SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0027
         (429 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z97634-12|CAI95599.1|  195|Homo sapiens non-metastatic cells 4, ...    37   0.033
Z97634-14|CAM26405.1|  168|Homo sapiens non-metastatic cells 4, ...    31   2.2  
Z97634-13|CAC37288.1|  187|Homo sapiens non-metastatic cells 4, ...    31   2.2  
Z97634-10|CAO77937.1|  233|Homo sapiens non-metastatic cells 4, ...    31   2.2  
Y07604-1|CAA68877.1|  187|Homo sapiens nucleoside-diphosphate ki...    31   2.2  
BT019438-1|AAV38245.1|  187|Homo sapiens non-metastatic cells 4,...    31   2.2  
BC017067-1|AAH17067.1|  187|Homo sapiens non-metastatic cells 4,...    31   2.2  
BC004880-1|AAH04880.1|  187|Homo sapiens non-metastatic cells 4,...    31   2.2  
AL023881-7|CAO77957.1|  233|Homo sapiens non-metastatic cells 4,...    31   2.2  
AE006463-10|AAK61230.1|  187|Homo sapiens nucleoside diphosphate...    31   2.2  
AJ277892-3|CAD12457.1| 5604|Homo sapiens Novex-3 Titin Isoform p...    29   8.8  
AC023270-1|AAX88844.1| 5604|Homo sapiens unknown protein.              29   8.8  

>Z97634-12|CAI95599.1|  195|Homo sapiens non-metastatic cells 4,
           protein expressed in protein.
          Length = 195

 Score = 36.7 bits (81), Expect = 0.033
 Identities = 20/54 (37%), Positives = 26/54 (48%)
 Frame = -3

Query: 229 LNRGPRSPGPL*RCRHGCSCPFFQFS*RSSTWAREQHWSCSKPAPERRRRIGSL 68
           L  GPR+PGP    RHG   P      R  +W RE+     KP   +RR +G +
Sbjct: 13  LRCGPRAPGPSLLVRHGSGLPPSALK-RGPSWTRERTLVAVKPDGVQRRLVGDV 65


>Z97634-14|CAM26405.1|  168|Homo sapiens non-metastatic cells 4,
           protein expressed in protein.
          Length = 168

 Score = 30.7 bits (66), Expect = 2.2
 Identities = 19/54 (35%), Positives = 25/54 (46%)
 Frame = -3

Query: 229 LNRGPRSPGPL*RCRHGCSCPFFQFS*RSSTWAREQHWSCSKPAPERRRRIGSL 68
           L  GPR+PGP    RHG   P         +W RE+     KP   +RR +G +
Sbjct: 8   LRCGPRAPGPSLLVRHGSGGP---------SWTRERTLVAVKPDGVQRRLVGDV 52


>Z97634-13|CAC37288.1|  187|Homo sapiens non-metastatic cells 4,
           protein expressed in protein.
          Length = 187

 Score = 30.7 bits (66), Expect = 2.2
 Identities = 19/54 (35%), Positives = 25/54 (46%)
 Frame = -3

Query: 229 LNRGPRSPGPL*RCRHGCSCPFFQFS*RSSTWAREQHWSCSKPAPERRRRIGSL 68
           L  GPR+PGP    RHG   P         +W RE+     KP   +RR +G +
Sbjct: 13  LRCGPRAPGPSLLVRHGSGGP---------SWTRERTLVAVKPDGVQRRLVGDV 57


>Z97634-10|CAO77937.1|  233|Homo sapiens non-metastatic cells 4,
           protein expressed in protein.
          Length = 233

 Score = 30.7 bits (66), Expect = 2.2
 Identities = 19/54 (35%), Positives = 25/54 (46%)
 Frame = -3

Query: 229 LNRGPRSPGPL*RCRHGCSCPFFQFS*RSSTWAREQHWSCSKPAPERRRRIGSL 68
           L  GPR+PGP    RHG   P         +W RE+     KP   +RR +G +
Sbjct: 13  LRCGPRAPGPSLLVRHGSGGP---------SWTRERTLVAVKPDGVQRRLVGDV 57


>Y07604-1|CAA68877.1|  187|Homo sapiens nucleoside-diphosphate
           kinase protein.
          Length = 187

 Score = 30.7 bits (66), Expect = 2.2
 Identities = 19/54 (35%), Positives = 25/54 (46%)
 Frame = -3

Query: 229 LNRGPRSPGPL*RCRHGCSCPFFQFS*RSSTWAREQHWSCSKPAPERRRRIGSL 68
           L  GPR+PGP    RHG   P         +W RE+     KP   +RR +G +
Sbjct: 13  LRCGPRAPGPSLLVRHGSGGP---------SWTRERTLVAVKPDGVQRRLVGDV 57


>BT019438-1|AAV38245.1|  187|Homo sapiens non-metastatic cells 4,
           protein expressed in protein.
          Length = 187

 Score = 30.7 bits (66), Expect = 2.2
 Identities = 19/54 (35%), Positives = 25/54 (46%)
 Frame = -3

Query: 229 LNRGPRSPGPL*RCRHGCSCPFFQFS*RSSTWAREQHWSCSKPAPERRRRIGSL 68
           L  GPR+PGP    RHG   P         +W RE+     KP   +RR +G +
Sbjct: 13  LRCGPRAPGPSLLVRHGSGGP---------SWTRERTLVAVKPDGVQRRLVGDV 57


>BC017067-1|AAH17067.1|  187|Homo sapiens non-metastatic cells 4,
           protein expressed in protein.
          Length = 187

 Score = 30.7 bits (66), Expect = 2.2
 Identities = 19/54 (35%), Positives = 25/54 (46%)
 Frame = -3

Query: 229 LNRGPRSPGPL*RCRHGCSCPFFQFS*RSSTWAREQHWSCSKPAPERRRRIGSL 68
           L  GPR+PGP    RHG   P         +W RE+     KP   +RR +G +
Sbjct: 13  LRCGPRAPGPSLLVRHGSGGP---------SWTRERTLVAVKPDGVQRRLVGDV 57


>BC004880-1|AAH04880.1|  187|Homo sapiens non-metastatic cells 4,
           protein expressed in protein.
          Length = 187

 Score = 30.7 bits (66), Expect = 2.2
 Identities = 19/54 (35%), Positives = 25/54 (46%)
 Frame = -3

Query: 229 LNRGPRSPGPL*RCRHGCSCPFFQFS*RSSTWAREQHWSCSKPAPERRRRIGSL 68
           L  GPR+PGP    RHG   P         +W RE+     KP   +RR +G +
Sbjct: 13  LRCGPRAPGPSLLVRHGSGGP---------SWTRERTLVAVKPDGVQRRLVGDV 57


>AL023881-7|CAO77957.1|  233|Homo sapiens non-metastatic cells 4,
           protein expressed in protein.
          Length = 233

 Score = 30.7 bits (66), Expect = 2.2
 Identities = 19/54 (35%), Positives = 25/54 (46%)
 Frame = -3

Query: 229 LNRGPRSPGPL*RCRHGCSCPFFQFS*RSSTWAREQHWSCSKPAPERRRRIGSL 68
           L  GPR+PGP    RHG   P         +W RE+     KP   +RR +G +
Sbjct: 13  LRCGPRAPGPSLLVRHGSGGP---------SWTRERTLVAVKPDGVQRRLVGDV 57


>AE006463-10|AAK61230.1|  187|Homo sapiens nucleoside diphosphate
           kinase : NDKM protein.
          Length = 187

 Score = 30.7 bits (66), Expect = 2.2
 Identities = 19/54 (35%), Positives = 25/54 (46%)
 Frame = -3

Query: 229 LNRGPRSPGPL*RCRHGCSCPFFQFS*RSSTWAREQHWSCSKPAPERRRRIGSL 68
           L  GPR+PGP    RHG   P         +W RE+     KP   +RR +G +
Sbjct: 13  LRCGPRAPGPSLLVRHGSGGP---------SWTRERTLVAVKPDGVQRRLVGDV 57


>AJ277892-3|CAD12457.1| 5604|Homo sapiens Novex-3 Titin Isoform
            protein.
          Length = 5604

 Score = 28.7 bits (61), Expect = 8.8
 Identities = 13/28 (46%), Positives = 17/28 (60%)
 Frame = -1

Query: 225  TEDLDRRARFDDAVTDVPAHFFNFLEDL 142
            TE+L+ +A   D VT  P H F FL D+
Sbjct: 4126 TEELEPKAMPQDQVTQSPKHRFVFLSDI 4153


>AC023270-1|AAX88844.1| 5604|Homo sapiens unknown protein.
          Length = 5604

 Score = 28.7 bits (61), Expect = 8.8
 Identities = 13/28 (46%), Positives = 17/28 (60%)
 Frame = -1

Query: 225  TEDLDRRARFDDAVTDVPAHFFNFLEDL 142
            TE+L+ +A   D VT  P H F FL D+
Sbjct: 4126 TEELEPKAMPQDQVTQSPKHRFVFLSDI 4153


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 55,785,848
Number of Sequences: 237096
Number of extensions: 1086788
Number of successful extensions: 1955
Number of sequences better than 10.0: 12
Number of HSP's better than 10.0 without gapping: 1921
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1955
length of database: 76,859,062
effective HSP length: 83
effective length of database: 57,180,094
effective search space used: 3373625546
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).