SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0028
         (598 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BC130630-1|AAI30631.1|  830|Homo sapiens PHC2 protein protein.         31   4.1  
AL513327-5|CAI13957.1|  858|Homo sapiens polyhomeotic homolog 2 ...    31   4.1  
AL513327-4|CAI13956.1|  464|Homo sapiens polyhomeotic homolog 2 ...    31   4.1  
AK024260-1|BAB14863.1|  126|Homo sapiens protein ( Homo sapiens ...    31   4.1  
AJ419231-1|CAD11673.1|  858|Homo sapiens polyhomeotic 2 protein.       31   4.1  

>BC130630-1|AAI30631.1|  830|Homo sapiens PHC2 protein protein.
          Length = 830

 Score = 30.7 bits (66), Expect = 4.1
 Identities = 12/31 (38%), Positives = 16/31 (51%)
 Frame = -3

Query: 161 EPGSTPRCPSGTPSMSPQKGSPASQPYTLXR 69
           +PG + +C   TP   PQ G P   P+T  R
Sbjct: 387 KPGGSQQCHPPTPDTGPQNGHPEGVPHTPQR 417


>AL513327-5|CAI13957.1|  858|Homo sapiens polyhomeotic homolog 2
           (Drosophila) protein.
          Length = 858

 Score = 30.7 bits (66), Expect = 4.1
 Identities = 12/31 (38%), Positives = 16/31 (51%)
 Frame = -3

Query: 161 EPGSTPRCPSGTPSMSPQKGSPASQPYTLXR 69
           +PG + +C   TP   PQ G P   P+T  R
Sbjct: 416 KPGGSQQCHPPTPDTGPQNGHPEGVPHTPQR 446


>AL513327-4|CAI13956.1|  464|Homo sapiens polyhomeotic homolog 2
           (Drosophila) protein.
          Length = 464

 Score = 30.7 bits (66), Expect = 4.1
 Identities = 12/31 (38%), Positives = 16/31 (51%)
 Frame = -3

Query: 161 EPGSTPRCPSGTPSMSPQKGSPASQPYTLXR 69
           +PG + +C   TP   PQ G P   P+T  R
Sbjct: 21  KPGGSQQCHPPTPDTGPQNGHPEGVPHTPQR 51


>AK024260-1|BAB14863.1|  126|Homo sapiens protein ( Homo sapiens
           cDNA FLJ14198 fis, clone NT2RP3002512. ).
          Length = 126

 Score = 30.7 bits (66), Expect = 4.1
 Identities = 15/40 (37%), Positives = 22/40 (55%)
 Frame = +1

Query: 112 GDIDGVPLGQRGVLPGSTQINRKCFREGESRRAPSAGPML 231
           G++  V  G+R +LP   Q+   C +EG SRR    G +L
Sbjct: 18  GNVTVVQKGERDILPNGQQV-LVCSQEGSSRRCGGQGDLL 56


>AJ419231-1|CAD11673.1|  858|Homo sapiens polyhomeotic 2 protein.
          Length = 858

 Score = 30.7 bits (66), Expect = 4.1
 Identities = 12/31 (38%), Positives = 16/31 (51%)
 Frame = -3

Query: 161 EPGSTPRCPSGTPSMSPQKGSPASQPYTLXR 69
           +PG + +C   TP   PQ G P   P+T  R
Sbjct: 416 KPGGSQQCHPPTPDTGPQNGHPEGVPHTPQR 446


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 88,336,242
Number of Sequences: 237096
Number of extensions: 1862787
Number of successful extensions: 8969
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 8677
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 8967
length of database: 76,859,062
effective HSP length: 86
effective length of database: 56,468,806
effective search space used: 6324506272
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).