SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0029
         (499 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BC024254-1|AAH24254.1|  476|Homo sapiens abl-interactor 1 protein.     31   2.2  
AL390961-6|CAI17278.1|  452|Homo sapiens spectrin SH3 domain bin...    31   2.2  
AL390961-5|CAI17276.1|  481|Homo sapiens spectrin SH3 domain bin...    31   2.2  
AL390961-4|CAI17274.1|  476|Homo sapiens spectrin SH3 domain bin...    31   2.2  
AL139404-6|CAH73116.1|  452|Homo sapiens spectrin SH3 domain bin...    31   2.2  
AL139404-5|CAH73113.1|  481|Homo sapiens spectrin SH3 domain bin...    31   2.2  
AL139404-4|CAH73115.1|  476|Homo sapiens spectrin SH3 domain bin...    31   2.2  
AF540955-1|AAN28379.1|  476|Homo sapiens Abl-interactor 1 protein.     31   2.2  
AB040151-1|BAB55675.1|  452|Homo sapiens hNap1 Binding Protein p...    31   2.2  
AF414442-1|AAL65133.2|22152|Homo sapiens ovarian cancer related ...    31   2.9  
AY867077-1|AAW68950.1|  107|Homo sapiens anti-tetanus toxoid imm...    29   6.8  
AY866996-1|AAW68872.1|  107|Homo sapiens anti-tetanus toxoid imm...    29   6.8  
AY640561-1|AAT65161.1|  118|Homo sapiens immunoglobulin E variab...    29   6.8  
U43573-1|AAC50513.1|  743|Homo sapiens alpha-N-acetylglucosamini...    29   9.0  
U43572-1|AAC50512.1|  743|Homo sapiens alpha-N-acetylglucosamini...    29   9.0  
U40846-1|AAB06188.1|  743|Homo sapiens alpha-N-acetylglucosamini...    29   9.0  
L78465-1|AAB36605.1|  639|Homo sapiens alpha-N-acetylglucosamini...    29   9.0  
L78464-1|AAB36604.1|  743|Homo sapiens alpha-N-acetylglucosamini...    29   9.0  
BC053991-1|AAH53991.1|  743|Homo sapiens N-acetylglucosaminidase...    29   9.0  
BC033092-1|AAH33092.1|  508|Homo sapiens SIRPA protein protein.        29   9.0  
BC026692-1|AAH26692.1|  507|Homo sapiens SIRPA protein protein.        29   9.0  
AY640557-1|AAT65157.1|  118|Homo sapiens immunoglobulin E variab...    29   9.0  
AY640506-1|AAT65111.1|  118|Homo sapiens immunoglobulin E variab...    29   9.0  
AL117335-2|CAM28335.1|  508|Homo sapiens signal-regulatory prote...    29   9.0  
AL034562-2|CAM28287.1|  508|Homo sapiens signal-regulatory prote...    29   9.0  

>BC024254-1|AAH24254.1|  476|Homo sapiens abl-interactor 1 protein.
          Length = 476

 Score = 31.1 bits (67), Expect = 2.2
 Identities = 33/121 (27%), Positives = 53/121 (43%)
 Frame = -2

Query: 459 RKTPFEQRVTILSGQSPTFPNIRTTTANSLQSS*RPRCHVRGAKLNARSTSILVRGASLG 280
           R TP++   T+   + PT PN   T+   L S   P    R A LN R  +    G+S G
Sbjct: 189 RNTPYK---TLEPVKPPTVPNDYMTSPARLGSQHSPG---RTASLNQRPRTH--SGSSGG 240

Query: 279 NGDSVTSNAIAVLIWVWRLTDHLTTASNGSDSSSRGTEYSTTCRTARRAYSKARMACDTG 100
           +G    S + ++ I +   T    T    +  S+ G++Y T  R   R ++    +  +G
Sbjct: 241 SGSRENSGSSSIGIPIAVPTPSPPTIGPAAPGSAPGSQYGTMTRQISR-HNSTTSSTSSG 299

Query: 99  G 97
           G
Sbjct: 300 G 300


>AL390961-6|CAI17278.1|  452|Homo sapiens spectrin SH3 domain
           binding protein 1 protein.
          Length = 452

 Score = 31.1 bits (67), Expect = 2.2
 Identities = 33/121 (27%), Positives = 53/121 (43%)
 Frame = -2

Query: 459 RKTPFEQRVTILSGQSPTFPNIRTTTANSLQSS*RPRCHVRGAKLNARSTSILVRGASLG 280
           R TP++   T+   + PT PN   T+   L S   P    R A LN R  +    G+S G
Sbjct: 194 RNTPYK---TLEPVKPPTVPNDYMTSPARLGSQHSPG---RTASLNQRPRTH--SGSSGG 245

Query: 279 NGDSVTSNAIAVLIWVWRLTDHLTTASNGSDSSSRGTEYSTTCRTARRAYSKARMACDTG 100
           +G    S + ++ I +   T    T    +  S+ G++Y T  R   R ++    +  +G
Sbjct: 246 SGSRENSGSSSIGIPIAVPTPSPPTIGPAAPGSAPGSQYGTMTRQISR-HNSTTSSTSSG 304

Query: 99  G 97
           G
Sbjct: 305 G 305


>AL390961-5|CAI17276.1|  481|Homo sapiens spectrin SH3 domain
           binding protein 1 protein.
          Length = 481

 Score = 31.1 bits (67), Expect = 2.2
 Identities = 33/121 (27%), Positives = 53/121 (43%)
 Frame = -2

Query: 459 RKTPFEQRVTILSGQSPTFPNIRTTTANSLQSS*RPRCHVRGAKLNARSTSILVRGASLG 280
           R TP++   T+   + PT PN   T+   L S   P    R A LN R  +    G+S G
Sbjct: 194 RNTPYK---TLEPVKPPTVPNDYMTSPARLGSQHSPG---RTASLNQRPRTH--SGSSGG 245

Query: 279 NGDSVTSNAIAVLIWVWRLTDHLTTASNGSDSSSRGTEYSTTCRTARRAYSKARMACDTG 100
           +G    S + ++ I +   T    T    +  S+ G++Y T  R   R ++    +  +G
Sbjct: 246 SGSRENSGSSSIGIPIAVPTPSPPTIGPAAPGSAPGSQYGTMTRQISR-HNSTTSSTSSG 304

Query: 99  G 97
           G
Sbjct: 305 G 305


>AL390961-4|CAI17274.1|  476|Homo sapiens spectrin SH3 domain
           binding protein 1 protein.
          Length = 476

 Score = 31.1 bits (67), Expect = 2.2
 Identities = 33/121 (27%), Positives = 53/121 (43%)
 Frame = -2

Query: 459 RKTPFEQRVTILSGQSPTFPNIRTTTANSLQSS*RPRCHVRGAKLNARSTSILVRGASLG 280
           R TP++   T+   + PT PN   T+   L S   P    R A LN R  +    G+S G
Sbjct: 189 RNTPYK---TLEPVKPPTVPNDYMTSPARLGSQHSPG---RTASLNQRPRTH--SGSSGG 240

Query: 279 NGDSVTSNAIAVLIWVWRLTDHLTTASNGSDSSSRGTEYSTTCRTARRAYSKARMACDTG 100
           +G    S + ++ I +   T    T    +  S+ G++Y T  R   R ++    +  +G
Sbjct: 241 SGSRENSGSSSIGIPIAVPTPSPPTIGPAAPGSAPGSQYGTMTRQISR-HNSTTSSTSSG 299

Query: 99  G 97
           G
Sbjct: 300 G 300


>AL139404-6|CAH73116.1|  452|Homo sapiens spectrin SH3 domain
           binding protein 1 protein.
          Length = 452

 Score = 31.1 bits (67), Expect = 2.2
 Identities = 33/121 (27%), Positives = 53/121 (43%)
 Frame = -2

Query: 459 RKTPFEQRVTILSGQSPTFPNIRTTTANSLQSS*RPRCHVRGAKLNARSTSILVRGASLG 280
           R TP++   T+   + PT PN   T+   L S   P    R A LN R  +    G+S G
Sbjct: 194 RNTPYK---TLEPVKPPTVPNDYMTSPARLGSQHSPG---RTASLNQRPRTH--SGSSGG 245

Query: 279 NGDSVTSNAIAVLIWVWRLTDHLTTASNGSDSSSRGTEYSTTCRTARRAYSKARMACDTG 100
           +G    S + ++ I +   T    T    +  S+ G++Y T  R   R ++    +  +G
Sbjct: 246 SGSRENSGSSSIGIPIAVPTPSPPTIGPAAPGSAPGSQYGTMTRQISR-HNSTTSSTSSG 304

Query: 99  G 97
           G
Sbjct: 305 G 305


>AL139404-5|CAH73113.1|  481|Homo sapiens spectrin SH3 domain
           binding protein 1 protein.
          Length = 481

 Score = 31.1 bits (67), Expect = 2.2
 Identities = 33/121 (27%), Positives = 53/121 (43%)
 Frame = -2

Query: 459 RKTPFEQRVTILSGQSPTFPNIRTTTANSLQSS*RPRCHVRGAKLNARSTSILVRGASLG 280
           R TP++   T+   + PT PN   T+   L S   P    R A LN R  +    G+S G
Sbjct: 194 RNTPYK---TLEPVKPPTVPNDYMTSPARLGSQHSPG---RTASLNQRPRTH--SGSSGG 245

Query: 279 NGDSVTSNAIAVLIWVWRLTDHLTTASNGSDSSSRGTEYSTTCRTARRAYSKARMACDTG 100
           +G    S + ++ I +   T    T    +  S+ G++Y T  R   R ++    +  +G
Sbjct: 246 SGSRENSGSSSIGIPIAVPTPSPPTIGPAAPGSAPGSQYGTMTRQISR-HNSTTSSTSSG 304

Query: 99  G 97
           G
Sbjct: 305 G 305


>AL139404-4|CAH73115.1|  476|Homo sapiens spectrin SH3 domain
           binding protein 1 protein.
          Length = 476

 Score = 31.1 bits (67), Expect = 2.2
 Identities = 33/121 (27%), Positives = 53/121 (43%)
 Frame = -2

Query: 459 RKTPFEQRVTILSGQSPTFPNIRTTTANSLQSS*RPRCHVRGAKLNARSTSILVRGASLG 280
           R TP++   T+   + PT PN   T+   L S   P    R A LN R  +    G+S G
Sbjct: 189 RNTPYK---TLEPVKPPTVPNDYMTSPARLGSQHSPG---RTASLNQRPRTH--SGSSGG 240

Query: 279 NGDSVTSNAIAVLIWVWRLTDHLTTASNGSDSSSRGTEYSTTCRTARRAYSKARMACDTG 100
           +G    S + ++ I +   T    T    +  S+ G++Y T  R   R ++    +  +G
Sbjct: 241 SGSRENSGSSSIGIPIAVPTPSPPTIGPAAPGSAPGSQYGTMTRQISR-HNSTTSSTSSG 299

Query: 99  G 97
           G
Sbjct: 300 G 300


>AF540955-1|AAN28379.1|  476|Homo sapiens Abl-interactor 1 protein.
          Length = 476

 Score = 31.1 bits (67), Expect = 2.2
 Identities = 33/121 (27%), Positives = 53/121 (43%)
 Frame = -2

Query: 459 RKTPFEQRVTILSGQSPTFPNIRTTTANSLQSS*RPRCHVRGAKLNARSTSILVRGASLG 280
           R TP++   T+   + PT PN   T+   L S   P    R A LN R  +    G+S G
Sbjct: 189 RNTPYK---TLEPVKPPTVPNDYMTSPARLGSQHSPG---RTASLNQRPRTH--SGSSGG 240

Query: 279 NGDSVTSNAIAVLIWVWRLTDHLTTASNGSDSSSRGTEYSTTCRTARRAYSKARMACDTG 100
           +G    S + ++ I +   T    T    +  S+ G++Y T  R   R ++    +  +G
Sbjct: 241 SGSRENSGSSSIGIPIAVPTPSPPTIGPAAPGSAPGSQYGTMTRQISR-HNSTTSSTSSG 299

Query: 99  G 97
           G
Sbjct: 300 G 300


>AB040151-1|BAB55675.1|  452|Homo sapiens hNap1 Binding Protein
           protein.
          Length = 452

 Score = 31.1 bits (67), Expect = 2.2
 Identities = 33/121 (27%), Positives = 53/121 (43%)
 Frame = -2

Query: 459 RKTPFEQRVTILSGQSPTFPNIRTTTANSLQSS*RPRCHVRGAKLNARSTSILVRGASLG 280
           R TP++   T+   + PT PN   T+   L S   P    R A LN R  +    G+S G
Sbjct: 194 RNTPYK---TLEPVKPPTVPNDYMTSPARLGSQHSPG---RTASLNQRPRTH--SGSSGG 245

Query: 279 NGDSVTSNAIAVLIWVWRLTDHLTTASNGSDSSSRGTEYSTTCRTARRAYSKARMACDTG 100
           +G    S + ++ I +   T    T    +  S+ G++Y T  R   R ++    +  +G
Sbjct: 246 SGSRENSGSSSIGIPIAVPTPSPPTIGPAAPGSAPGSQYGTMTRQISR-HNSTTSSTSSG 304

Query: 99  G 97
           G
Sbjct: 305 G 305


>AF414442-1|AAL65133.2|22152|Homo sapiens ovarian cancer related tumor
            marker CA125 protein.
          Length = 22152

 Score = 30.7 bits (66), Expect = 2.9
 Identities = 19/46 (41%), Positives = 23/46 (50%)
 Frame = -2

Query: 315  STSILVRGASLGNGDSVTSNAIAVLIWVWRLTDHLTTASNGSDSSS 178
            STS     ASL + DS  S   A+  W+W LT  L T +  S S S
Sbjct: 2025 STSSPYSSASLESLDSTISRRNAITSWLWDLTTSLPTTTWPSTSLS 2070


>AY867077-1|AAW68950.1|  107|Homo sapiens anti-tetanus toxoid
           immunoglobulin light chain variable region protein.
          Length = 107

 Score = 29.5 bits (63), Expect = 6.8
 Identities = 21/59 (35%), Positives = 29/59 (49%)
 Frame = -2

Query: 207 TASNGSDSSSRGTEYSTTCRTARRAYSKARMACDTGGKASWLLKAWLF*VLKTGVKFRY 31
           T S  S S+S G   +TTCRT++  +          GKA  LL  +    L+TGV  R+
Sbjct: 5   TQSPSSLSASVGDRVTTTCRTSQSIFINLNWFQQKPGKAPKLL-IYSASTLQTGVPSRF 62


>AY866996-1|AAW68872.1|  107|Homo sapiens anti-tetanus toxoid
           immunoglobulin light chain variable region protein.
          Length = 107

 Score = 29.5 bits (63), Expect = 6.8
 Identities = 21/59 (35%), Positives = 29/59 (49%)
 Frame = -2

Query: 207 TASNGSDSSSRGTEYSTTCRTARRAYSKARMACDTGGKASWLLKAWLF*VLKTGVKFRY 31
           T S  S S+S G   +TTCRT++  +          GKA  LL  +    L+TGV  R+
Sbjct: 5   TQSPSSLSASVGDRVTTTCRTSQSIFINLNWFQQKPGKAPKLL-IYSASTLQTGVPSRF 62


>AY640561-1|AAT65161.1|  118|Homo sapiens immunoglobulin E variable
           region protein.
          Length = 118

 Score = 29.5 bits (63), Expect = 6.8
 Identities = 13/30 (43%), Positives = 16/30 (53%)
 Frame = +3

Query: 330 SLRVRGTAVFKSSGGCSLSWFGCWEMSATG 419
           SLRV  TAVF  + G  ++WF  W     G
Sbjct: 85  SLRVEDTAVFYCAKGSGVNWFDPWGQGNPG 114


>U43573-1|AAC50513.1|  743|Homo sapiens
           alpha-N-acetylglucosaminidase protein.
          Length = 743

 Score = 29.1 bits (62), Expect = 9.0
 Identities = 18/53 (33%), Positives = 25/53 (47%)
 Frame = -2

Query: 222 TDHLTTASNGSDSSSRGTEYSTTCRTARRAYSKARMACDTGGKASWLLKAWLF 64
           TDH+  A   ++     +E S         Y +A  A DT  +A WLL+ WLF
Sbjct: 305 TDHIYGADTFNEMQPPSSEPSYLAAATTAVY-EAMTAVDT--EAVWLLQGWLF 354


>U43572-1|AAC50512.1|  743|Homo sapiens
           alpha-N-acetylglucosaminidase protein.
          Length = 743

 Score = 29.1 bits (62), Expect = 9.0
 Identities = 18/53 (33%), Positives = 25/53 (47%)
 Frame = -2

Query: 222 TDHLTTASNGSDSSSRGTEYSTTCRTARRAYSKARMACDTGGKASWLLKAWLF 64
           TDH+  A   ++     +E S         Y +A  A DT  +A WLL+ WLF
Sbjct: 305 TDHIYGADTFNEMQPPSSEPSYLAAATTAVY-EAMTAVDT--EAVWLLQGWLF 354


>U40846-1|AAB06188.1|  743|Homo sapiens
           alpha-N-acetylglucosaminidase protein.
          Length = 743

 Score = 29.1 bits (62), Expect = 9.0
 Identities = 18/53 (33%), Positives = 25/53 (47%)
 Frame = -2

Query: 222 TDHLTTASNGSDSSSRGTEYSTTCRTARRAYSKARMACDTGGKASWLLKAWLF 64
           TDH+  A   ++     +E S         Y +A  A DT  +A WLL+ WLF
Sbjct: 305 TDHIYGADTFNEMQPPSSEPSYLAAATTAVY-EAMTAVDT--EAVWLLQGWLF 354


>L78465-1|AAB36605.1|  639|Homo sapiens
           alpha-N-acetylglucosaminidase protein.
          Length = 639

 Score = 29.1 bits (62), Expect = 9.0
 Identities = 18/53 (33%), Positives = 25/53 (47%)
 Frame = -2

Query: 222 TDHLTTASNGSDSSSRGTEYSTTCRTARRAYSKARMACDTGGKASWLLKAWLF 64
           TDH+  A   ++     +E S         Y +A  A DT  +A WLL+ WLF
Sbjct: 201 TDHIYGADTFNEMQPPSSEPSYLAAATTAVY-EAMTAVDT--EAVWLLQGWLF 250


>L78464-1|AAB36604.1|  743|Homo sapiens
           alpha-N-acetylglucosaminidase protein.
          Length = 743

 Score = 29.1 bits (62), Expect = 9.0
 Identities = 18/53 (33%), Positives = 25/53 (47%)
 Frame = -2

Query: 222 TDHLTTASNGSDSSSRGTEYSTTCRTARRAYSKARMACDTGGKASWLLKAWLF 64
           TDH+  A   ++     +E S         Y +A  A DT  +A WLL+ WLF
Sbjct: 305 TDHIYGADTFNEMQPPSSEPSYLAAATTAVY-EAMTAVDT--EAVWLLQGWLF 354


>BC053991-1|AAH53991.1|  743|Homo sapiens N-acetylglucosaminidase,
           alpha- (Sanfilippo disease IIIB) protein.
          Length = 743

 Score = 29.1 bits (62), Expect = 9.0
 Identities = 18/53 (33%), Positives = 25/53 (47%)
 Frame = -2

Query: 222 TDHLTTASNGSDSSSRGTEYSTTCRTARRAYSKARMACDTGGKASWLLKAWLF 64
           TDH+  A   ++     +E S         Y +A  A DT  +A WLL+ WLF
Sbjct: 305 TDHIYGADTFNEMQPPSSEPSYLAAATTAVY-EAMTAVDT--EAVWLLQGWLF 354


>BC033092-1|AAH33092.1|  508|Homo sapiens SIRPA protein protein.
          Length = 508

 Score = 29.1 bits (62), Expect = 9.0
 Identities = 17/60 (28%), Positives = 31/60 (51%), Gaps = 1/60 (1%)
 Frame = -3

Query: 422 AASRRHFPTSEPRQRTASRALEDRGATYAERSSTRALRPY-SSEERRSGTETA*LQTPSQ 246
           +++R H P    R+ T  ++L+    TYA+ +  +  +P   + E  + TE A +QT  Q
Sbjct: 406 SSTRLHEPEKNAREITQVQSLDTNDITYADLNLPKGKKPAPQAAEPNNHTEYASIQTSPQ 465


>BC026692-1|AAH26692.1|  507|Homo sapiens SIRPA protein protein.
          Length = 507

 Score = 29.1 bits (62), Expect = 9.0
 Identities = 17/60 (28%), Positives = 31/60 (51%), Gaps = 1/60 (1%)
 Frame = -3

Query: 422 AASRRHFPTSEPRQRTASRALEDRGATYAERSSTRALRPY-SSEERRSGTETA*LQTPSQ 246
           +++R H P    R+ T  ++L+    TYA+ +  +  +P   + E  + TE A +QT  Q
Sbjct: 405 SSTRLHEPEKNAREITQVQSLDTNDITYADLNLPKGKKPAPQAAEPNNHTEYASIQTSPQ 464


>AY640557-1|AAT65157.1|  118|Homo sapiens immunoglobulin E variable
           region protein.
          Length = 118

 Score = 29.1 bits (62), Expect = 9.0
 Identities = 12/24 (50%), Positives = 15/24 (62%)
 Frame = +3

Query: 330 SLRVRGTAVFKSSGGCSLSWFGCW 401
           SLRV  TAVF  + G  ++WF  W
Sbjct: 85  SLRVEDTAVFYCAKGSGVNWFDPW 108


>AY640506-1|AAT65111.1|  118|Homo sapiens immunoglobulin E variable
           region protein.
          Length = 118

 Score = 29.1 bits (62), Expect = 9.0
 Identities = 12/24 (50%), Positives = 15/24 (62%)
 Frame = +3

Query: 330 SLRVRGTAVFKSSGGCSLSWFGCW 401
           SLRV  TAVF  + G  ++WF  W
Sbjct: 85  SLRVEDTAVFYCARGSGVNWFDPW 108


>AL117335-2|CAM28335.1|  508|Homo sapiens signal-regulatory protein
           alpha protein.
          Length = 508

 Score = 29.1 bits (62), Expect = 9.0
 Identities = 17/60 (28%), Positives = 31/60 (51%), Gaps = 1/60 (1%)
 Frame = -3

Query: 422 AASRRHFPTSEPRQRTASRALEDRGATYAERSSTRALRPY-SSEERRSGTETA*LQTPSQ 246
           +++R H P    R+ T  ++L+    TYA+ +  +  +P   + E  + TE A +QT  Q
Sbjct: 406 SSTRLHEPEKNAREITQVQSLDTNDITYADLNLPKGKKPAPQAAEPNNHTEYASIQTSPQ 465


>AL034562-2|CAM28287.1|  508|Homo sapiens signal-regulatory protein
           alpha protein.
          Length = 508

 Score = 29.1 bits (62), Expect = 9.0
 Identities = 17/60 (28%), Positives = 31/60 (51%), Gaps = 1/60 (1%)
 Frame = -3

Query: 422 AASRRHFPTSEPRQRTASRALEDRGATYAERSSTRALRPY-SSEERRSGTETA*LQTPSQ 246
           +++R H P    R+ T  ++L+    TYA+ +  +  +P   + E  + TE A +QT  Q
Sbjct: 406 SSTRLHEPEKNAREITQVQSLDTNDITYADLNLPKGKKPAPQAAEPNNHTEYASIQTSPQ 465


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 68,037,617
Number of Sequences: 237096
Number of extensions: 1258252
Number of successful extensions: 5439
Number of sequences better than 10.0: 25
Number of HSP's better than 10.0 without gapping: 5271
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5426
length of database: 76,859,062
effective HSP length: 85
effective length of database: 56,705,902
effective search space used: 4536472160
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).