN DL +   N+VP+PR+HF    +AP+ S     +  LTV E+T   
Sbjct: 236 SSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLTVAEITNAC 295

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTK 310
           F+  N MV CDPRHG+Y+    ++RG+ + K + +     +TK
Sbjct: 296 FEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTK 338



 Score = 60.5 bits (140), Expect = 6e-09
 Identities = 29/93 (31%), Positives = 50/93 (53%), Gaps = 8/93 (8%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPR--------GLKMASTFIG 408
           +G +  K+V+  +A I+ K +  FV+W P   K+ +   PP          ++ A   + 
Sbjct: 320 RGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLS 379

Query: 409 NTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
           NTTA+   + R+  +F  M+ ++AF+HWY GEG
Sbjct: 380 NTTAVAEAWARLDHKFDLMYAKRAFVHWYVGEG 412


>AK223024-1|BAD96744.1|  449|Homo sapiens tubulin alpha 6 variant
           protein.
          Length = 449

 Score = 92.7 bits (220), Expect = 1e-18
 Identities = 42/103 (40%), Positives = 60/103 (58%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S IT  LRF G LN DL +   N+VP+PR+HF    +AP+ S     +  LTV E+T   
Sbjct: 236 SSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLTVAEITNAC 295

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTK 310
           F+  N MV CDPRHG+Y+    ++RG+ + K + +     +TK
Sbjct: 296 FEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTK 338



 Score = 60.5 bits (140), Expect = 6e-09
 Identities = 29/93 (31%), Positives = 50/93 (53%), Gaps = 8/93 (8%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPR--------GLKMASTFIG 408
           +G +  K+V+  +A I+ K +  FV+W P   K+ +   PP          ++ A   + 
Sbjct: 320 RGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLS 379

Query: 409 NTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
           NTTA+   + R+  +F  M+ ++AF+HWY GEG
Sbjct: 380 NTTAVAEAWARLDHKFDLMYAKRAFVHWYVGEG 412


>X06956-1|CAA30026.1|  447|Homo sapiens alpha-tubulin protein.
          Length = 447

 Score = 91.1 bits (216), Expect = 3e-18
 Identities = 41/103 (39%), Positives = 60/103 (58%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S IT  LRF G LN DL +   N+VP+PR+HF    +AP+ S     +  L+V E+T   
Sbjct: 235 SSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNAC 294

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTK 310
           F+  N MV CDPRHG+Y+    ++RG+ + K + +     +TK
Sbjct: 295 FEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIAAIKTK 337



 Score = 61.3 bits (142), Expect = 3e-09
 Identities = 31/93 (33%), Positives = 50/93 (53%), Gaps = 8/93 (8%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPR--------GLKMASTFIG 408
           +G +  K+V+  +A I+ K S  FV+W P   K+ +   PP          ++ A   + 
Sbjct: 319 RGDVVPKDVNAAIAAIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLS 378

Query: 409 NTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
           NTTAI   + R+  +F  M+ ++AF+HWY GEG
Sbjct: 379 NTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEG 411


>DQ422808-1|ABD72607.1|  450|Homo sapiens tubulin, alpha 2 protein.
          Length = 450

 Score = 91.1 bits (216), Expect = 3e-18
 Identities = 41/103 (39%), Positives = 60/103 (58%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S IT  LRF G LN DL +   N+VP+PR+HF    +AP+ S     +  L+V E+T   
Sbjct: 236 SSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNAC 295

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTK 310
           F+  N MV CDPRHG+Y+    ++RG+ + K + +     +TK
Sbjct: 296 FEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTK 338



 Score = 61.3 bits (142), Expect = 3e-09
 Identities = 31/97 (31%), Positives = 51/97 (52%), Gaps = 8/97 (8%)
 Frame = +1

Query: 241 CDDIQGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPR--------GLKMAS 396
           C   +G +  K+V+  +A I+ K +  FV+W P   K+ +   PP          ++ A 
Sbjct: 316 CMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAV 375

Query: 397 TFIGNTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
             + NTTAI   + R+  +F  M+ ++AF+HWY GEG
Sbjct: 376 CMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEG 412


>DQ400107-1|ABD60581.1|  451|Homo sapiens alpha tubulin protein.
          Length = 451

 Score = 91.1 bits (216), Expect = 3e-18
 Identities = 41/103 (39%), Positives = 60/103 (58%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S IT  LRF G LN DL +   N+VP+PR+HF    +AP+ S     +  L+V E+T   
Sbjct: 236 SSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNAC 295

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTK 310
           F+  N MV CDPRHG+Y+    ++RG+ + K + +     +TK
Sbjct: 296 FEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTK 338



 Score = 62.1 bits (144), Expect = 2e-09
 Identities = 31/93 (33%), Positives = 50/93 (53%), Gaps = 8/93 (8%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPR--------GLKMASTFIG 408
           +G +  K+V+  +A I+ K S  FV+W P   K+ +   PP          ++ A   + 
Sbjct: 320 RGDVVPKDVNAAIATIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLS 379

Query: 409 NTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
           NTTAI   + R+  +F  M+ ++AF+HWY GEG
Sbjct: 380 NTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEG 412


>BT006731-1|AAP35377.1|  448|Homo sapiens tubulin, alpha 1 (testis
           specific) protein.
          Length = 448

 Score = 91.1 bits (216), Expect = 3e-18
 Identities = 41/103 (39%), Positives = 60/103 (58%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S IT  LRF G LN DL +   N+VP+PR+HF    +AP+ S     +  L+V E+T   
Sbjct: 236 SSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNAC 295

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTK 310
           F+  N MV CDPRHG+Y+    ++RG+ + K + +     +TK
Sbjct: 296 FEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIAAIKTK 338



 Score = 61.3 bits (142), Expect = 3e-09
 Identities = 31/93 (33%), Positives = 50/93 (53%), Gaps = 8/93 (8%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPR--------GLKMASTFIG 408
           +G +  K+V+  +A I+ K S  FV+W P   K+ +   PP          ++ A   + 
Sbjct: 320 RGDVVPKDVNAAIAAIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLS 379

Query: 409 NTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
           NTTAI   + R+  +F  M+ ++AF+HWY GEG
Sbjct: 380 NTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEG 412


>BC071904-1|AAH71904.1|  451|Homo sapiens tubulin, alpha 1b protein.
          Length = 451

 Score = 91.1 bits (216), Expect = 3e-18
 Identities = 41/103 (39%), Positives = 60/103 (58%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S IT  LRF G LN DL +   N+VP+PR+HF    +AP+ S     +  L+V E+T   
Sbjct: 236 SSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNAC 295

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTK 310
           F+  N MV CDPRHG+Y+    ++RG+ + K + +     +TK
Sbjct: 296 FEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTK 338



 Score = 62.1 bits (144), Expect = 2e-09
 Identities = 31/93 (33%), Positives = 50/93 (53%), Gaps = 8/93 (8%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPR--------GLKMASTFIG 408
           +G +  K+V+  +A I+ K S  FV+W P   K+ +   PP          ++ A   + 
Sbjct: 320 RGDVVPKDVNAAIATIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLS 379

Query: 409 NTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
           NTTAI   + R+  +F  M+ ++AF+HWY GEG
Sbjct: 380 NTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEG 412


>BC057811-1|AAH57811.1|  450|Homo sapiens tubulin, alpha 3e protein.
          Length = 450

 Score = 91.1 bits (216), Expect = 3e-18
 Identities = 41/103 (39%), Positives = 60/103 (58%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S IT  LRF G LN DL +   N+VP+PR+HF    +AP+ S     +  L+V E+T   
Sbjct: 236 SSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNAC 295

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTK 310
           F+  N MV CDPRHG+Y+    ++RG+ + K + +     +TK
Sbjct: 296 FEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTK 338



 Score = 58.4 bits (135), Expect = 2e-08
 Identities = 31/97 (31%), Positives = 50/97 (51%), Gaps = 8/97 (8%)
 Frame = +1

Query: 241 CDDIQGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPR--------GLKMAS 396
           C   +G +  K+V+  +A I+ K +  FV+W P   K+ +   PP          ++ A 
Sbjct: 316 CMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAV 375

Query: 397 TFIGNTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
             + NTTAI   + R+  +F  M+ + AF+HWY GEG
Sbjct: 376 CMLSNTTAIAEAWARLVHKFDLMYAKWAFVHWYVGEG 412


>BC050637-1|AAH50637.1|  451|Homo sapiens tubulin, alpha 1a protein.
          Length = 451

 Score = 91.1 bits (216), Expect = 3e-18
 Identities = 41/103 (39%), Positives = 60/103 (58%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S IT  LRF G LN DL +   N+VP+PR+HF    +AP+ S     +  L+V E+T   
Sbjct: 236 SSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNAC 295

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTK 310
           F+  N MV CDPRHG+Y+    ++RG+ + K + +     +TK
Sbjct: 296 FEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTK 338



 Score = 60.9 bits (141), Expect = 4e-09
 Identities = 30/93 (32%), Positives = 50/93 (53%), Gaps = 8/93 (8%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPR--------GLKMASTFIG 408
           +G +  K+V+  +A I+ K +  FV+W P   K+ +   PP          ++ A   + 
Sbjct: 320 RGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLS 379

Query: 409 NTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
           NTTAI   + R+  +F  M+ ++AF+HWY GEG
Sbjct: 380 NTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEG 412


>BC030820-1|AAH30820.1|  451|Homo sapiens tubulin, alpha 1b protein.
          Length = 451

 Score = 91.1 bits (216), Expect = 3e-18
 Identities = 41/103 (39%), Positives = 60/103 (58%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S IT  LRF G LN DL +   N+VP+PR+HF    +AP+ S     +  L+V E+T   
Sbjct: 236 SSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNAC 295

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTK 310
           F+  N MV CDPRHG+Y+    ++RG+ + K + +     +TK
Sbjct: 296 FEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTK 338



 Score = 62.1 bits (144), Expect = 2e-09
 Identities = 31/93 (33%), Positives = 50/93 (53%), Gaps = 8/93 (8%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPR--------GLKMASTFIG 408
           +G +  K+V+  +A I+ K S  FV+W P   K+ +   PP          ++ A   + 
Sbjct: 320 RGDVVPKDVNAAIATIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLS 379

Query: 409 NTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
           NTTAI   + R+  +F  M+ ++AF+HWY GEG
Sbjct: 380 NTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEG 412


>BC021564-1|AAH21564.1|  335|Homo sapiens TUBA1B protein protein.
          Length = 335

 Score = 91.1 bits (216), Expect = 3e-18
 Identities = 41/103 (39%), Positives = 60/103 (58%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S IT  LRF G LN DL +   N+VP+PR+HF    +AP+ S     +  L+V E+T   
Sbjct: 120 SSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNAC 179

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTK 310
           F+  N MV CDPRHG+Y+    ++RG+ + K + +     +TK
Sbjct: 180 FEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTK 222



 Score = 62.1 bits (144), Expect = 2e-09
 Identities = 31/93 (33%), Positives = 50/93 (53%), Gaps = 8/93 (8%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPR--------GLKMASTFIG 408
           +G +  K+V+  +A I+ K S  FV+W P   K+ +   PP          ++ A   + 
Sbjct: 204 RGDVVPKDVNAAIATIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLS 263

Query: 409 NTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
           NTTAI   + R+  +F  M+ ++AF+HWY GEG
Sbjct: 264 NTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEG 296


>BC017004-1|AAH17004.1|  451|Homo sapiens tubulin, alpha 1b protein.
          Length = 451

 Score = 91.1 bits (216), Expect = 3e-18
 Identities = 41/103 (39%), Positives = 60/103 (58%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S IT  LRF G LN DL +   N+VP+PR+HF    +AP+ S     +  L+V E+T   
Sbjct: 236 SSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNAC 295

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTK 310
           F+  N MV CDPRHG+Y+    ++RG+ + K + +     +TK
Sbjct: 296 FEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTK 338



 Score = 62.1 bits (144), Expect = 2e-09
 Identities = 31/93 (33%), Positives = 50/93 (53%), Gaps = 8/93 (8%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPR--------GLKMASTFIG 408
           +G +  K+V+  +A I+ K S  FV+W P   K+ +   PP          ++ A   + 
Sbjct: 320 RGDVVPKDVNAAIATIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLS 379

Query: 409 NTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
           NTTAI   + R+  +F  M+ ++AF+HWY GEG
Sbjct: 380 NTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEG 412


>BC015883-1|AAH15883.1|  451|Homo sapiens tubulin, alpha 1b protein.
          Length = 451

 Score = 91.1 bits (216), Expect = 3e-18
 Identities = 41/103 (39%), Positives = 60/103 (58%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S IT  LRF G LN DL +   N+VP+PR+HF    +AP+ S     +  L+V E+T   
Sbjct: 236 SSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNAC 295

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTK 310
           F+  N MV CDPRHG+Y+    ++RG+ + K + +     +TK
Sbjct: 296 FEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTK 338



 Score = 62.1 bits (144), Expect = 2e-09
 Identities = 31/93 (33%), Positives = 50/93 (53%), Gaps = 8/93 (8%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPR--------GLKMASTFIG 408
           +G +  K+V+  +A I+ K S  FV+W P   K+ +   PP          ++ A   + 
Sbjct: 320 RGDVVPKDVNAAIATIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLS 379

Query: 409 NTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
           NTTAI   + R+  +F  M+ ++AF+HWY GEG
Sbjct: 380 NTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEG 412


>BC011721-1|AAH11721.1|  418|Homo sapiens tubulin, alpha 3c protein.
          Length = 418

 Score = 91.1 bits (216), Expect = 3e-18
 Identities = 41/103 (39%), Positives = 60/103 (58%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S IT  LRF G LN DL +   N+VP+PR+HF    +AP+ S     +  L+V E+T   
Sbjct: 236 SSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNAC 295

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTK 310
           F+  N MV CDPRHG+Y+    ++RG+ + K + +     +TK
Sbjct: 296 FEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTK 338



 Score = 33.9 bits (74), Expect = 0.56
 Identities = 21/76 (27%), Positives = 36/76 (47%), Gaps = 8/76 (10%)
 Frame = +1

Query: 241 CDDIQGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPP--------RGLKMAS 396
           C   +G +  K+V+  +A I+ K +  FV+W P   K+ +   PP          ++ A 
Sbjct: 316 CMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAV 375

Query: 397 TFIGNTTAIQTIFKRV 444
             + NTTAI   + R+
Sbjct: 376 CMLSNTTAIAEAWARL 391


>BC011572-1|AAH11572.1|  451|Homo sapiens tubulin, alpha 1b protein.
          Length = 451

 Score = 91.1 bits (216), Expect = 3e-18
 Identities = 41/103 (39%), Positives = 60/103 (58%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S IT  LRF G LN DL +   N+VP+PR+HF    +AP+ S     +  L+V E+T   
Sbjct: 236 SSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNAC 295

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTK 310
           F+  N MV CDPRHG+Y+    ++RG+ + K + +     +TK
Sbjct: 296 FEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTK 338



 Score = 62.1 bits (144), Expect = 2e-09
 Identities = 31/93 (33%), Positives = 50/93 (53%), Gaps = 8/93 (8%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPR--------GLKMASTFIG 408
           +G +  K+V+  +A I+ K S  FV+W P   K+ +   PP          ++ A   + 
Sbjct: 320 RGDVVPKDVNAAIATIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLS 379

Query: 409 NTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
           NTTAI   + R+  +F  M+ ++AF+HWY GEG
Sbjct: 380 NTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEG 412


>BC010494-1|AAH10494.1|  451|Homo sapiens tubulin, alpha 1b protein.
          Length = 451

 Score = 91.1 bits (216), Expect = 3e-18
 Identities = 41/103 (39%), Positives = 60/103 (58%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S IT  LRF G LN DL +   N+VP+PR+HF    +AP+ S     +  L+V E+T   
Sbjct: 236 SSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNAC 295

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTK 310
           F+  N MV CDPRHG+Y+    ++RG+ + K + +     +TK
Sbjct: 296 FEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTK 338



 Score = 62.1 bits (144), Expect = 2e-09
 Identities = 31/93 (33%), Positives = 50/93 (53%), Gaps = 8/93 (8%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPR--------GLKMASTFIG 408
           +G +  K+V+  +A I+ K S  FV+W P   K+ +   PP          ++ A   + 
Sbjct: 320 RGDVVPKDVNAAIATIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLS 379

Query: 409 NTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
           NTTAI   + R+  +F  M+ ++AF+HWY GEG
Sbjct: 380 NTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEG 412


>BC009513-1|AAH09513.1|  451|Homo sapiens tubulin, alpha 1b protein.
          Length = 451

 Score = 91.1 bits (216), Expect = 3e-18
 Identities = 41/103 (39%), Positives = 60/103 (58%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S IT  LRF G LN DL +   N+VP+PR+HF    +AP+ S     +  L+V E+T   
Sbjct: 236 SSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNAC 295

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTK 310
           F+  N MV CDPRHG+Y+    ++RG+ + K + +     +TK
Sbjct: 296 FEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTK 338



 Score = 62.1 bits (144), Expect = 2e-09
 Identities = 31/93 (33%), Positives = 50/93 (53%), Gaps = 8/93 (8%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPR--------GLKMASTFIG 408
           +G +  K+V+  +A I+ K S  FV+W P   K+ +   PP          ++ A   + 
Sbjct: 320 RGDVVPKDVNAAIATIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLS 379

Query: 409 NTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
           NTTAI   + R+  +F  M+ ++AF+HWY GEG
Sbjct: 380 NTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEG 412


>BC009512-1|AAH09512.1|  451|Homo sapiens tubulin, alpha 1b protein.
          Length = 451

 Score = 91.1 bits (216), Expect = 3e-18
 Identities = 41/103 (39%), Positives = 60/103 (58%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S IT  LRF G LN DL +   N+VP+PR+HF    +AP+ S     +  L+V E+T   
Sbjct: 236 SSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNAC 295

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTK 310
           F+  N MV CDPRHG+Y+    ++RG+ + K + +     +TK
Sbjct: 296 FEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTK 338



 Score = 62.1 bits (144), Expect = 2e-09
 Identities = 31/93 (33%), Positives = 50/93 (53%), Gaps = 8/93 (8%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPR--------GLKMASTFIG 408
           +G +  K+V+  +A I+ K S  FV+W P   K+ +   PP          ++ A   + 
Sbjct: 320 RGDVVPKDVNAAIATIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLS 379

Query: 409 NTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
           NTTAI   + R+  +F  M+ ++AF+HWY GEG
Sbjct: 380 NTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEG 412


>BC009509-1|AAH09509.1|  451|Homo sapiens tubulin, alpha 1b protein.
          Length = 451

 Score = 91.1 bits (216), Expect = 3e-18
 Identities = 41/103 (39%), Positives = 60/103 (58%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S IT  LRF G LN DL +   N+VP+PR+HF    +AP+ S     +  L+V E+T   
Sbjct: 236 SSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNAC 295

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTK 310
           F+  N MV CDPRHG+Y+    ++RG+ + K + +     +TK
Sbjct: 296 FEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTK 338



 Score = 62.1 bits (144), Expect = 2e-09
 Identities = 31/93 (33%), Positives = 50/93 (53%), Gaps = 8/93 (8%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPR--------GLKMASTFIG 408
           +G +  K+V+  +A I+ K S  FV+W P   K+ +   PP          ++ A   + 
Sbjct: 320 RGDVVPKDVNAAIATIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLS 379

Query: 409 NTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
           NTTAI   + R+  +F  M+ ++AF+HWY GEG
Sbjct: 380 NTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEG 412


>BC009314-1|AAH09314.1|  451|Homo sapiens tubulin, alpha 1b protein.
          Length = 451

 Score = 91.1 bits (216), Expect = 3e-18
 Identities = 41/103 (39%), Positives = 60/103 (58%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S IT  LRF G LN DL +   N+VP+PR+HF    +AP+ S     +  L+V E+T   
Sbjct: 236 SSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNAC 295

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTK 310
           F+  N MV CDPRHG+Y+    ++RG+ + K + +     +TK
Sbjct: 296 FEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTK 338



 Score = 62.1 bits (144), Expect = 2e-09
 Identities = 31/93 (33%), Positives = 50/93 (53%), Gaps = 8/93 (8%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPR--------GLKMASTFIG 408
           +G +  K+V+  +A I+ K S  FV+W P   K+ +   PP          ++ A   + 
Sbjct: 320 RGDVVPKDVNAAIATIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLS 379

Query: 409 NTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
           NTTAI   + R+  +F  M+ ++AF+HWY GEG
Sbjct: 380 NTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEG 412


>BC009238-1|AAH09238.1|  448|Homo sapiens tubulin, alpha 4a protein.
          Length = 448

 Score = 91.1 bits (216), Expect = 3e-18
 Identities = 41/103 (39%), Positives = 60/103 (58%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S IT  LRF G LN DL +   N+VP+PR+HF    +AP+ S     +  L+V E+T   
Sbjct: 236 SSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNAC 295

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTK 310
           F+  N MV CDPRHG+Y+    ++RG+ + K + +     +TK
Sbjct: 296 FEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIAAIKTK 338



 Score = 61.3 bits (142), Expect = 3e-09
 Identities = 31/93 (33%), Positives = 50/93 (53%), Gaps = 8/93 (8%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPR--------GLKMASTFIG 408
           +G +  K+V+  +A I+ K S  FV+W P   K+ +   PP          ++ A   + 
Sbjct: 320 RGDVVPKDVNAAIAAIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLS 379

Query: 409 NTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
           NTTAI   + R+  +F  M+ ++AF+HWY GEG
Sbjct: 380 NTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEG 412


>BC008659-1|AAH08659.1|  451|Homo sapiens tubulin, alpha 1b protein.
          Length = 451

 Score = 91.1 bits (216), Expect = 3e-18
 Identities = 41/103 (39%), Positives = 60/103 (58%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S IT  LRF G LN DL +   N+VP+PR+HF    +AP+ S     +  L+V E+T   
Sbjct: 236 SSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNAC 295

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTK 310
           F+  N MV CDPRHG+Y+    ++RG+ + K + +     +TK
Sbjct: 296 FEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTK 338



 Score = 62.1 bits (144), Expect = 2e-09
 Identities = 31/93 (33%), Positives = 50/93 (53%), Gaps = 8/93 (8%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPR--------GLKMASTFIG 408
           +G +  K+V+  +A I+ K S  FV+W P   K+ +   PP          ++ A   + 
Sbjct: 320 RGDVVPKDVNAAIATIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLS 379

Query: 409 NTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
           NTTAI   + R+  +F  M+ ++AF+HWY GEG
Sbjct: 380 NTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEG 412


>BC006481-1|AAH06481.1|  451|Homo sapiens tubulin, alpha 1b protein.
          Length = 451

 Score = 91.1 bits (216), Expect = 3e-18
 Identities = 41/103 (39%), Positives = 60/103 (58%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S IT  LRF G LN DL +   N+VP+PR+HF    +AP+ S     +  L+V E+T   
Sbjct: 236 SSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNAC 295

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTK 310
           F+  N MV CDPRHG+Y+    ++RG+ + K + +     +TK
Sbjct: 296 FEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTK 338



 Score = 62.1 bits (144), Expect = 2e-09
 Identities = 31/93 (33%), Positives = 50/93 (53%), Gaps = 8/93 (8%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPR--------GLKMASTFIG 408
           +G +  K+V+  +A I+ K S  FV+W P   K+ +   PP          ++ A   + 
Sbjct: 320 RGDVVPKDVNAAIATIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLS 379

Query: 409 NTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
           NTTAI   + R+  +F  M+ ++AF+HWY GEG
Sbjct: 380 NTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEG 412


>BC006468-1|AAH06468.1|  451|Homo sapiens tubulin, alpha 1a protein.
          Length = 451

 Score = 91.1 bits (216), Expect = 3e-18
 Identities = 41/103 (39%), Positives = 60/103 (58%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S IT  LRF G LN DL +   N+VP+PR+HF    +AP+ S     +  L+V E+T   
Sbjct: 236 SSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNAC 295

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTK 310
           F+  N MV CDPRHG+Y+    ++RG+ + K + +     +TK
Sbjct: 296 FEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTK 338



 Score = 60.9 bits (141), Expect = 4e-09
 Identities = 30/93 (32%), Positives = 50/93 (53%), Gaps = 8/93 (8%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPR--------GLKMASTFIG 408
           +G +  K+V+  +A I+ K +  FV+W P   K+ +   PP          ++ A   + 
Sbjct: 320 RGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLS 379

Query: 409 NTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
           NTTAI   + R+  +F  M+ ++AF+HWY GEG
Sbjct: 380 NTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEG 412


>BC006379-1|AAH06379.1|  451|Homo sapiens tubulin, alpha 1b protein.
          Length = 451

 Score = 91.1 bits (216), Expect = 3e-18
 Identities = 41/103 (39%), Positives = 60/103 (58%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S IT  LRF G LN DL +   N+VP+PR+HF    +AP+ S     +  L+V E+T   
Sbjct: 236 SSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNAC 295

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTK 310
           F+  N MV CDPRHG+Y+    ++RG+ + K + +     +TK
Sbjct: 296 FEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTK 338



 Score = 62.1 bits (144), Expect = 2e-09
 Identities = 31/93 (33%), Positives = 50/93 (53%), Gaps = 8/93 (8%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPR--------GLKMASTFIG 408
           +G +  K+V+  +A I+ K S  FV+W P   K+ +   PP          ++ A   + 
Sbjct: 320 RGDVVPKDVNAAIATIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLS 379

Query: 409 NTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
           NTTAI   + R+  +F  M+ ++AF+HWY GEG
Sbjct: 380 NTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEG 412


>BC001128-1|AAH01128.1|  451|Homo sapiens tubulin, alpha 1b protein.
          Length = 451

 Score = 91.1 bits (216), Expect = 3e-18
 Identities = 41/103 (39%), Positives = 60/103 (58%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S IT  LRF G LN DL +   N+VP+PR+HF    +AP+ S     +  L+V E+T   
Sbjct: 236 SSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNAC 295

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTK 310
           F+  N MV CDPRHG+Y+    ++RG+ + K + +     +TK
Sbjct: 296 FEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTK 338



 Score = 62.1 bits (144), Expect = 2e-09
 Identities = 31/93 (33%), Positives = 50/93 (53%), Gaps = 8/93 (8%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPR--------GLKMASTFIG 408
           +G +  K+V+  +A I+ K S  FV+W P   K+ +   PP          ++ A   + 
Sbjct: 320 RGDVVPKDVNAAIATIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLS 379

Query: 409 NTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
           NTTAI   + R+  +F  M+ ++AF+HWY GEG
Sbjct: 380 NTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEG 412


>BC000696-1|AAH00696.1|  451|Homo sapiens tubulin, alpha 1b protein.
          Length = 451

 Score = 91.1 bits (216), Expect = 3e-18
 Identities = 41/103 (39%), Positives = 60/103 (58%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S IT  LRF G LN DL +   N+VP+PR+HF    +AP+ S     +  L+V E+T   
Sbjct: 236 SSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNAC 295

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTK 310
           F+  N MV CDPRHG+Y+    ++RG+ + K + +     +TK
Sbjct: 296 FEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTK 338



 Score = 62.1 bits (144), Expect = 2e-09
 Identities = 31/93 (33%), Positives = 50/93 (53%), Gaps = 8/93 (8%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPR--------GLKMASTFIG 408
           +G +  K+V+  +A I+ K S  FV+W P   K+ +   PP          ++ A   + 
Sbjct: 320 RGDVVPKDVNAAIATIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLS 379

Query: 409 NTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
           NTTAI   + R+  +F  M+ ++AF+HWY GEG
Sbjct: 380 NTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEG 412


>AY895018-1|AAW65371.1|  448|Homo sapiens tubulin, alpha 1 (testis
           specific) protein.
          Length = 448

 Score = 91.1 bits (216), Expect = 3e-18
 Identities = 41/103 (39%), Positives = 60/103 (58%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S IT  LRF G LN DL +   N+VP+PR+HF    +AP+ S     +  L+V E+T   
Sbjct: 236 SSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNAC 295

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTK 310
           F+  N MV CDPRHG+Y+    ++RG+ + K + +     +TK
Sbjct: 296 FEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIAAIKTK 338



 Score = 61.3 bits (142), Expect = 3e-09
 Identities = 31/93 (33%), Positives = 50/93 (53%), Gaps = 8/93 (8%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPR--------GLKMASTFIG 408
           +G +  K+V+  +A I+ K S  FV+W P   K+ +   PP          ++ A   + 
Sbjct: 320 RGDVVPKDVNAAIAAIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLS 379

Query: 409 NTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
           NTTAI   + R+  +F  M+ ++AF+HWY GEG
Sbjct: 380 NTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEG 412


>AL139327-3|CAH73534.1|  450|Homo sapiens tubulin, alpha 3c protein.
          Length = 450

 Score = 91.1 bits (216), Expect = 3e-18
 Identities = 41/103 (39%), Positives = 60/103 (58%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S IT  LRF G LN DL +   N+VP+PR+HF    +AP+ S     +  L+V E+T   
Sbjct: 236 SSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNAC 295

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTK 310
           F+  N MV CDPRHG+Y+    ++RG+ + K + +     +TK
Sbjct: 296 FEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTK 338



 Score = 61.3 bits (142), Expect = 3e-09
 Identities = 31/97 (31%), Positives = 51/97 (52%), Gaps = 8/97 (8%)
 Frame = +1

Query: 241 CDDIQGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPR--------GLKMAS 396
           C   +G +  K+V+  +A I+ K +  FV+W P   K+ +   PP          ++ A 
Sbjct: 316 CMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAV 375

Query: 397 TFIGNTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
             + NTTAI   + R+  +F  M+ ++AF+HWY GEG
Sbjct: 376 CMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEG 412


>AF141348-1|AAD33872.1|  328|Homo sapiens alpha-tubulin protein.
          Length = 328

 Score = 91.1 bits (216), Expect = 3e-18
 Identities = 41/103 (39%), Positives = 60/103 (58%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S IT  LRF G LN DL +   N+VP+PR+HF    +AP+ S     +  L+V E+T   
Sbjct: 113 SSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNAC 172

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTK 310
           F+  N MV CDPRHG+Y+    ++RG+ + K + +     +TK
Sbjct: 173 FEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTK 215



 Score = 60.9 bits (141), Expect = 4e-09
 Identities = 30/93 (32%), Positives = 50/93 (53%), Gaps = 8/93 (8%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPR--------GLKMASTFIG 408
           +G +  K+V+  +A I+ K +  FV+W P   K+ +   PP          ++ A   + 
Sbjct: 197 RGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLS 256

Query: 409 NTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
           NTTAI   + R+  +F  M+ ++AF+HWY GEG
Sbjct: 257 NTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEG 289


>AF141347-1|AAD33871.1|  451|Homo sapiens alpha-tubulin protein.
          Length = 451

 Score = 91.1 bits (216), Expect = 3e-18
 Identities = 41/103 (39%), Positives = 60/103 (58%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S IT  LRF G LN DL +   N+VP+PR+HF    +AP+ S     +  L+V E+T   
Sbjct: 236 SSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNAC 295

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTK 310
           F+  N MV CDPRHG+Y+    ++RG+ + K + +     +TK
Sbjct: 296 FEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTK 338



 Score = 60.9 bits (141), Expect = 4e-09
 Identities = 30/93 (32%), Positives = 50/93 (53%), Gaps = 8/93 (8%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPR--------GLKMASTFIG 408
           +G +  K+V+  +A I+ K +  FV+W P   K+ +   PP          ++ A   + 
Sbjct: 320 RGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLS 379

Query: 409 NTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
           NTTAI   + R+  +F  M+ ++AF+HWY GEG
Sbjct: 380 NTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEG 412


>AF081484-1|AAC31959.1|  451|Homo sapiens alpha-tubulin isoform 1
           protein.
          Length = 451

 Score = 91.1 bits (216), Expect = 3e-18
 Identities = 41/103 (39%), Positives = 60/103 (58%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S IT  LRF G LN DL +   N+VP+PR+HF    +AP+ S     +  L+V E+T   
Sbjct: 236 SSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNAC 295

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTK 310
           F+  N MV CDPRHG+Y+    ++RG+ + K + +     +TK
Sbjct: 296 FEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTK 338



 Score = 62.1 bits (144), Expect = 2e-09
 Identities = 31/93 (33%), Positives = 50/93 (53%), Gaps = 8/93 (8%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPR--------GLKMASTFIG 408
           +G +  K+V+  +A I+ K S  FV+W P   K+ +   PP          ++ A   + 
Sbjct: 320 RGDVVPKDVNAAIATIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLS 379

Query: 409 NTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
           NTTAI   + R+  +F  M+ ++AF+HWY GEG
Sbjct: 380 NTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEG 412


>AF005392-1|AAC39578.1|  449|Homo sapiens alpha tubulin protein.
          Length = 449

 Score = 91.1 bits (216), Expect = 3e-18
 Identities = 41/103 (39%), Positives = 60/103 (58%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S IT  LRF G LN DL +   N+VP+PR+HF    +AP+ S     +  L+V E+T   
Sbjct: 235 SSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNAC 294

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTK 310
           F+  N MV CDPRHG+Y+    ++RG+ + K + +     +TK
Sbjct: 295 FEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTK 337



 Score = 61.3 bits (142), Expect = 3e-09
 Identities = 31/97 (31%), Positives = 51/97 (52%), Gaps = 8/97 (8%)
 Frame = +1

Query: 241 CDDIQGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPR--------GLKMAS 396
           C   +G +  K+V+  +A I+ K +  FV+W P   K+ +   PP          ++ A 
Sbjct: 315 CMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAV 374

Query: 397 TFIGNTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
             + NTTAI   + R+  +F  M+ ++AF+HWY GEG
Sbjct: 375 CMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEG 411


>CR456600-1|CAG30486.1|  449|Homo sapiens TUBA8 protein.
          Length = 449

 Score = 89.4 bits (212), Expect = 1e-17
 Identities = 43/108 (39%), Positives = 62/108 (57%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S IT  LRF G LN DL +   N+VP+PR+HF    +AP+ S     +  L+V E+T   
Sbjct: 236 SSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLVTYAPIISAEKAYHEQLSVAEITSSC 295

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTKTARIL 325
           F+  + MV CDPRHG+Y+    ++RG+ + K +  N  I   KT R +
Sbjct: 296 FEPNSQMVKCDPRHGKYMACCMLYRGDVVPKDV--NVAIAAIKTKRTI 341



 Score = 60.1 bits (139), Expect = 7e-09
 Identities = 31/97 (31%), Positives = 51/97 (52%), Gaps = 8/97 (8%)
 Frame = +1

Query: 241 CDDIQGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPR--------GLKMAS 396
           C   +G +  K+V+  +A I+ K +  FV+W P   K+ +   PP          ++ A 
Sbjct: 316 CMLYRGDVVPKDVNVAIAAIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAV 375

Query: 397 TFIGNTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
             + NTTAI   + R+  +F  M+ ++AF+HWY GEG
Sbjct: 376 CMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEG 412


>BX537702-1|CAD97815.1|  479|Homo sapiens hypothetical protein
           protein.
          Length = 479

 Score = 89.4 bits (212), Expect = 1e-17
 Identities = 43/108 (39%), Positives = 62/108 (57%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S IT  LRF G LN DL +   N+VP+PR+HF    +AP+ S     +  L+V E+T   
Sbjct: 235 SSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLVTYAPIISAEKAYHEQLSVAEITSSC 294

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTKTARIL 325
           F+  + MV CDPRHG+Y+    ++RG+ + K +  N  I   KT R +
Sbjct: 295 FEPNSQMVKCDPRHGKYMACCMLYRGDVVPKDV--NVAIAAIKTKRTI 340



 Score = 59.7 bits (138), Expect = 1e-08
 Identities = 31/97 (31%), Positives = 51/97 (52%), Gaps = 8/97 (8%)
 Frame = +1

Query: 241 CDDIQGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPR--------GLKMAS 396
           C   +G +  K+V+  +A I+ K +  FV+W P   K+ +   PP          ++ A 
Sbjct: 315 CMLYRGDVVPKDVNVAIAAIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAV 374

Query: 397 TFIGNTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
             + NTTAI   + R+  +F  M+ ++AF+HWY GEG
Sbjct: 375 CMLSNTTAIAEAWARLDHKFDLMYAKQAFVHWYVGEG 411


>BC104845-1|AAI04846.1|  449|Homo sapiens tubulin, alpha 8 protein.
          Length = 449

 Score = 89.4 bits (212), Expect = 1e-17
 Identities = 43/108 (39%), Positives = 62/108 (57%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S IT  LRF G LN DL +   N+VP+PR+HF    +AP+ S     +  L+V E+T   
Sbjct: 236 SSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLVTYAPIISAEKAYHEQLSVAEITSSC 295

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTKTARIL 325
           F+  + MV CDPRHG+Y+    ++RG+ + K +  N  I   KT R +
Sbjct: 296 FEPNSQMVKCDPRHGKYMACCMLYRGDVVPKDV--NVAIAAIKTKRTI 341



 Score = 60.1 bits (139), Expect = 7e-09
 Identities = 31/97 (31%), Positives = 51/97 (52%), Gaps = 8/97 (8%)
 Frame = +1

Query: 241 CDDIQGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPR--------GLKMAS 396
           C   +G +  K+V+  +A I+ K +  FV+W P   K+ +   PP          ++ A 
Sbjct: 316 CMLYRGDVVPKDVNVAIAAIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAV 375

Query: 397 TFIGNTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
             + NTTAI   + R+  +F  M+ ++AF+HWY GEG
Sbjct: 376 CMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEG 412


>BC074827-1|AAH74827.1|  449|Homo sapiens tubulin, alpha 8 protein.
          Length = 449

 Score = 89.4 bits (212), Expect = 1e-17
 Identities = 43/108 (39%), Positives = 62/108 (57%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S IT  LRF G LN DL +   N+VP+PR+HF    +AP+ S     +  L+V E+T   
Sbjct: 236 SSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLVTYAPIISAEKAYHEQLSVAEITSSC 295

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTKTARIL 325
           F+  + MV CDPRHG+Y+    ++RG+ + K +  N  I   KT R +
Sbjct: 296 FEPNSQMVKCDPRHGKYMACCMLYRGDVVPKDV--NVAIAAIKTKRTI 341



 Score = 60.1 bits (139), Expect = 7e-09
 Identities = 31/97 (31%), Positives = 51/97 (52%), Gaps = 8/97 (8%)
 Frame = +1

Query: 241 CDDIQGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPR--------GLKMAS 396
           C   +G +  K+V+  +A I+ K +  FV+W P   K+ +   PP          ++ A 
Sbjct: 316 CMLYRGDVVPKDVNVAIAAIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAV 375

Query: 397 TFIGNTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
             + NTTAI   + R+  +F  M+ ++AF+HWY GEG
Sbjct: 376 CMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEG 412


>AJ245922-1|CAB88036.1|  449|Homo sapiens alpha-tubulin 8 protein.
          Length = 449

 Score = 89.4 bits (212), Expect = 1e-17
 Identities = 43/108 (39%), Positives = 62/108 (57%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S IT  LRF G LN DL +   N+VP+PR+HF    +AP+ S     +  L+V E+T   
Sbjct: 236 SSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLVTYAPIISAEKAYHEQLSVAEITSSC 295

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTKTARIL 325
           F+  + MV CDPRHG+Y+    ++RG+ + K +  N  I   KT R +
Sbjct: 296 FEPNSQMVKCDPRHGKYMACCMLYRGDVVPKDV--NVAIAAIKTKRTI 341



 Score = 60.1 bits (139), Expect = 7e-09
 Identities = 31/97 (31%), Positives = 51/97 (52%), Gaps = 8/97 (8%)
 Frame = +1

Query: 241 CDDIQGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPR--------GLKMAS 396
           C   +G +  K+V+  +A I+ K +  FV+W P   K+ +   PP          ++ A 
Sbjct: 316 CMLYRGDVVPKDVNVAIAAIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAV 375

Query: 397 TFIGNTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
             + NTTAI   + R+  +F  M+ ++AF+HWY GEG
Sbjct: 376 CMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEG 412


>X01703-1|CAA25855.1|  451|Homo sapiens alpha-tubulin protein.
          Length = 451

 Score = 88.2 bits (209), Expect = 2e-17
 Identities = 40/103 (38%), Positives = 59/103 (57%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S IT  LRF G LN DL +   N+VP+PR+HF    +AP+ S     +  L+V E+T   
Sbjct: 236 SSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNAC 295

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTK 310
           F+  N MV CDP HG+Y+    ++RG+ + K + +     +TK
Sbjct: 296 FEPANQMVKCDPGHGKYMACCLLYRGDVVPKDVNAAIATIKTK 338



 Score = 60.9 bits (141), Expect = 4e-09
 Identities = 30/93 (32%), Positives = 50/93 (53%), Gaps = 8/93 (8%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPR--------GLKMASTFIG 408
           +G +  K+V+  +A I+ K +  FV+W P   K+ +   PP          ++ A   + 
Sbjct: 320 RGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLS 379

Query: 409 NTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
           NTTAI   + R+  +F  M+ ++AF+HWY GEG
Sbjct: 380 NTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEG 412


>K00558-1|AAA91576.1|  451|Homo sapiens protein ( human
           alpha-tubulin mRNA, complete cds. ).
          Length = 451

 Score = 87.0 bits (206), Expect = 6e-17
 Identities = 39/103 (37%), Positives = 59/103 (57%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S IT  LRF G LN DL +   N+VP+PR+HF    +AP+ S     +  L+V ++T   
Sbjct: 236 SSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVADITNAC 295

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTK 310
           F+  N MV CDP HG+Y+    ++RG+ + K + +     +TK
Sbjct: 296 FEPANQMVKCDPGHGKYMACCLLYRGDVVPKDVNAAIATIKTK 338



 Score = 60.9 bits (141), Expect = 4e-09
 Identities = 30/93 (32%), Positives = 50/93 (53%), Gaps = 8/93 (8%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPR--------GLKMASTFIG 408
           +G +  K+V+  +A I+ K +  FV+W P   K+ +   PP          ++ A   + 
Sbjct: 320 RGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLS 379

Query: 409 NTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
           NTTAI   + R+  +F  M+ ++AF+HWY GEG
Sbjct: 380 NTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEG 412


>K00557-1|AAA91575.1|  342|Homo sapiens alpha-tubulin protein.
          Length = 342

 Score = 87.0 bits (206), Expect = 6e-17
 Identities = 39/103 (37%), Positives = 59/103 (57%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S IT  LRF G LN DL +   N+VP+PR+HF    +AP+ S     +  L+V ++T   
Sbjct: 127 SSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVADITNAC 186

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTK 310
           F+  N MV CDP HG+Y+    ++RG+ + K + +     +TK
Sbjct: 187 FEPANQMVKCDPGHGKYMACCLLYRGDVVPKDVNAAIATIKTK 229



 Score = 60.9 bits (141), Expect = 4e-09
 Identities = 30/93 (32%), Positives = 50/93 (53%), Gaps = 8/93 (8%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPR--------GLKMASTFIG 408
           +G +  K+V+  +A I+ K +  FV+W P   K+ +   PP          ++ A   + 
Sbjct: 211 RGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLS 270

Query: 409 NTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
           NTTAI   + R+  +F  M+ ++AF+HWY GEG
Sbjct: 271 NTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEG 303


>BC057810-1|AAH57810.1|  450|Homo sapiens tubulin, alpha 3d protein.
          Length = 450

 Score = 86.6 bits (205), Expect = 8e-17
 Identities = 40/103 (38%), Positives = 59/103 (57%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S IT  LRF G LN DL +   N+VP+PR+HF    +AP+ S     +  L+V E+T   
Sbjct: 236 SSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNAC 295

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTSNWRIFRTK 310
           F+  N MV  DPRHG+Y+    ++RG+ + K + +     +TK
Sbjct: 296 FEPANQMVKYDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTK 338



 Score = 61.3 bits (142), Expect = 3e-09
 Identities = 31/97 (31%), Positives = 51/97 (52%), Gaps = 8/97 (8%)
 Frame = +1

Query: 241 CDDIQGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPR--------GLKMAS 396
           C   +G +  K+V+  +A I+ K +  FV+W P   K+ +   PP          ++ A 
Sbjct: 316 CMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAV 375

Query: 397 TFIGNTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
             + NTTAI   + R+  +F  M+ ++AF+HWY GEG
Sbjct: 376 CMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEG 412


>BC105634-1|AAI05635.1|  446|Homo sapiens tubulin, alpha-like 3
           protein.
          Length = 446

 Score = 85.8 bits (203), Expect = 1e-16
 Identities = 36/95 (37%), Positives = 57/95 (60%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S IT  LRF G LN DL +   N+VP+PR+HF    FAP+ S     +   +V ++T   
Sbjct: 243 SSITASLRFEGPLNVDLIEFQTNLVPYPRIHFPMTAFAPIVSADKAYHEQFSVSDITTAC 302

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTS 286
           F++ N +V CDPR G+Y+    ++RG+ + K++ +
Sbjct: 303 FESSNQLVKCDPRLGKYMACCLLYRGDVVPKEVNA 337



 Score = 58.4 bits (135), Expect = 2e-08
 Identities = 31/93 (33%), Positives = 51/93 (54%), Gaps = 8/93 (8%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPR---GLKMAST-----FIG 408
           +G +  KEV+  +A  ++++S  FV+W P   K+ + + PP    G  +A        + 
Sbjct: 327 RGDVVPKEVNAAIAATKSRHSVQFVDWCPTGFKVGINNRPPTVMPGGDLAKVHRSICMLS 386

Query: 409 NTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
           NTTAI   + R+  +F  M+ ++AFLHWY  EG
Sbjct: 387 NTTAIVEAWARLDHKFDLMYAKRAFLHWYLREG 419


>BC099716-1|AAH99716.1|  446|Homo sapiens tubulin, alpha-like 3
           protein.
          Length = 446

 Score = 85.8 bits (203), Expect = 1e-16
 Identities = 36/95 (37%), Positives = 57/95 (60%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S IT  LRF G LN DL +   N+VP+PR+HF    FAP+ S     +   +V ++T   
Sbjct: 243 SSITASLRFEGPLNVDLIEFQTNLVPYPRIHFPMTAFAPIVSADKAYHEQFSVSDITTAC 302

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTS 286
           F++ N +V CDPR G+Y+    ++RG+ + K++ +
Sbjct: 303 FESSNQLVKCDPRLGKYMACCLLYRGDVVPKEVNA 337



 Score = 58.4 bits (135), Expect = 2e-08
 Identities = 31/93 (33%), Positives = 51/93 (54%), Gaps = 8/93 (8%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPR---GLKMAST-----FIG 408
           +G +  KEV+  +A  ++++S  FV+W P   K+ + + PP    G  +A        + 
Sbjct: 327 RGDVVPKEVNAAIAATKSRHSVQFVDWCPTGFKVGINNRPPTVMPGGDLAKVHRSICMLS 386

Query: 409 NTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
           NTTAI   + R+  +F  M+ ++AFLHWY  EG
Sbjct: 387 NTTAIVEAWARLDHKFDLMYAKRAFLHWYLREG 419


>BC098247-1|AAH98247.1|  406|Homo sapiens TUBAL3 protein protein.
          Length = 406

 Score = 85.8 bits (203), Expect = 1e-16
 Identities = 36/95 (37%), Positives = 57/95 (60%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S IT  LRF G LN DL +   N+VP+PR+HF    FAP+ S     +   +V ++T   
Sbjct: 203 SSITASLRFEGPLNVDLIEFQTNLVPYPRIHFPMTAFAPIVSADKAYHEQFSVSDITTAC 262

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTS 286
           F++ N +V CDPR G+Y+    ++RG+ + K++ +
Sbjct: 263 FESSNQLVKCDPRLGKYMACCLLYRGDVVPKEVNA 297



 Score = 58.4 bits (135), Expect = 2e-08
 Identities = 31/93 (33%), Positives = 51/93 (54%), Gaps = 8/93 (8%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPR---GLKMAST-----FIG 408
           +G +  KEV+  +A  ++++S  FV+W P   K+ + + PP    G  +A        + 
Sbjct: 287 RGDVVPKEVNAAIAATKSRHSVQFVDWCPTGFKVGINNRPPTVMPGGDLAKVHRSICMLS 346

Query: 409 NTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
           NTTAI   + R+  +F  M+ ++AFLHWY  EG
Sbjct: 347 NTTAIVEAWARLDHKFDLMYAKRAFLHWYLREG 379


>AL683826-2|CAI23625.1|  446|Homo sapiens tubulin, alpha-like 3
           protein.
          Length = 446

 Score = 85.8 bits (203), Expect = 1e-16
 Identities = 36/95 (37%), Positives = 57/95 (60%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S IT  LRF G LN DL +   N+VP+PR+HF    FAP+ S     +   +V ++T   
Sbjct: 243 SSITASLRFEGPLNVDLIEFQTNLVPYPRIHFPMTAFAPIVSADKAYHEQFSVSDITTAC 302

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTS 286
           F++ N +V CDPR G+Y+    ++RG+ + K++ +
Sbjct: 303 FESSNQLVKCDPRLGKYMACCLLYRGDVVPKEVNA 337



 Score = 58.4 bits (135), Expect = 2e-08
 Identities = 31/93 (33%), Positives = 51/93 (54%), Gaps = 8/93 (8%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPR---GLKMAST-----FIG 408
           +G +  KEV+  +A  ++++S  FV+W P   K+ + + PP    G  +A        + 
Sbjct: 327 RGDVVPKEVNAAIAATKSRHSVQFVDWCPTGFKVGINNRPPTVMPGGDLAKVHRSICMLS 386

Query: 409 NTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
           NTTAI   + R+  +F  M+ ++AFLHWY  EG
Sbjct: 387 NTTAIVEAWARLDHKFDLMYAKRAFLHWYLREG 419


>AK025318-1|BAB15110.1|  446|Homo sapiens protein ( Homo sapiens
           cDNA: FLJ21665 fis, clone COL08913. ).
          Length = 446

 Score = 85.8 bits (203), Expect = 1e-16
 Identities = 36/95 (37%), Positives = 57/95 (60%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQM 181
           S IT  LRF G LN DL +   N+VP+PR+HF    FAP+ S     +   +V ++T   
Sbjct: 243 SSITASLRFEGPLNVDLIEFQTNLVPYPRIHFPMTAFAPIVSADKAYHEQFSVSDITTAC 302

Query: 182 FDAKNMMVACDPRHGRYLTVATIFRGECL*KKLTS 286
           F++ N +V CDPR G+Y+    ++RG+ + K++ +
Sbjct: 303 FESSNQLVKCDPRLGKYMACCLLYRGDVVPKEVNA 337



 Score = 58.4 bits (135), Expect = 2e-08
 Identities = 31/93 (33%), Positives = 51/93 (54%), Gaps = 8/93 (8%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPR---GLKMAST-----FIG 408
           +G +  KEV+  +A  ++++S  FV+W P   K+ + + PP    G  +A        + 
Sbjct: 327 RGDVVPKEVNAAIAATKSRHSVQFVDWCPTGFKVGINNRPPTVMPGGDLAKVHRSICMLS 386

Query: 409 NTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
           NTTAI   + R+  +F  M+ ++AFLHWY  EG
Sbjct: 387 NTTAIVEAWARLDHKFDLMYAKRAFLHWYLREG 419


>EF036509-1|ABO65095.1|   82|Homo sapiens beta-4 tubulin protein.
          Length = 82

 Score = 78.6 bits (185), Expect = 2e-14
 Identities = 34/40 (85%), Positives = 37/40 (92%)
 Frame = +1

Query: 388 MASTFIGNTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
           MA TFIGN+TAIQ +FKR+SEQF AMFRRKAFLHWYTGEG
Sbjct: 1   MAVTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEG 40



 Score = 54.4 bits (125), Expect = 4e-07
 Identities = 26/34 (76%), Positives = 28/34 (82%), Gaps = 3/34 (8%)
 Frame = +3

Query: 486 ALVHW*---G*DEMEFTEAESNMNDLISEYQQYQ 578
           A +HW    G DEMEFTEAESNMNDL+SEYQQYQ
Sbjct: 31  AFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ 64


>BC001805-1|AAH01805.1|  198|Homo sapiens Unknown (protein for
           IMAGE:3543670) protein.
          Length = 198

 Score = 70.9 bits (166), Expect = 4e-12
 Identities = 30/81 (37%), Positives = 48/81 (59%)
 Frame = +2

Query: 68  NMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQMFDAKNMMVACDPRHGRYLTVAT 247
           N+VP+PR+HF    +AP+ S     +  L+V E+T   F+  N MV CDPRHG+Y+    
Sbjct: 5   NLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCL 64

Query: 248 IFRGECL*KKLTSNWRIFRTK 310
           ++RG+ + K + +     +TK
Sbjct: 65  LYRGDVVPKDVNAAIATIKTK 85



 Score = 62.1 bits (144), Expect = 2e-09
 Identities = 31/93 (33%), Positives = 50/93 (53%), Gaps = 8/93 (8%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPPR--------GLKMASTFIG 408
           +G +  K+V+  +A I+ K S  FV+W P   K+ +   PP          ++ A   + 
Sbjct: 67  RGDVVPKDVNAAIATIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLS 126

Query: 409 NTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
           NTTAI   + R+  +F  M+ ++AF+HWY GEG
Sbjct: 127 NTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEG 159


>M61764-1|AAA52620.1|  451|Homo sapiens gamma-tubulin protein.
          Length = 451

 Score = 60.1 bits (139), Expect = 7e-09
 Identities = 33/91 (36%), Positives = 51/91 (56%), Gaps = 4/91 (4%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTS-RGAQQYRALTVPELTLQ 178
           S  TT LR+PG +N DL  L  +++P PRLHF   G+ PLT+ +     R  TV ++  +
Sbjct: 237 SASTTTLRYPGYMNNDLIGLIASLIPTPRLHFLMTGYTPLTTDQSVASVRKTTVLDVMRR 296

Query: 179 MFDAKNMMVAC--DPRHGR-YLTVATIFRGE 262
           +   KN+MV+   D +    Y+ +  I +GE
Sbjct: 297 LLQPKNVMVSTGRDRQTNHCYIAILNIIQGE 327



 Score = 44.0 bits (99), Expect = 5e-04
 Identities = 23/92 (25%), Positives = 46/92 (50%), Gaps = 3/92 (3%)
 Frame = +1

Query: 250 IQGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVC---DIPPRGLKMASTFIGNTTA 420
           IQG +   +V + L  I+ +    F+ W P + ++A+       P   +++   + N T+
Sbjct: 324 IQGEVDPTQVHKSLQRIRERKLANFIPWGPASIQVALSRKSPYLPSAHRVSGLMMANHTS 383

Query: 421 IQTIFKRVSEQFVAMFRRKAFLHWYTGEGRMK 516
           I ++F+R   Q+  + +R+AFL  +  E   K
Sbjct: 384 ISSLFERTCRQYDKLRKREAFLEQFRKEDMFK 415


>CR407642-1|CAG28570.1|  451|Homo sapiens TUBG1 protein.
          Length = 451

 Score = 60.1 bits (139), Expect = 7e-09
 Identities = 33/91 (36%), Positives = 51/91 (56%), Gaps = 4/91 (4%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTS-RGAQQYRALTVPELTLQ 178
           S  TT LR+PG +N DL  L  +++P PRLHF   G+ PLT+ +     R  TV ++  +
Sbjct: 237 SASTTTLRYPGYMNNDLIGLIASLIPTPRLHFLMTGYTPLTTDQSVASVRKTTVLDVMRR 296

Query: 179 MFDAKNMMVAC--DPRHGR-YLTVATIFRGE 262
           +   KN+MV+   D +    Y+ +  I +GE
Sbjct: 297 LLQPKNVMVSTGRDRQTNHCYIAILNIIQGE 327



 Score = 44.0 bits (99), Expect = 5e-04
 Identities = 23/92 (25%), Positives = 46/92 (50%), Gaps = 3/92 (3%)
 Frame = +1

Query: 250 IQGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVC---DIPPRGLKMASTFIGNTTA 420
           IQG +   +V + L  I+ +    F+ W P + ++A+       P   +++   + N T+
Sbjct: 324 IQGEVDPTQVHKSLQRIRERKLANFIPWGPASIQVALSRKSPYLPSAHRVSGLMMANHTS 383

Query: 421 IQTIFKRVSEQFVAMFRRKAFLHWYTGEGRMK 516
           I ++F+R   Q+  + +R+AFL  +  E   K
Sbjct: 384 ISSLFERTCRQYDKLRKREAFLEQFRKEDMFK 415


>BT019931-1|AAV38734.1|  451|Homo sapiens tubulin, gamma 1 protein.
          Length = 451

 Score = 60.1 bits (139), Expect = 7e-09
 Identities = 33/91 (36%), Positives = 51/91 (56%), Gaps = 4/91 (4%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTS-RGAQQYRALTVPELTLQ 178
           S  TT LR+PG +N DL  L  +++P PRLHF   G+ PLT+ +     R  TV ++  +
Sbjct: 237 SASTTTLRYPGYMNNDLIGLIASLIPTPRLHFLMTGYTPLTTDQSVASVRKTTVLDVMRR 296

Query: 179 MFDAKNMMVAC--DPRHGR-YLTVATIFRGE 262
           +   KN+MV+   D +    Y+ +  I +GE
Sbjct: 297 LLQPKNVMVSTGRDRQTNHCYIAILNIIQGE 327



 Score = 44.0 bits (99), Expect = 5e-04
 Identities = 23/92 (25%), Positives = 46/92 (50%), Gaps = 3/92 (3%)
 Frame = +1

Query: 250 IQGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVC---DIPPRGLKMASTFIGNTTA 420
           IQG +   +V + L  I+ +    F+ W P + ++A+       P   +++   + N T+
Sbjct: 324 IQGEVDPTQVHKSLQRIRERKLANFIPWGPASIQVALSRKSPYLPSAHRVSGLMMANHTS 383

Query: 421 IQTIFKRVSEQFVAMFRRKAFLHWYTGEGRMK 516
           I ++F+R   Q+  + +R+AFL  +  E   K
Sbjct: 384 ISSLFERTCRQYDKLRKREAFLEQFRKEDMFK 415


>BC141925-1|AAI41926.1|  253|Homo sapiens TUBB2A protein protein.
          Length = 253

 Score = 60.1 bits (139), Expect = 7e-09
 Identities = 26/27 (96%), Positives = 27/27 (100%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPF 82
           SG+TTCLRFPGQLNADLRKLAVNMVPF
Sbjct: 227 SGVTTCLRFPGQLNADLRKLAVNMVPF 253


>BC127872-1|AAI27873.2|  188|Homo sapiens TUBB2B protein protein.
          Length = 188

 Score = 60.1 bits (139), Expect = 7e-09
 Identities = 26/27 (96%), Positives = 27/27 (100%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPF 82
           SG+TTCLRFPGQLNADLRKLAVNMVPF
Sbjct: 162 SGVTTCLRFPGQLNADLRKLAVNMVPF 188


>BC108739-1|AAI08740.1|  451|Homo sapiens tubulin, gamma 2 protein.
          Length = 451

 Score = 60.1 bits (139), Expect = 7e-09
 Identities = 33/91 (36%), Positives = 51/91 (56%), Gaps = 4/91 (4%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTS-RGAQQYRALTVPELTLQ 178
           S  TT LR+PG +N DL  L  +++P PRLHF   G+ PLT+ +     R  TV ++  +
Sbjct: 237 SASTTTLRYPGYMNNDLIGLIASLIPTPRLHFLMTGYTPLTTDQSVASVRKTTVLDVMRR 296

Query: 179 MFDAKNMMVAC--DPRHGR-YLTVATIFRGE 262
           +   KN+MV+   D +    Y+ +  I +GE
Sbjct: 297 LLQPKNVMVSTGRDRQTNHCYIAILNIIQGE 327



 Score = 41.9 bits (94), Expect = 0.002
 Identities = 23/92 (25%), Positives = 45/92 (48%), Gaps = 3/92 (3%)
 Frame = +1

Query: 250 IQGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVC---DIPPRGLKMASTFIGNTTA 420
           IQG +   +V + L  I+ +    F+ W P + ++A+       P   +++   + N T+
Sbjct: 324 IQGEVDPTQVHKSLQRIRERKLANFIPWGPASIQVALSRKSPYLPSAHRVSGLMMANHTS 383

Query: 421 IQTIFKRVSEQFVAMFRRKAFLHWYTGEGRMK 516
           I ++F+   +QF  + +R AFL  +  E   K
Sbjct: 384 ISSLFESSCQQFDKLRKRDAFLEQFRKEDMFK 415


>BC051890-1|AAH51890.1|  451|Homo sapiens tubulin, gamma 2 protein.
          Length = 451

 Score = 60.1 bits (139), Expect = 7e-09
 Identities = 33/91 (36%), Positives = 51/91 (56%), Gaps = 4/91 (4%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTS-RGAQQYRALTVPELTLQ 178
           S  TT LR+PG +N DL  L  +++P PRLHF   G+ PLT+ +     R  TV ++  +
Sbjct: 237 SASTTTLRYPGYMNNDLIGLIASLIPTPRLHFLMTGYTPLTTDQSVASVRKTTVLDVMRR 296

Query: 179 MFDAKNMMVAC--DPRHGR-YLTVATIFRGE 262
           +   KN+MV+   D +    Y+ +  I +GE
Sbjct: 297 LLQPKNVMVSTGRDRQTNHCYIAILNIIQGE 327



 Score = 41.9 bits (94), Expect = 0.002
 Identities = 23/92 (25%), Positives = 45/92 (48%), Gaps = 3/92 (3%)
 Frame = +1

Query: 250 IQGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVC---DIPPRGLKMASTFIGNTTA 420
           IQG +   +V + L  I+ +    F+ W P + ++A+       P   +++   + N T+
Sbjct: 324 IQGEVDPTQVHKSLQRIRERKLANFIPWGPASIQVALSRKSPYLPSAHRVSGLMMANHTS 383

Query: 421 IQTIFKRVSEQFVAMFRRKAFLHWYTGEGRMK 516
           I ++F+   +QF  + +R AFL  +  E   K
Sbjct: 384 ISSLFESSCQQFDKLRKRDAFLEQFRKEDMFK 415


>BC009670-1|AAH09670.1|  451|Homo sapiens tubulin, gamma 2 protein.
          Length = 451

 Score = 60.1 bits (139), Expect = 7e-09
 Identities = 33/91 (36%), Positives = 51/91 (56%), Gaps = 4/91 (4%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTS-RGAQQYRALTVPELTLQ 178
           S  TT LR+PG +N DL  L  +++P PRLHF   G+ PLT+ +     R  TV ++  +
Sbjct: 237 SASTTTLRYPGYMNNDLIGLIASLIPTPRLHFLMTGYTPLTTDQSVASVRKTTVLDVMRR 296

Query: 179 MFDAKNMMVAC--DPRHGR-YLTVATIFRGE 262
           +   KN+MV+   D +    Y+ +  I +GE
Sbjct: 297 LLQPKNVMVSTGRDRQTNHCYIAILNIIQGE 327



 Score = 41.9 bits (94), Expect = 0.002
 Identities = 23/92 (25%), Positives = 45/92 (48%), Gaps = 3/92 (3%)
 Frame = +1

Query: 250 IQGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVC---DIPPRGLKMASTFIGNTTA 420
           IQG +   +V + L  I+ +    F+ W P + ++A+       P   +++   + N T+
Sbjct: 324 IQGEVDPTQVHKSLQRIRERKLANFIPWGPASIQVALSRKSPYLPSAHRVSGLMMANHTS 383

Query: 421 IQTIFKRVSEQFVAMFRRKAFLHWYTGEGRMK 516
           I ++F+   +QF  + +R AFL  +  E   K
Sbjct: 384 ISSLFESSCQQFDKLRKRDAFLEQFRKEDMFK 415


>BC000619-1|AAH00619.1|  451|Homo sapiens tubulin, gamma 1 protein.
          Length = 451

 Score = 60.1 bits (139), Expect = 7e-09
 Identities = 33/91 (36%), Positives = 51/91 (56%), Gaps = 4/91 (4%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTS-RGAQQYRALTVPELTLQ 178
           S  TT LR+PG +N DL  L  +++P PRLHF   G+ PLT+ +     R  TV ++  +
Sbjct: 237 SASTTTLRYPGYMNNDLIGLIASLIPTPRLHFLMTGYTPLTTDQSVASVRKTTVLDVMRR 296

Query: 179 MFDAKNMMVAC--DPRHGR-YLTVATIFRGE 262
           +   KN+MV+   D +    Y+ +  I +GE
Sbjct: 297 LLQPKNVMVSTGRDRQTNHCYIAILNIIQGE 327



 Score = 44.0 bits (99), Expect = 5e-04
 Identities = 23/92 (25%), Positives = 46/92 (50%), Gaps = 3/92 (3%)
 Frame = +1

Query: 250 IQGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVC---DIPPRGLKMASTFIGNTTA 420
           IQG +   +V + L  I+ +    F+ W P + ++A+       P   +++   + N T+
Sbjct: 324 IQGEVDPTQVHKSLQRIRERKLANFIPWGPASIQVALSRKSPYLPSAHRVSGLMMANHTS 383

Query: 421 IQTIFKRVSEQFVAMFRRKAFLHWYTGEGRMK 516
           I ++F+R   Q+  + +R+AFL  +  E   K
Sbjct: 384 ISSLFERTCRQYDKLRKREAFLEQFRKEDMFK 415


>AK022324-1|BAB14012.1|  451|Homo sapiens protein ( Homo sapiens
           cDNA FLJ12262 fis, clone MAMMA1001576, highly similar to
           Human gamma-tubulin mRNA. ).
          Length = 451

 Score = 60.1 bits (139), Expect = 7e-09
 Identities = 33/91 (36%), Positives = 51/91 (56%), Gaps = 4/91 (4%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTS-RGAQQYRALTVPELTLQ 178
           S  TT LR+PG +N DL  L  +++P PRLHF   G+ PLT+ +     R  TV ++  +
Sbjct: 237 SASTTTLRYPGYMNNDLIGLIASLIPTPRLHFLMTGYTPLTTDQSVASVRKTTVLDVMRR 296

Query: 179 MFDAKNMMVAC--DPRHGR-YLTVATIFRGE 262
           +   KN+MV+   D +    Y+ +  I +GE
Sbjct: 297 LLQPKNVMVSTGRDRQTNHCYIAILNIIQGE 327



 Score = 41.9 bits (94), Expect = 0.002
 Identities = 23/92 (25%), Positives = 45/92 (48%), Gaps = 3/92 (3%)
 Frame = +1

Query: 250 IQGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVC---DIPPRGLKMASTFIGNTTA 420
           IQG +   +V + L  I+ +    F+ W P + ++A+       P   +++   + N T+
Sbjct: 324 IQGEVDPTQVHKSLQRIRERKLANFIPWGPASIQVALSRKSPYLPSAHRVSGLMMANHTS 383

Query: 421 IQTIFKRVSEQFVAMFRRKAFLHWYTGEGRMK 516
           I ++F+   +QF  + +R AFL  +  E   K
Sbjct: 384 ISSLFESSCQQFDKLRKRDAFLEQFRKEDMFK 415


>AF225971-1|AAF34188.1|  451|Homo sapiens gamma-tubulin protein.
          Length = 451

 Score = 60.1 bits (139), Expect = 7e-09
 Identities = 33/91 (36%), Positives = 51/91 (56%), Gaps = 4/91 (4%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTS-RGAQQYRALTVPELTLQ 178
           S  TT LR+PG +N DL  L  +++P PRLHF   G+ PLT+ +     R  TV ++  +
Sbjct: 237 SASTTTLRYPGYMNNDLIGLIASLIPTPRLHFLMTGYTPLTTDQSVASVRKTTVLDVMRR 296

Query: 179 MFDAKNMMVAC--DPRHGR-YLTVATIFRGE 262
           +   KN+MV+   D +    Y+ +  I +GE
Sbjct: 297 LLQPKNVMVSTGRDRQTNHCYIAILNIIQGE 327



 Score = 41.9 bits (94), Expect = 0.002
 Identities = 23/92 (25%), Positives = 45/92 (48%), Gaps = 3/92 (3%)
 Frame = +1

Query: 250 IQGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVC---DIPPRGLKMASTFIGNTTA 420
           IQG +   +V + L  I+ +    F+ W P + ++A+       P   +++   + N T+
Sbjct: 324 IQGEVDPTQVHKSLQRIRERKLANFIPWGPASIQVALSRKSPYLPSAHRVSGLMMANHTS 383

Query: 421 IQTIFKRVSEQFVAMFRRKAFLHWYTGEGRMK 516
           I ++F+   +QF  + +R AFL  +  E   K
Sbjct: 384 ISSLFESSCQQFDKLRKRDAFLEQFRKEDMFK 415


>Z99289-4|CAI42327.1|  475|Homo sapiens tubulin, epsilon 1 protein.
          Length = 475

 Score = 59.7 bits (138), Expect = 1e-08
 Identities = 26/84 (30%), Positives = 44/84 (52%)
 Frame = +2

Query: 8   ITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQMFD 187
           +T+  RF G LN DL ++++N+VPFP+LH+      PL +          + ++    F 
Sbjct: 269 LTSSARFEGSLNMDLNEISMNLVPFPQLHYLVSSLTPLYTLTDVNIPPRRLDQMFSDAFS 328

Query: 188 AKNMMVACDPRHGRYLTVATIFRG 259
             + ++  DP+H  YL  A + RG
Sbjct: 329 KDHQLLRADPKHSLYLACALMVRG 352



 Score = 50.8 bits (116), Expect = 5e-06
 Identities = 22/75 (29%), Positives = 40/75 (53%), Gaps = 1/75 (1%)
 Frame = +1

Query: 274 EVDEQLANIQN-KNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTIFKRVSE 450
           ++ +   NI+  K S  FV W     K ++C +PP G   +   + N T ++  F  + E
Sbjct: 355 QISDLRRNIERLKPSLQFVSWNQEGWKTSLCSVPPVGHSHSLLALANNTCVKPTFMELKE 414

Query: 451 QFVAMFRRKAFLHWY 495
           +F+ ++++KA LH Y
Sbjct: 415 RFMRLYKKKAHLHHY 429


>BC031101-1|AAH31101.1|  475|Homo sapiens tubulin, epsilon 1
           protein.
          Length = 475

 Score = 59.7 bits (138), Expect = 1e-08
 Identities = 26/84 (30%), Positives = 44/84 (52%)
 Frame = +2

Query: 8   ITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQMFD 187
           +T+  RF G LN DL ++++N+VPFP+LH+      PL +          + ++    F 
Sbjct: 269 LTSSARFEGSLNMDLNEISMNLVPFPQLHYLVSSLTPLYTLTDVNIPPRRLDQMFSDAFS 328

Query: 188 AKNMMVACDPRHGRYLTVATIFRG 259
             + ++  DP+H  YL  A + RG
Sbjct: 329 KDHQLLRADPKHSLYLACALMVRG 352



 Score = 50.8 bits (116), Expect = 5e-06
 Identities = 22/75 (29%), Positives = 40/75 (53%), Gaps = 1/75 (1%)
 Frame = +1

Query: 274 EVDEQLANIQN-KNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTIFKRVSE 450
           ++ +   NI+  K S  FV W     K ++C +PP G   +   + N T ++  F  + E
Sbjct: 355 QISDLRRNIERLKPSLQFVSWNQEGWKTSLCSVPPVGHSHSLLALANNTCVKPTFMELKE 414

Query: 451 QFVAMFRRKAFLHWY 495
           +F+ ++++KA LH Y
Sbjct: 415 RFMRLYKKKAHLHHY 429


>BC025405-1|AAH25405.1|  475|Homo sapiens tubulin, epsilon 1
           protein.
          Length = 475

 Score = 59.7 bits (138), Expect = 1e-08
 Identities = 26/84 (30%), Positives = 44/84 (52%)
 Frame = +2

Query: 8   ITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQMFD 187
           +T+  RF G LN DL ++++N+VPFP+LH+      PL +          + ++    F 
Sbjct: 269 LTSSARFEGSLNMDLNEISMNLVPFPQLHYLVSSLTPLYTLTDVNIPPRRLDQMFSDAFS 328

Query: 188 AKNMMVACDPRHGRYLTVATIFRG 259
             + ++  DP+H  YL  A + RG
Sbjct: 329 KDHQLLRADPKHSLYLACALMVRG 352



 Score = 50.8 bits (116), Expect = 5e-06
 Identities = 22/75 (29%), Positives = 40/75 (53%), Gaps = 1/75 (1%)
 Frame = +1

Query: 274 EVDEQLANIQN-KNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTIFKRVSE 450
           ++ +   NI+  K S  FV W     K ++C +PP G   +   + N T ++  F  + E
Sbjct: 355 QISDLRRNIERLKPSLQFVSWNQEGWKTSLCSVPPVGHSHSLLALANNTCVKPTFMELKE 414

Query: 451 QFVAMFRRKAFLHWY 495
           +F+ ++++KA LH Y
Sbjct: 415 RFMRLYKKKAHLHHY 429


>AF201334-1|AAF09585.1|  475|Homo sapiens epsilon-tubulin protein.
          Length = 475

 Score = 59.7 bits (138), Expect = 1e-08
 Identities = 26/84 (30%), Positives = 44/84 (52%)
 Frame = +2

Query: 8   ITTCLRFPGQLNADLRKLAVNMVPFPRLHFYTPGFAPLTSRGAQQYRALTVPELTLQMFD 187
           +T+  RF G LN DL ++++N+VPFP+LH+      PL +          + ++    F 
Sbjct: 269 LTSSARFEGSLNMDLNEISMNLVPFPQLHYLVSSLTPLYTLTDVNIPPRRLDQMFSDAFS 328

Query: 188 AKNMMVACDPRHGRYLTVATIFRG 259
             + ++  DP+H  YL  A + RG
Sbjct: 329 KDHQLLRADPKHSLYLACALMVRG 352



 Score = 50.8 bits (116), Expect = 5e-06
 Identities = 22/75 (29%), Positives = 40/75 (53%), Gaps = 1/75 (1%)
 Frame = +1

Query: 274 EVDEQLANIQN-KNSTYFVEWIPNNCKIAVCDIPPRGLKMASTFIGNTTAIQTIFKRVSE 450
           ++ +   NI+  K S  FV W     K ++C +PP G   +   + N T ++  F  + E
Sbjct: 355 QISDLRRNIERLKPSLQFVSWNQEGWKTSLCSVPPVGHSHSLLALANNTCVKPTFMELKE 414

Query: 451 QFVAMFRRKAFLHWY 495
           +F+ ++++KA LH Y
Sbjct: 415 RFMRLYKKKAHLHHY 429


>BC033064-1|AAH33064.1|  325|Homo sapiens TUBA1C protein protein.
          Length = 325

 Score = 58.4 bits (135), Expect = 2e-08
 Identities = 26/74 (35%), Positives = 41/74 (55%)
 Frame = +2

Query: 89  LHFYTPGFAPLTSRGAQQYRALTVPELTLQMFDAKNMMVACDPRHGRYLTVATIFRGECL 268
           +HF    +AP+ S     +  LTV E+T   F+  N MV CDPRHG+Y+    ++RG+ +
Sbjct: 135 VHFPLATYAPVISAEKAYHEQLTVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVV 194

Query: 269 *KKLTSNWRIFRTK 310
            K + +     +TK
Sbjct: 195 PKDVNAAIATIKTK 208



 Score = 37.5 bits (83), Expect = 0.046
 Identities = 22/82 (26%), Positives = 39/82 (47%), Gaps = 8/82 (9%)
 Frame = +1

Query: 253 QGRMSMKEVDEQLANIQNKNSTYFVEWIPNNCKIAVCDIPP--------RGLKMASTFIG 408
           +G +  K+V+  +A I+ K +  FV+W P   K+ +   PP          ++ A   + 
Sbjct: 190 RGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLS 249

Query: 409 NTTAIQTIFKRVSEQFVAMFRR 474
           NTTA+   + R+  +F    RR
Sbjct: 250 NTTAVAEAWARLDHKFDLPLRR 271


>BC141924-1|AAI41925.1|  253|Homo sapiens TUBB2A protein protein.
          Length = 253

 Score = 58.0 bits (134), Expect = 3e-08
 Identities = 25/27 (92%), Positives = 26/27 (96%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPF 82
           SG+TTCLRFPGQLNADLRKL VNMVPF
Sbjct: 227 SGVTTCLRFPGQLNADLRKLPVNMVPF 253


>BC127874-1|AAI27875.1|  151|Homo sapiens Unknown (protein for
           IMAGE:40134249) protein.
          Length = 151

 Score = 56.8 bits (131), Expect = 7e-08
 Identities = 25/27 (92%), Positives = 26/27 (96%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPF 82
           SG+TTCLRFPGQLNADLRKLAVNMV F
Sbjct: 120 SGVTTCLRFPGQLNADLRKLAVNMVAF 146


>K03460-1|AAA36785.1|   98|Homo sapiens protein ( Human
           alpha-tubulin isotype H2-alpha gene, last exon. ).
          Length = 98

 Score = 44.4 bits (100), Expect = 4e-04
 Identities = 19/48 (39%), Positives = 30/48 (62%)
 Frame = +1

Query: 364 DIPPRGLKMASTFIGNTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
           D+ P  ++ A   + NTTAI   + R+  +F  M+ ++AF+HWY GEG
Sbjct: 15  DLAP--VQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEG 60


>L11645-1|AAA35521.1|   98|Homo sapiens alpha-tubulin protein.
          Length = 98

 Score = 44.0 bits (99), Expect = 5e-04
 Identities = 17/42 (40%), Positives = 27/42 (64%)
 Frame = +1

Query: 382 LKMASTFIGNTTAIQTIFKRVSEQFVAMFRRKAFLHWYTGEG 507
           ++ A   + NTTAI   + R+  +F  M+ ++AF+HWY GEG
Sbjct: 19  VQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEG 60


>AJ400879-3|CAC35389.1| 1214|Homo sapiens KIAA0298 protein protein.
          Length = 1214

 Score = 30.3 bits (65), Expect = 6.9
 Identities = 11/48 (22%), Positives = 27/48 (56%), Gaps = 2/48 (4%)
 Frame = -3

Query: 498  SVPVQEGFPP--KHSHELLRHPLEYGLYGRRVTNEGRSHFKTPRRYVT 361
            S+P  E   P  +H +++++ P++  +  R++  +  +H+ TP   V+
Sbjct: 1061 SLPFHEPVSPLARHYYQIIKRPMDLSIIRRKLQKKDPAHYTTPEEVVS 1108


>AK024002-1|BAB14767.1|  241|Homo sapiens protein ( Homo sapiens
           cDNA FLJ13940 fis, clone Y79AA1000833, moderately
           similar to TUBULIN ALPHA-1 CHAIN. ).
          Length = 241

 Score = 29.9 bits (64), Expect = 9.1
 Identities = 13/27 (48%), Positives = 16/27 (59%)
 Frame = +2

Query: 2   SGITTCLRFPGQLNADLRKLAVNMVPF 82
           S IT  LRF G LN DL +   N+V +
Sbjct: 175 SSITASLRFDGALNVDLTEFQTNLVSY 201


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 96,184,724
Number of Sequences: 237096
Number of extensions: 2044113
Number of successful extensions: 4875
Number of sequences better than 10.0: 169
Number of HSP's better than 10.0 without gapping: 4343
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4808
length of database: 76,859,062
effective HSP length: 88
effective length of database: 55,994,614
effective search space used: 8063224416
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).