SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0023
         (289 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

X66699-1|CAA47244.1|   92|Homo sapiens ribosomal protein L37a pr...   136   9e-33
L06499-1|AAA60280.1|   92|Homo sapiens ribosomal protein L37a pr...   136   9e-33
CR542152-1|CAG46949.1|   92|Homo sapiens RPL37A protein.              136   9e-33
BC082239-1|AAH82239.1|   92|Homo sapiens ribosomal protein L37a ...   136   9e-33
BC067789-1|AAH67789.1|   92|Homo sapiens ribosomal protein L37a ...   136   9e-33
BC016748-1|AAH16748.1|   92|Homo sapiens ribosomal protein L37a ...   136   9e-33
BC014262-1|AAH14262.1|   92|Homo sapiens ribosomal protein L37a ...   136   9e-33
AC073321-2|AAY15078.1|   92|Homo sapiens unknown protein.             136   9e-33
BC000555-1|AAH00555.2|   91|Homo sapiens RPL37A protein protein.      134   4e-32
BC063476-1|AAH63476.1|   72|Homo sapiens RPL37A protein protein.      130   8e-31
AF174595-1|AAF04516.1|  173|Homo sapiens F-box protein Fbx3 prot...    29   2.1  
BC048806-1|AAH48806.1|  126|Homo sapiens chromosome 17 open read...    29   3.6  
BC036356-1|AAH36356.1|  264|Homo sapiens C17orf64 protein protein.     29   3.6  
AY577304-1|AAT84393.1|  128|Homo sapiens immunoglobulin heavy ch...    28   4.8  
X00663-1|CAA25282.1|  800|Homo sapiens protein ( Human mRNA frag...    28   6.3  
X00588-1|CAA25240.1| 1210|Homo sapiens epidermal growth factor r...    28   6.3  
U95089-1|AAB53063.1|  405|Homo sapiens truncated epidermal growt...    28   6.3  
U48722-1|AAC50802.1|  405|Homo sapiens epidermal growth factor r...    28   6.3  
K03193-1|AAA52371.1|  657|Homo sapiens EGFR protein.                   28   6.3  
BC128419-1|AAI28420.1|  388|Homo sapiens EGFR protein protein.         28   6.3  
BC118665-1|AAI18666.1|  464|Homo sapiens EGFR protein protein.         28   6.3  
BC094761-1|AAH94761.1| 1091|Homo sapiens EGFR protein protein.         28   6.3  
AY698024-1|AAT97979.1|  405|Homo sapiens epidermal growth factor...    28   6.3  
AY698023-1|AAT97978.1|  645|Homo sapiens epidermal growth factor...    28   6.3  
AY588246-1|AAS83109.1| 1210|Homo sapiens epidermal growth factor...    28   6.3  
AY550966-1|AAT52212.1| 1210|Homo sapiens cell growth inhibiting ...    28   6.3  
AF288738-5|AAG35787.1|  405|Homo sapiens p60 epidermal growth fa...    28   6.3  
AF288738-4|AAG35790.1|  628|Homo sapiens truncated epidermal gro...    28   6.3  
AF288738-3|AAG35786.1|  705|Homo sapiens p110 epidermal growth f...    28   6.3  
AF288738-2|AAG35788.1|  657|Homo sapiens A431-specific p115 epid...    28   6.3  
AF288738-1|AAG35789.1| 1210|Homo sapiens p170 epidermal growth f...    28   6.3  
AF125253-1|AAG43240.1|  705|Homo sapiens truncated epidermal gro...    28   6.3  
AB209442-1|BAD92679.1| 1081|Homo sapiens epidermal growth factor...    28   6.3  
D12763-1|BAA02233.1|  328|Homo sapiens ST2 protein protein.            27   8.3  
BC117223-1|AAI17224.1|  907|Homo sapiens zinc finger protein 228...    27   8.3  
BC101753-1|AAI01754.1|  907|Homo sapiens zinc finger protein 228...    27   8.3  
BC030975-1|AAH30975.1|  328|Homo sapiens interleukin 1 receptor-...    27   8.3  
AC084239-2|AAG23968.1|  913|Homo sapiens ZNF228 protein protein.       27   8.3  
AC007248-2|AAY15047.1|  556|Homo sapiens unknown protein.              27   8.3  
AB012701-1|BAA82405.2|  556|Homo sapiens ST2L protein.                 27   8.3  

>X66699-1|CAA47244.1|   92|Homo sapiens ribosomal protein L37a
           protein.
          Length = 92

 Score =  136 bits (330), Expect = 9e-33
 Identities = 59/76 (77%), Positives = 66/76 (86%)
 Frame = +2

Query: 26  MAKRTKKVGITGKYGTRYGASLRKMVKKMEVTQHAKYTCSFCGKDAMKRSCVGIWSCKRC 205
           MAKRTKKVGI GKYGTRYGASLRKMVKK+E++QHAKYTCSFCGK  MKR  VGIW C  C
Sbjct: 1   MAKRTKKVGIVGKYGTRYGASLRKMVKKIEISQHAKYTCSFCGKTKMKRRAVGIWHCGSC 60

Query: 206 KRTVAGGAWVFSTTAA 253
            +TVAGGAW ++TT+A
Sbjct: 61  MKTVAGGAWTYNTTSA 76


>L06499-1|AAA60280.1|   92|Homo sapiens ribosomal protein L37a
           protein.
          Length = 92

 Score =  136 bits (330), Expect = 9e-33
 Identities = 59/76 (77%), Positives = 66/76 (86%)
 Frame = +2

Query: 26  MAKRTKKVGITGKYGTRYGASLRKMVKKMEVTQHAKYTCSFCGKDAMKRSCVGIWSCKRC 205
           MAKRTKKVGI GKYGTRYGASLRKMVKK+E++QHAKYTCSFCGK  MKR  VGIW C  C
Sbjct: 1   MAKRTKKVGIVGKYGTRYGASLRKMVKKIEISQHAKYTCSFCGKTKMKRRAVGIWHCGSC 60

Query: 206 KRTVAGGAWVFSTTAA 253
            +TVAGGAW ++TT+A
Sbjct: 61  MKTVAGGAWTYNTTSA 76


>CR542152-1|CAG46949.1|   92|Homo sapiens RPL37A protein.
          Length = 92

 Score =  136 bits (330), Expect = 9e-33
 Identities = 59/76 (77%), Positives = 66/76 (86%)
 Frame = +2

Query: 26  MAKRTKKVGITGKYGTRYGASLRKMVKKMEVTQHAKYTCSFCGKDAMKRSCVGIWSCKRC 205
           MAKRTKKVGI GKYGTRYGASLRKMVKK+E++QHAKYTCSFCGK  MKR  VGIW C  C
Sbjct: 1   MAKRTKKVGIVGKYGTRYGASLRKMVKKIEISQHAKYTCSFCGKTKMKRRAVGIWHCGSC 60

Query: 206 KRTVAGGAWVFSTTAA 253
            +TVAGGAW ++TT+A
Sbjct: 61  MKTVAGGAWTYNTTSA 76


>BC082239-1|AAH82239.1|   92|Homo sapiens ribosomal protein L37a
           protein.
          Length = 92

 Score =  136 bits (330), Expect = 9e-33
 Identities = 59/76 (77%), Positives = 66/76 (86%)
 Frame = +2

Query: 26  MAKRTKKVGITGKYGTRYGASLRKMVKKMEVTQHAKYTCSFCGKDAMKRSCVGIWSCKRC 205
           MAKRTKKVGI GKYGTRYGASLRKMVKK+E++QHAKYTCSFCGK  MKR  VGIW C  C
Sbjct: 1   MAKRTKKVGIVGKYGTRYGASLRKMVKKIEISQHAKYTCSFCGKTKMKRRAVGIWHCGSC 60

Query: 206 KRTVAGGAWVFSTTAA 253
            +TVAGGAW ++TT+A
Sbjct: 61  MKTVAGGAWTYNTTSA 76


>BC067789-1|AAH67789.1|   92|Homo sapiens ribosomal protein L37a
           protein.
          Length = 92

 Score =  136 bits (330), Expect = 9e-33
 Identities = 59/76 (77%), Positives = 66/76 (86%)
 Frame = +2

Query: 26  MAKRTKKVGITGKYGTRYGASLRKMVKKMEVTQHAKYTCSFCGKDAMKRSCVGIWSCKRC 205
           MAKRTKKVGI GKYGTRYGASLRKMVKK+E++QHAKYTCSFCGK  MKR  VGIW C  C
Sbjct: 1   MAKRTKKVGIVGKYGTRYGASLRKMVKKIEISQHAKYTCSFCGKTKMKRRAVGIWHCGSC 60

Query: 206 KRTVAGGAWVFSTTAA 253
            +TVAGGAW ++TT+A
Sbjct: 61  MKTVAGGAWTYNTTSA 76


>BC016748-1|AAH16748.1|   92|Homo sapiens ribosomal protein L37a
           protein.
          Length = 92

 Score =  136 bits (330), Expect = 9e-33
 Identities = 59/76 (77%), Positives = 66/76 (86%)
 Frame = +2

Query: 26  MAKRTKKVGITGKYGTRYGASLRKMVKKMEVTQHAKYTCSFCGKDAMKRSCVGIWSCKRC 205
           MAKRTKKVGI GKYGTRYGASLRKMVKK+E++QHAKYTCSFCGK  MKR  VGIW C  C
Sbjct: 1   MAKRTKKVGIVGKYGTRYGASLRKMVKKIEISQHAKYTCSFCGKTKMKRRAVGIWHCGSC 60

Query: 206 KRTVAGGAWVFSTTAA 253
            +TVAGGAW ++TT+A
Sbjct: 61  MKTVAGGAWTYNTTSA 76


>BC014262-1|AAH14262.1|   92|Homo sapiens ribosomal protein L37a
           protein.
          Length = 92

 Score =  136 bits (330), Expect = 9e-33
 Identities = 59/76 (77%), Positives = 66/76 (86%)
 Frame = +2

Query: 26  MAKRTKKVGITGKYGTRYGASLRKMVKKMEVTQHAKYTCSFCGKDAMKRSCVGIWSCKRC 205
           MAKRTKKVGI GKYGTRYGASLRKMVKK+E++QHAKYTCSFCGK  MKR  VGIW C  C
Sbjct: 1   MAKRTKKVGIVGKYGTRYGASLRKMVKKIEISQHAKYTCSFCGKTKMKRRAVGIWHCGSC 60

Query: 206 KRTVAGGAWVFSTTAA 253
            +TVAGGAW ++TT+A
Sbjct: 61  MKTVAGGAWTYNTTSA 76


>AC073321-2|AAY15078.1|   92|Homo sapiens unknown protein.
          Length = 92

 Score =  136 bits (330), Expect = 9e-33
 Identities = 59/76 (77%), Positives = 66/76 (86%)
 Frame = +2

Query: 26  MAKRTKKVGITGKYGTRYGASLRKMVKKMEVTQHAKYTCSFCGKDAMKRSCVGIWSCKRC 205
           MAKRTKKVGI GKYGTRYGASLRKMVKK+E++QHAKYTCSFCGK  MKR  VGIW C  C
Sbjct: 1   MAKRTKKVGIVGKYGTRYGASLRKMVKKIEISQHAKYTCSFCGKTKMKRRAVGIWHCGSC 60

Query: 206 KRTVAGGAWVFSTTAA 253
            +TVAGGAW ++TT+A
Sbjct: 61  MKTVAGGAWTYNTTSA 76


>BC000555-1|AAH00555.2|   91|Homo sapiens RPL37A protein protein.
          Length = 91

 Score =  134 bits (325), Expect = 4e-32
 Identities = 58/75 (77%), Positives = 65/75 (86%)
 Frame = +2

Query: 29  AKRTKKVGITGKYGTRYGASLRKMVKKMEVTQHAKYTCSFCGKDAMKRSCVGIWSCKRCK 208
           AKRTKKVGI GKYGTRYGASLRKMVKK+E++QHAKYTCSFCGK  MKR  VGIW C  C 
Sbjct: 1   AKRTKKVGIVGKYGTRYGASLRKMVKKIEISQHAKYTCSFCGKTKMKRRAVGIWHCGSCM 60

Query: 209 RTVAGGAWVFSTTAA 253
           +TVAGGAW ++TT+A
Sbjct: 61  KTVAGGAWTYNTTSA 75


>BC063476-1|AAH63476.1|   72|Homo sapiens RPL37A protein protein.
          Length = 72

 Score =  130 bits (314), Expect = 8e-31
 Identities = 56/71 (78%), Positives = 61/71 (85%)
 Frame = +2

Query: 26  MAKRTKKVGITGKYGTRYGASLRKMVKKMEVTQHAKYTCSFCGKDAMKRSCVGIWSCKRC 205
           MAKRTKKVGI GKYGTRYGASLRKMVKK+E++QHAKYTCSFCGK  MKR  VGIW C  C
Sbjct: 1   MAKRTKKVGIVGKYGTRYGASLRKMVKKIEISQHAKYTCSFCGKTKMKRRAVGIWHCGSC 60

Query: 206 KRTVAGGAWVF 238
            +TVAGGAW +
Sbjct: 61  MKTVAGGAWTY 71


>AF174595-1|AAF04516.1|  173|Homo sapiens F-box protein Fbx3
           protein.
          Length = 173

 Score = 29.5 bits (63), Expect = 2.1
 Identities = 9/18 (50%), Positives = 10/18 (55%)
 Frame = +1

Query: 25  NGQTYQKGWNYWQIWHTL 78
           NGQ     W YW+ WH L
Sbjct: 148 NGQKLVGSWGYWEAWHCL 165


>BC048806-1|AAH48806.1|  126|Homo sapiens chromosome 17 open reading
           frame 64 protein.
          Length = 126

 Score = 28.7 bits (61), Expect = 3.6
 Identities = 12/29 (41%), Positives = 19/29 (65%)
 Frame = +2

Query: 89  LRKMVKKMEVTQHAKYTCSFCGKDAMKRS 175
           LR++ K  + +Q AK+  +FC  DA +RS
Sbjct: 17  LRRLYKYTKSSQPAKFLVTFCASDAPERS 45


>BC036356-1|AAH36356.1|  264|Homo sapiens C17orf64 protein protein.
          Length = 264

 Score = 28.7 bits (61), Expect = 3.6
 Identities = 12/29 (41%), Positives = 19/29 (65%)
 Frame = +2

Query: 89  LRKMVKKMEVTQHAKYTCSFCGKDAMKRS 175
           LR++ K  + +Q AK+  +FC  DA +RS
Sbjct: 155 LRRLYKYTKSSQPAKFLVTFCASDAPERS 183


>AY577304-1|AAT84393.1|  128|Homo sapiens immunoglobulin heavy chain
           variable region protein protein.
          Length = 128

 Score = 28.3 bits (60), Expect = 4.8
 Identities = 10/36 (27%), Positives = 17/36 (47%)
 Frame = +1

Query: 16  VYQNGQTYQKGWNYWQIWHTLRCLST*NGQKDGSNP 123
           +Y   ++Y  GWNY+  W     ++  +G     NP
Sbjct: 93  MYYCARSYSTGWNYFDYWGQGTLVTVSSGSASAPNP 128


>X00663-1|CAA25282.1|  800|Homo sapiens protein ( Human mRNA
           fragment for epidermal growth factor (EGF) receptor. ).
          Length = 800

 Score = 27.9 bits (59), Expect = 6.3
 Identities = 16/51 (31%), Positives = 27/51 (52%), Gaps = 1/51 (1%)
 Frame = +2

Query: 59  GKYGTRYGAS-LRKMVKKMEVTQHAKYTCSFCGKDAMKRSCVGIWSCKRCK 208
           GKY   +GA+ ++K  +   VT H     + CG D+ +    G+  CK+C+
Sbjct: 141 GKYS--FGATCVKKCPRNYVVTDHGSCVRA-CGADSYEMEEDGVRKCKKCE 188


>X00588-1|CAA25240.1| 1210|Homo sapiens epidermal growth factor
           receptor protein.
          Length = 1210

 Score = 27.9 bits (59), Expect = 6.3
 Identities = 16/51 (31%), Positives = 27/51 (52%), Gaps = 1/51 (1%)
 Frame = +2

Query: 59  GKYGTRYGAS-LRKMVKKMEVTQHAKYTCSFCGKDAMKRSCVGIWSCKRCK 208
           GKY   +GA+ ++K  +   VT H     + CG D+ +    G+  CK+C+
Sbjct: 283 GKYS--FGATCVKKCPRNYVVTDHGSCVRA-CGADSYEMEEDGVRKCKKCE 330


>U95089-1|AAB53063.1|  405|Homo sapiens truncated epidermal growth
           factor receptor-like protein precursor protein.
          Length = 405

 Score = 27.9 bits (59), Expect = 6.3
 Identities = 16/51 (31%), Positives = 27/51 (52%), Gaps = 1/51 (1%)
 Frame = +2

Query: 59  GKYGTRYGAS-LRKMVKKMEVTQHAKYTCSFCGKDAMKRSCVGIWSCKRCK 208
           GKY   +GA+ ++K  +   VT H     + CG D+ +    G+  CK+C+
Sbjct: 283 GKYS--FGATCVKKCPRNYVVTDHGSCVRA-CGADSYEMEEDGVRKCKKCE 330


>U48722-1|AAC50802.1|  405|Homo sapiens epidermal growth factor
           receptor precursor protein.
          Length = 405

 Score = 27.9 bits (59), Expect = 6.3
 Identities = 16/51 (31%), Positives = 27/51 (52%), Gaps = 1/51 (1%)
 Frame = +2

Query: 59  GKYGTRYGAS-LRKMVKKMEVTQHAKYTCSFCGKDAMKRSCVGIWSCKRCK 208
           GKY   +GA+ ++K  +   VT H     + CG D+ +    G+  CK+C+
Sbjct: 283 GKYS--FGATCVKKCPRNYVVTDHGSCVRA-CGADSYEMEEDGVRKCKKCE 330


>K03193-1|AAA52371.1|  657|Homo sapiens EGFR protein.
          Length = 657

 Score = 27.9 bits (59), Expect = 6.3
 Identities = 16/51 (31%), Positives = 27/51 (52%), Gaps = 1/51 (1%)
 Frame = +2

Query: 59  GKYGTRYGAS-LRKMVKKMEVTQHAKYTCSFCGKDAMKRSCVGIWSCKRCK 208
           GKY   +GA+ ++K  +   VT H     + CG D+ +    G+  CK+C+
Sbjct: 283 GKYS--FGATCVKKCPRNYVVTDHGSCVRA-CGADSYEMEEDGVRKCKKCE 330


>BC128419-1|AAI28420.1|  388|Homo sapiens EGFR protein protein.
          Length = 388

 Score = 27.9 bits (59), Expect = 6.3
 Identities = 16/51 (31%), Positives = 27/51 (52%), Gaps = 1/51 (1%)
 Frame = +2

Query: 59  GKYGTRYGAS-LRKMVKKMEVTQHAKYTCSFCGKDAMKRSCVGIWSCKRCK 208
           GKY   +GA+ ++K  +   VT H     + CG D+ +    G+  CK+C+
Sbjct: 11  GKYS--FGATCVKKCPRNYVVTDHGSCVRA-CGADSYEMEEDGVRKCKKCE 58


>BC118665-1|AAI18666.1|  464|Homo sapiens EGFR protein protein.
          Length = 464

 Score = 27.9 bits (59), Expect = 6.3
 Identities = 16/51 (31%), Positives = 27/51 (52%), Gaps = 1/51 (1%)
 Frame = +2

Query: 59  GKYGTRYGAS-LRKMVKKMEVTQHAKYTCSFCGKDAMKRSCVGIWSCKRCK 208
           GKY   +GA+ ++K  +   VT H     + CG D+ +    G+  CK+C+
Sbjct: 77  GKYS--FGATCVKKCPRNYVVTDHGSCVRA-CGADSYEMEEDGVRKCKKCE 124


>BC094761-1|AAH94761.1| 1091|Homo sapiens EGFR protein protein.
          Length = 1091

 Score = 27.9 bits (59), Expect = 6.3
 Identities = 16/51 (31%), Positives = 27/51 (52%), Gaps = 1/51 (1%)
 Frame = +2

Query: 59  GKYGTRYGAS-LRKMVKKMEVTQHAKYTCSFCGKDAMKRSCVGIWSCKRCK 208
           GKY   +GA+ ++K  +   VT H     + CG D+ +    G+  CK+C+
Sbjct: 238 GKYS--FGATCVKKCPRNYVVTDHGSCVRA-CGADSYEMEEDGVRKCKKCE 285


>AY698024-1|AAT97979.1|  405|Homo sapiens epidermal growth factor
           receptor short isoform protein.
          Length = 405

 Score = 27.9 bits (59), Expect = 6.3
 Identities = 16/51 (31%), Positives = 27/51 (52%), Gaps = 1/51 (1%)
 Frame = +2

Query: 59  GKYGTRYGAS-LRKMVKKMEVTQHAKYTCSFCGKDAMKRSCVGIWSCKRCK 208
           GKY   +GA+ ++K  +   VT H     + CG D+ +    G+  CK+C+
Sbjct: 283 GKYS--FGATCVKKCPRNYVVTDHGSCVRA-CGADSYEMEEDGVRKCKKCE 330


>AY698023-1|AAT97978.1|  645|Homo sapiens epidermal growth factor
           receptor protein.
          Length = 645

 Score = 27.9 bits (59), Expect = 6.3
 Identities = 16/51 (31%), Positives = 27/51 (52%), Gaps = 1/51 (1%)
 Frame = +2

Query: 59  GKYGTRYGAS-LRKMVKKMEVTQHAKYTCSFCGKDAMKRSCVGIWSCKRCK 208
           GKY   +GA+ ++K  +   VT H     + CG D+ +    G+  CK+C+
Sbjct: 283 GKYS--FGATCVKKCPRNYVVTDHGSCVRA-CGADSYEMEEDGVRKCKKCE 330


>AY588246-1|AAS83109.1| 1210|Homo sapiens epidermal growth factor
           receptor (erythroblastic leukemia viral (v-erb-b) oncog
           protein.
          Length = 1210

 Score = 27.9 bits (59), Expect = 6.3
 Identities = 16/51 (31%), Positives = 27/51 (52%), Gaps = 1/51 (1%)
 Frame = +2

Query: 59  GKYGTRYGAS-LRKMVKKMEVTQHAKYTCSFCGKDAMKRSCVGIWSCKRCK 208
           GKY   +GA+ ++K  +   VT H     + CG D+ +    G+  CK+C+
Sbjct: 283 GKYS--FGATCVKKCPRNYVVTDHGSCVRA-CGADSYEMEEDGVRKCKKCE 330


>AY550966-1|AAT52212.1| 1210|Homo sapiens cell growth inhibiting
           protein 40 protein.
          Length = 1210

 Score = 27.9 bits (59), Expect = 6.3
 Identities = 16/51 (31%), Positives = 27/51 (52%), Gaps = 1/51 (1%)
 Frame = +2

Query: 59  GKYGTRYGAS-LRKMVKKMEVTQHAKYTCSFCGKDAMKRSCVGIWSCKRCK 208
           GKY   +GA+ ++K  +   VT H     + CG D+ +    G+  CK+C+
Sbjct: 283 GKYS--FGATCVKKCPRNYVVTDHGSCVRA-CGADSYEMEEDGVRKCKKCE 330


>AF288738-5|AAG35787.1|  405|Homo sapiens p60 epidermal growth
           factor receptor protein.
          Length = 405

 Score = 27.9 bits (59), Expect = 6.3
 Identities = 16/51 (31%), Positives = 27/51 (52%), Gaps = 1/51 (1%)
 Frame = +2

Query: 59  GKYGTRYGAS-LRKMVKKMEVTQHAKYTCSFCGKDAMKRSCVGIWSCKRCK 208
           GKY   +GA+ ++K  +   VT H     + CG D+ +    G+  CK+C+
Sbjct: 283 GKYS--FGATCVKKCPRNYVVTDHGSCVRA-CGADSYEMEEDGVRKCKKCE 330


>AF288738-4|AAG35790.1|  628|Homo sapiens truncated epidermal growth
           factor receptor protein.
          Length = 628

 Score = 27.9 bits (59), Expect = 6.3
 Identities = 16/51 (31%), Positives = 27/51 (52%), Gaps = 1/51 (1%)
 Frame = +2

Query: 59  GKYGTRYGAS-LRKMVKKMEVTQHAKYTCSFCGKDAMKRSCVGIWSCKRCK 208
           GKY   +GA+ ++K  +   VT H     + CG D+ +    G+  CK+C+
Sbjct: 283 GKYS--FGATCVKKCPRNYVVTDHGSCVRA-CGADSYEMEEDGVRKCKKCE 330


>AF288738-3|AAG35786.1|  705|Homo sapiens p110 epidermal growth
           factor receptor protein.
          Length = 705

 Score = 27.9 bits (59), Expect = 6.3
 Identities = 16/51 (31%), Positives = 27/51 (52%), Gaps = 1/51 (1%)
 Frame = +2

Query: 59  GKYGTRYGAS-LRKMVKKMEVTQHAKYTCSFCGKDAMKRSCVGIWSCKRCK 208
           GKY   +GA+ ++K  +   VT H     + CG D+ +    G+  CK+C+
Sbjct: 283 GKYS--FGATCVKKCPRNYVVTDHGSCVRA-CGADSYEMEEDGVRKCKKCE 330


>AF288738-2|AAG35788.1|  657|Homo sapiens A431-specific p115
           epidermal growth factor receptor protein.
          Length = 657

 Score = 27.9 bits (59), Expect = 6.3
 Identities = 16/51 (31%), Positives = 27/51 (52%), Gaps = 1/51 (1%)
 Frame = +2

Query: 59  GKYGTRYGAS-LRKMVKKMEVTQHAKYTCSFCGKDAMKRSCVGIWSCKRCK 208
           GKY   +GA+ ++K  +   VT H     + CG D+ +    G+  CK+C+
Sbjct: 283 GKYS--FGATCVKKCPRNYVVTDHGSCVRA-CGADSYEMEEDGVRKCKKCE 330


>AF288738-1|AAG35789.1| 1210|Homo sapiens p170 epidermal growth
           factor receptor protein.
          Length = 1210

 Score = 27.9 bits (59), Expect = 6.3
 Identities = 16/51 (31%), Positives = 27/51 (52%), Gaps = 1/51 (1%)
 Frame = +2

Query: 59  GKYGTRYGAS-LRKMVKKMEVTQHAKYTCSFCGKDAMKRSCVGIWSCKRCK 208
           GKY   +GA+ ++K  +   VT H     + CG D+ +    G+  CK+C+
Sbjct: 283 GKYS--FGATCVKKCPRNYVVTDHGSCVRA-CGADSYEMEEDGVRKCKKCE 330


>AF125253-1|AAG43240.1|  705|Homo sapiens truncated epidermal growth
           factor receptor precursor protein.
          Length = 705

 Score = 27.9 bits (59), Expect = 6.3
 Identities = 16/51 (31%), Positives = 27/51 (52%), Gaps = 1/51 (1%)
 Frame = +2

Query: 59  GKYGTRYGAS-LRKMVKKMEVTQHAKYTCSFCGKDAMKRSCVGIWSCKRCK 208
           GKY   +GA+ ++K  +   VT H     + CG D+ +    G+  CK+C+
Sbjct: 283 GKYS--FGATCVKKCPRNYVVTDHGSCVRA-CGADSYEMEEDGVRKCKKCE 330


>AB209442-1|BAD92679.1| 1081|Homo sapiens epidermal growth factor
           receptor isoform a variant protein.
          Length = 1081

 Score = 27.9 bits (59), Expect = 6.3
 Identities = 16/51 (31%), Positives = 27/51 (52%), Gaps = 1/51 (1%)
 Frame = +2

Query: 59  GKYGTRYGAS-LRKMVKKMEVTQHAKYTCSFCGKDAMKRSCVGIWSCKRCK 208
           GKY   +GA+ ++K  +   VT H     + CG D+ +    G+  CK+C+
Sbjct: 154 GKYS--FGATCVKKCPRNYVVTDHGSCVRA-CGADSYEMEEDGVRKCKKCE 201


>D12763-1|BAA02233.1|  328|Homo sapiens ST2 protein protein.
          Length = 328

 Score = 27.5 bits (58), Expect = 8.3
 Identities = 16/49 (32%), Positives = 25/49 (51%), Gaps = 1/49 (2%)
 Frame = +2

Query: 80  GASLRKMVKKMEVTQHAKYTCSFC-GKDAMKRSCVGIWSCKRCKRTVAG 223
           GA  +  +K++E+ ++A  TCS C GK     + V +W     K T  G
Sbjct: 215 GAPAQNEIKEVEIGKNANLTCSACFGKGTQFLAAV-LWQLNGTKITDFG 262


>BC117223-1|AAI17224.1|  907|Homo sapiens zinc finger protein 228
           protein.
          Length = 907

 Score = 27.5 bits (58), Expect = 8.3
 Identities = 11/23 (47%), Positives = 15/23 (65%)
 Frame = +2

Query: 107 KMEVTQHAKYTCSFCGKDAMKRS 175
           K+EV +   Y+C  CG+D MK S
Sbjct: 216 KLEVHRKENYSCHDCGEDIMKVS 238


>BC101753-1|AAI01754.1|  907|Homo sapiens zinc finger protein 228
           protein.
          Length = 907

 Score = 27.5 bits (58), Expect = 8.3
 Identities = 11/23 (47%), Positives = 15/23 (65%)
 Frame = +2

Query: 107 KMEVTQHAKYTCSFCGKDAMKRS 175
           K+EV +   Y+C  CG+D MK S
Sbjct: 216 KLEVHRKENYSCHDCGEDIMKVS 238


>BC030975-1|AAH30975.1|  328|Homo sapiens interleukin 1
           receptor-like 1 protein.
          Length = 328

 Score = 27.5 bits (58), Expect = 8.3
 Identities = 16/49 (32%), Positives = 25/49 (51%), Gaps = 1/49 (2%)
 Frame = +2

Query: 80  GASLRKMVKKMEVTQHAKYTCSFC-GKDAMKRSCVGIWSCKRCKRTVAG 223
           GA  +  +K++E+ ++A  TCS C GK     + V +W     K T  G
Sbjct: 215 GAPAQNEIKEVEIGKNANLTCSACFGKGTQFLAAV-LWQLNGTKITDFG 262


>AC084239-2|AAG23968.1|  913|Homo sapiens ZNF228 protein protein.
          Length = 913

 Score = 27.5 bits (58), Expect = 8.3
 Identities = 11/23 (47%), Positives = 15/23 (65%)
 Frame = +2

Query: 107 KMEVTQHAKYTCSFCGKDAMKRS 175
           K+EV +   Y+C  CG+D MK S
Sbjct: 222 KLEVHRKENYSCHDCGEDIMKVS 244


>AC007248-2|AAY15047.1|  556|Homo sapiens unknown protein.
          Length = 556

 Score = 27.5 bits (58), Expect = 8.3
 Identities = 16/49 (32%), Positives = 25/49 (51%), Gaps = 1/49 (2%)
 Frame = +2

Query: 80  GASLRKMVKKMEVTQHAKYTCSFC-GKDAMKRSCVGIWSCKRCKRTVAG 223
           GA  +  +K++E+ ++A  TCS C GK     + V +W     K T  G
Sbjct: 215 GAPAQNEIKEVEIGKNANLTCSACFGKGTQFLAAV-LWQLNGTKITDFG 262


>AB012701-1|BAA82405.2|  556|Homo sapiens ST2L protein.
          Length = 556

 Score = 27.5 bits (58), Expect = 8.3
 Identities = 16/49 (32%), Positives = 25/49 (51%), Gaps = 1/49 (2%)
 Frame = +2

Query: 80  GASLRKMVKKMEVTQHAKYTCSFC-GKDAMKRSCVGIWSCKRCKRTVAG 223
           GA  +  +K++E+ ++A  TCS C GK     + V +W     K T  G
Sbjct: 215 GAPAQNEIKEVEIGKNANLTCSACFGKGTQFLAAV-LWQLNGTKITDFG 262


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 48,458,420
Number of Sequences: 237096
Number of extensions: 993768
Number of successful extensions: 3324
Number of sequences better than 10.0: 40
Number of HSP's better than 10.0 without gapping: 2827
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3324
length of database: 76,859,062
effective HSP length: 72
effective length of database: 59,788,150
effective search space used: 1375127450
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).