SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= tesS0015
         (598 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

X02344-1|CAA26203.1|  445|Homo sapiens beta-tubulin protein.          182   6e-46
BX255925-3|CAM24148.1|  445|Homo sapiens tubulin, beta 2C protein.    182   6e-46
BC071889-1|AAH71889.1|  445|Homo sapiens tubulin, beta 2C protein.    182   6e-46
BC039175-1|AAH39175.1|  445|Homo sapiens tubulin, beta 2C protein.    182   6e-46
BC029529-1|AAH29529.1|  445|Homo sapiens tubulin, beta 2C protein.    182   6e-46
BC024038-1|AAH24038.1|  445|Homo sapiens tubulin, beta 2C protein.    182   6e-46
BC019829-1|AAH19829.1|  445|Homo sapiens tubulin, beta 2C protein.    182   6e-46
BC019359-1|AAH19359.1|  445|Homo sapiens tubulin, beta 2C protein.    182   6e-46
BC012835-1|AAH12835.1|  445|Homo sapiens tubulin, beta 2C protein.    182   6e-46
BC007889-1|AAH07889.1|  445|Homo sapiens tubulin, beta 2C protein.    182   6e-46
BC004188-1|AAH04188.1|  445|Homo sapiens tubulin, beta 2C protein.    182   6e-46
BC002885-1|AAH02885.1|  445|Homo sapiens tubulin, beta 2C protein.    182   6e-46
BC002783-1|AAH02783.1|  445|Homo sapiens tubulin, beta 2C protein.    182   6e-46
BC001911-1|AAH01911.1|  445|Homo sapiens tubulin, beta 2C protein.    182   6e-46
AY167990-1|AAN87335.1|  445|Homo sapiens class IVb beta tubulin ...   182   6e-46
V00599-1|CAA23844.1|  437|Homo sapiens protein ( Human mRNA frag...   180   3e-45
J00314-1|AAB59507.1|  444|Homo sapiens protein ( Human beta-tubu...   180   3e-45
BX248307-7|CAM25934.1|  426|Homo sapiens tubulin beta polypeptid...   180   3e-45
BX248307-6|CAM25933.1|  444|Homo sapiens tubulin beta polypeptid...   180   3e-45
BC103746-1|AAI03747.1|  444|Homo sapiens tubulin, beta protein.       180   3e-45
BC070326-1|AAH70326.1|  444|Homo sapiens tubulin, beta protein.       180   3e-45
BC021909-1|AAH21909.1|  444|Homo sapiens tubulin, beta protein.       180   3e-45
BC020946-1|AAH20946.1|  444|Homo sapiens tubulin, beta protein.       180   3e-45
BC019924-1|AAH19924.1|  444|Homo sapiens tubulin, beta protein.       180   3e-45
BC013374-1|AAH13374.1|  444|Homo sapiens tubulin, beta protein.       180   3e-45
BC007605-1|AAH07605.1|  444|Homo sapiens tubulin, beta protein.       180   3e-45
BC005838-1|AAH05838.1|  444|Homo sapiens tubulin, beta protein.       180   3e-45
BC002347-1|AAH02347.1|  444|Homo sapiens tubulin, beta protein.       180   3e-45
BC001938-1|AAH01938.1|  444|Homo sapiens tubulin, beta protein.       180   3e-45
BA000025-69|BAB63321.1|  444|Homo sapiens Beta-tubulin protein.       180   3e-45
AL845353-24|CAI41893.1|  426|Homo sapiens tubulin, beta polypept...   180   3e-45
AL845353-23|CAI41892.1|  444|Homo sapiens tubulin, beta polypept...   180   3e-45
AL662848-8|CAM24851.1|  426|Homo sapiens tubulin, beta protein.       180   3e-45
AL662848-7|CAI17441.1|  444|Homo sapiens tubulin, beta protein.       180   3e-45
AL662797-12|CAM25516.1|  426|Homo sapiens tubulin, beta protein.      180   3e-45
AL662797-11|CAI18196.1|  444|Homo sapiens tubulin, beta protein.      180   3e-45
AF141349-1|AAD33873.1|  444|Homo sapiens beta-tubulin protein.        180   3e-45
AF070600-1|AAC28654.1|  444|Homo sapiens beta-tubulin protein.        180   3e-45
AF070593-1|AAC28650.1|  444|Homo sapiens beta-tubulin protein.        180   3e-45
AF070561-1|AAC28642.1|  444|Homo sapiens beta-tubulin protein.        180   3e-45
AB202098-1|BAE78618.1|  444|Homo sapiens beta 5-tubulin protein.      180   3e-45
AB103606-1|BAF31267.1|  444|Homo sapiens beta-tubulin protein pr...   180   3e-45
AB088100-1|BAC54932.1|  444|Homo sapiens tubulin, beta polypepti...   180   3e-45
AB062393-1|BAB93480.1|  444|Homo sapiens beta 5-tubulin protein.      180   3e-45
X00734-1|CAA25318.1|  444|Homo sapiens tubulin 5-beta protein.        179   6e-45
BC013683-1|AAH13683.1|  444|Homo sapiens tubulin, beta 4 protein.     179   6e-45
BC006570-1|AAH06570.1|  444|Homo sapiens TUBB4 protein protein.       179   6e-45
X79535-1|CAA56071.1|  445|Homo sapiens beta tubulin protein.          178   1e-44
CR541958-1|CAG46756.1|  445|Homo sapiens TUBB protein.                178   1e-44
CR456788-1|CAG33069.1|  445|Homo sapiens MGC8685 protein.             178   1e-44
BT019930-1|AAV38733.1|  445|Homo sapiens tubulin, beta polypepti...   178   1e-44
BC141925-1|AAI41926.1|  253|Homo sapiens TUBB2A protein protein.      178   1e-44
BC141924-1|AAI41925.1|  253|Homo sapiens TUBB2A protein protein.      178   1e-44
BC063610-1|AAH63610.1|  445|Homo sapiens tubulin, beta 2B protein.    178   1e-44
BC018780-1|AAH18780.1|  445|Homo sapiens tubulin, beta 2A protein.    178   1e-44
BC001352-1|AAH01352.1|  445|Homo sapiens tubulin, beta 2B protein.    178   1e-44
BC001194-1|AAH01194.1|  445|Homo sapiens tubulin, beta 2A protein.    178   1e-44
AY159127-1|AAN85571.1|  445|Homo sapiens class II beta tubulin i...   178   1e-44
AL445309-1|CAI40952.1|  445|Homo sapiens RP11-506K6.1 protein.        178   1e-44
AL031963-6|CAD70628.1|  445|Homo sapiens protein ( Human DNA seq...   178   1e-44
BC101271-1|AAI01272.1|  441|Homo sapiens TUBB8 protein protein.       176   6e-44
BC101270-1|AAI01271.1|  441|Homo sapiens TUBB8 protein protein.       176   6e-44
AL713922-4|CAI16221.1|  435|Homo sapiens novel protein similar t...   176   6e-44
AF355127-1|AAL32434.1|  444|Homo sapiens beta-tubulin 4Q protein.     176   6e-44
AK022340-1|BAB14016.1|  446|Homo sapiens protein ( Homo sapiens ...   169   5e-42
BC002654-1|AAH02654.1|  446|Homo sapiens tubulin, beta 6 protein.     169   6e-42
BC111374-1|AAI11375.1|  447|Homo sapiens TUBB6 protein protein.       168   1e-41
U47634-1|AAC52035.1|  450|Homo sapiens beta-tubulin protein.          167   2e-41
BT006971-1|AAP35617.1|  797|Homo sapiens tubulin, beta, 4 protein.    167   2e-41
BC003021-1|AAH03021.2|  450|Homo sapiens tubulin, beta 3 protein.     167   2e-41
BC001678-1|AAH01678.2|  406|Homo sapiens TUBB3 protein protein.       167   2e-41
BC000748-1|AAH00748.1|  450|Homo sapiens tubulin, beta 3 protein.     167   2e-41
AK223039-1|BAD96759.1|  450|Homo sapiens tubulin, beta, 4 varian...   167   2e-41
AF427491-1|AAL28094.1|  450|Homo sapiens class III beta tubulin ...   167   2e-41
U83110-1|AAB41497.1|  434|Homo sapiens beta-tubulin protein.          157   4e-38
U83668-1|AAB48456.1|  433|Homo sapiens beta-tubulin protein.          150   4e-36
BC033679-1|AAH33679.1|  451|Homo sapiens tubulin, beta 1 protein.     147   2e-35
AL109840-7|CAC09371.2|  451|Homo sapiens tubulin, beta 1 protein.     147   2e-35
AJ292757-1|CAC16605.1|  451|Homo sapiens protein ( Homo sapiens ...   147   2e-35
BC047518-1|AAH47518.1|  280|Homo sapiens TUBB3 protein protein.       138   1e-32
BX248307-8|CAM25935.1|  372|Homo sapiens tubulin beta polypeptid...   130   5e-30
AL845353-25|CAI41894.1|  372|Homo sapiens tubulin, beta polypept...   130   5e-30
AL662848-9|CAI17442.1|  372|Homo sapiens tubulin, beta protein.       130   5e-30
AL662797-13|CAI18197.1|  372|Homo sapiens tubulin, beta protein.      130   5e-30
BC127872-1|AAI27873.2|  188|Homo sapiens TUBB2B protein protein.      128   1e-29
AL713922-2|CAI16219.1|  227|Homo sapiens novel protein similar t...   123   4e-28
X01703-1|CAA25855.1|  451|Homo sapiens alpha-tubulin protein.         100   4e-21
K00558-1|AAA91576.1|  451|Homo sapiens protein ( human alpha-tub...   100   4e-21
DQ400107-1|ABD60581.1|  451|Homo sapiens alpha tubulin protein.       100   4e-21
BC071904-1|AAH71904.1|  451|Homo sapiens tubulin, alpha 1b protein.   100   4e-21
BC063036-1|AAH63036.1|  449|Homo sapiens tubulin, alpha 1c protein.   100   4e-21
BC051297-1|AAH51297.1|  449|Homo sapiens tubulin, alpha 1c protein.   100   4e-21
BC050637-1|AAH50637.1|  451|Homo sapiens tubulin, alpha 1a protein.   100   4e-21
BC030820-1|AAH30820.1|  451|Homo sapiens tubulin, alpha 1b protein.   100   4e-21
BC021088-1|AAH21088.1|  449|Homo sapiens tubulin, alpha 1c protein.   100   4e-21
BC019298-1|AAH19298.1|  449|Homo sapiens tubulin, alpha 1c protein.   100   4e-21
BC017004-1|AAH17004.1|  451|Homo sapiens tubulin, alpha 1b protein.   100   4e-21
BC015883-1|AAH15883.1|  451|Homo sapiens tubulin, alpha 1b protein.   100   4e-21
BC011790-1|AAH11790.1|  449|Homo sapiens tubulin, alpha 1c protein.   100   4e-21
BC011572-1|AAH11572.1|  451|Homo sapiens tubulin, alpha 1b protein.   100   4e-21
BC010494-1|AAH10494.1|  451|Homo sapiens tubulin, alpha 1b protein.   100   4e-21
BC009513-1|AAH09513.1|  451|Homo sapiens tubulin, alpha 1b protein.   100   4e-21
BC009512-1|AAH09512.1|  451|Homo sapiens tubulin, alpha 1b protein.   100   4e-21
BC009509-1|AAH09509.1|  451|Homo sapiens tubulin, alpha 1b protein.   100   4e-21
BC009314-1|AAH09314.1|  451|Homo sapiens tubulin, alpha 1b protein.   100   4e-21
BC008659-1|AAH08659.1|  451|Homo sapiens tubulin, alpha 1b protein.   100   4e-21
BC006481-1|AAH06481.1|  451|Homo sapiens tubulin, alpha 1b protein.   100   4e-21
BC006468-1|AAH06468.1|  451|Homo sapiens tubulin, alpha 1a protein.   100   4e-21
BC006379-1|AAH06379.1|  451|Homo sapiens tubulin, alpha 1b protein.   100   4e-21
BC005946-1|AAH05946.1|  449|Homo sapiens tubulin, alpha 1c protein.   100   4e-21
BC004949-1|AAH04949.1|  449|Homo sapiens tubulin, alpha 1c protein.   100   4e-21
BC001128-1|AAH01128.1|  451|Homo sapiens tubulin, alpha 1b protein.   100   4e-21
BC000696-1|AAH00696.1|  451|Homo sapiens tubulin, alpha 1b protein.   100   4e-21
AK223024-1|BAD96744.1|  449|Homo sapiens tubulin alpha 6 variant...   100   4e-21
AF141347-1|AAD33871.1|  451|Homo sapiens alpha-tubulin protein.       100   4e-21
AF081484-1|AAC31959.1|  451|Homo sapiens alpha-tubulin isoform 1...   100   4e-21
DQ422808-1|ABD72607.1|  450|Homo sapiens tubulin, alpha 2 protein.     99   6e-21
BC057810-1|AAH57810.1|  450|Homo sapiens tubulin, alpha 3d protein.    99   6e-21
BC011721-1|AAH11721.1|  418|Homo sapiens tubulin, alpha 3c protein.    99   6e-21
AL139327-3|CAH73534.1|  450|Homo sapiens tubulin, alpha 3c protein.    99   6e-21
AF005392-1|AAC39578.1|  449|Homo sapiens alpha tubulin protein.        99   6e-21
X06956-1|CAA30026.1|  447|Homo sapiens alpha-tubulin protein.          98   2e-20
BT006731-1|AAP35377.1|  448|Homo sapiens tubulin, alpha 1 (testi...    98   2e-20
BC009238-1|AAH09238.1|  448|Homo sapiens tubulin, alpha 4a protein.    98   2e-20
AY895018-1|AAW65371.1|  448|Homo sapiens tubulin, alpha 1 (testi...    98   2e-20
CR456600-1|CAG30486.1|  449|Homo sapiens TUBA8 protein.                98   2e-20
BX537702-1|CAD97815.1|  479|Homo sapiens hypothetical protein pr...    98   2e-20
BC104845-1|AAI04846.1|  449|Homo sapiens tubulin, alpha 8 protein.     98   2e-20
BC074827-1|AAH74827.1|  449|Homo sapiens tubulin, alpha 8 protein.     98   2e-20
BC057811-1|AAH57811.1|  450|Homo sapiens tubulin, alpha 3e protein.    98   2e-20
AJ245922-1|CAB88036.1|  449|Homo sapiens alpha-tubulin 8 protein.      98   2e-20
BC033064-1|AAH33064.1|  325|Homo sapiens TUBA1C protein protein.       93   9e-19
BC105634-1|AAI05635.1|  446|Homo sapiens tubulin, alpha-like 3 p...    85   2e-16
BC099716-1|AAH99716.1|  446|Homo sapiens tubulin, alpha-like 3 p...    85   2e-16
BC098247-1|AAH98247.1|  406|Homo sapiens TUBAL3 protein protein.       85   2e-16
AL683826-2|CAI23625.1|  446|Homo sapiens tubulin, alpha-like 3 p...    85   2e-16
AK025318-1|BAB15110.1|  446|Homo sapiens protein ( Homo sapiens ...    85   2e-16
AL713922-3|CAI16220.1|  410|Homo sapiens novel protein similar t...    82   2e-15
BC021564-1|AAH21564.1|  335|Homo sapiens TUBA1B protein protein.       81   3e-15
M61764-1|AAA52620.1|  451|Homo sapiens gamma-tubulin protein.          78   3e-14
CR407642-1|CAG28570.1|  451|Homo sapiens TUBG1 protein.                78   3e-14
BT019931-1|AAV38734.1|  451|Homo sapiens tubulin, gamma 1 protein.     78   3e-14
BC108739-1|AAI08740.1|  451|Homo sapiens tubulin, gamma 2 protein.     78   3e-14
BC051890-1|AAH51890.1|  451|Homo sapiens tubulin, gamma 2 protein.     78   3e-14
BC009670-1|AAH09670.1|  451|Homo sapiens tubulin, gamma 2 protein.     78   3e-14
BC000619-1|AAH00619.1|  451|Homo sapiens tubulin, gamma 1 protein.     78   3e-14
AK022324-1|BAB14012.1|  451|Homo sapiens protein ( Homo sapiens ...    78   3e-14
AF225971-1|AAF34188.1|  451|Homo sapiens gamma-tubulin protein.        78   3e-14
Z99289-5|CAI42328.1|  163|Homo sapiens tubulin, epsilon 1 protein.     71   2e-12
Z99289-4|CAI42327.1|  475|Homo sapiens tubulin, epsilon 1 protein.     71   2e-12
Z99289-3|CAI42326.1|  206|Homo sapiens tubulin, epsilon 1 protein.     71   2e-12
BC025405-1|AAH25405.1|  475|Homo sapiens tubulin, epsilon 1 prot...    71   2e-12
AF201334-1|AAF09585.1|  475|Homo sapiens epsilon-tubulin protein.      71   2e-12
BC031101-1|AAH31101.1|  475|Homo sapiens tubulin, epsilon 1 prot...    71   4e-12
AY533484-1|AAS86429.1|   98|Homo sapiens tubulin alpha-1 protein.      63   6e-10
AF035316-1|AAB88188.1|  342|Homo sapiens protein ( Homo sapiens ...    60   6e-09
BC001896-1|AAH01896.1|  340|Homo sapiens TUBB protein protein.         59   1e-08
AK024002-1|BAB14767.1|  241|Homo sapiens protein ( Homo sapiens ...    58   2e-08
BC000258-1|AAH00258.1|  398|Homo sapiens TUBD1 protein protein.        58   3e-08
AF201333-1|AAF09584.1|  453|Homo sapiens delta-tubulin protein.        57   4e-08
AB031045-1|BAD83581.1|  351|Homo sapiens delta-tubulin isoform p...    57   4e-08
AB031044-1|BAD83580.1|  398|Homo sapiens delta-tubulin isoform p...    57   4e-08
AB030837-1|BAD16590.1|  453|Homo sapiens delta tubulin protein.        57   4e-08
AK024096-1|BAB14825.1|  199|Homo sapiens protein ( Homo sapiens ...    33   1.0  
X07882-1|CAA30729.1|  226|Homo sapiens Po protein protein.             31   2.3  
X07704-1|CAA30542.1|  234|Homo sapiens Po protein protein.             31   2.3  
S80916-1|AAB50687.2|  238|Homo sapiens parotid 'o' protein protein.    31   2.3  
S80905-1|AAB50686.1|  382|Homo sapiens Con1 protein.                   31   2.3  
K03208-1|AAA60189.1|  251|Homo sapiens PRB2 protein.                   31   2.3  
K03207-1|AAA60188.1|  247|Homo sapiens salivary proline-rich pro...    31   2.3  
BC130386-1|AAI30387.1|  268|Homo sapiens PRB4 protein protein.         31   2.3  
K02575-1|AAA36502.1|  173|Homo sapiens protein ( Human salivary ...    31   4.1  
X07517-1|CAA30395.2|  236|Homo sapiens salivary proline-rich pro...    29   9.5  
X07516-1|CAA30394.2|  297|Homo sapiens salivary proline-rich pro...    29   9.5  
S62941-1|AAB27289.1|  358|Homo sapiens Ps 2 protein.                   29   9.5  
S62928-1|AAB27288.2|  297|Homo sapiens PRB1M protein precursor p...    29   9.5  
S52986-1|AAA13341.2|  331|Homo sapiens basic salivary proline-ri...    29   9.5  
M97220-1|AAB05816.1|  331|Homo sapiens salivary proline-rich pro...    29   9.5  
K03206-1|AAA60187.1|  178|Homo sapiens PRB1 protein.                   29   9.5  
K03205-1|AAA60186.1|  198|Homo sapiens PRB1 protein.                   29   9.5  
K03204-1|AAA60185.1|  331|Homo sapiens PRB1 protein.                   29   9.5  
BC141917-1|AAI41918.1|  198|Homo sapiens PRB1 protein protein.         29   9.5  
BC044827-1|AAH44827.1|  338|Homo sapiens PRB2 protein protein.         29   9.5  
AK074085-1|BAB84911.1| 1887|Homo sapiens FLJ00156 protein protein.     29   9.5  
AB046827-1|BAB13433.1| 1270|Homo sapiens KIAA1607 protein protein.     29   9.5  

>X02344-1|CAA26203.1|  445|Homo sapiens beta-tubulin protein.
          Length = 445

 Score =  182 bits (444), Expect = 6e-46
 Identities = 82/87 (94%), Positives = 85/87 (97%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           INVYYNEA+GGKYVPRAV+VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY
Sbjct: 47  INVYYNEATGGKYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 106

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAELVDSVLDVVRKEAE CDCL+ F
Sbjct: 107 TEGAELVDSVLDVVRKEAESCDCLQGF 133



 Score = 93.9 bits (223), Expect = 4e-19
 Identities = 41/45 (91%), Positives = 42/45 (93%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREIVH+QAGQCGNQIGAKFWEVISDEHGID TG Y GDSDLQLE
Sbjct: 1   MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLE 45


>BX255925-3|CAM24148.1|  445|Homo sapiens tubulin, beta 2C protein.
          Length = 445

 Score =  182 bits (444), Expect = 6e-46
 Identities = 82/87 (94%), Positives = 85/87 (97%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           INVYYNEA+GGKYVPRAV+VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY
Sbjct: 47  INVYYNEATGGKYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 106

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAELVDSVLDVVRKEAE CDCL+ F
Sbjct: 107 TEGAELVDSVLDVVRKEAESCDCLQGF 133



 Score = 93.9 bits (223), Expect = 4e-19
 Identities = 41/45 (91%), Positives = 42/45 (93%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREIVH+QAGQCGNQIGAKFWEVISDEHGID TG Y GDSDLQLE
Sbjct: 1   MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLE 45


>BC071889-1|AAH71889.1|  445|Homo sapiens tubulin, beta 2C protein.
          Length = 445

 Score =  182 bits (444), Expect = 6e-46
 Identities = 82/87 (94%), Positives = 85/87 (97%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           INVYYNEA+GGKYVPRAV+VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY
Sbjct: 47  INVYYNEATGGKYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 106

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAELVDSVLDVVRKEAE CDCL+ F
Sbjct: 107 TEGAELVDSVLDVVRKEAESCDCLQGF 133



 Score = 93.9 bits (223), Expect = 4e-19
 Identities = 41/45 (91%), Positives = 42/45 (93%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREIVH+QAGQCGNQIGAKFWEVISDEHGID TG Y GDSDLQLE
Sbjct: 1   MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLE 45


>BC039175-1|AAH39175.1|  445|Homo sapiens tubulin, beta 2C protein.
          Length = 445

 Score =  182 bits (444), Expect = 6e-46
 Identities = 82/87 (94%), Positives = 85/87 (97%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           INVYYNEA+GGKYVPRAV+VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY
Sbjct: 47  INVYYNEATGGKYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 106

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAELVDSVLDVVRKEAE CDCL+ F
Sbjct: 107 TEGAELVDSVLDVVRKEAESCDCLQGF 133



 Score = 93.9 bits (223), Expect = 4e-19
 Identities = 41/45 (91%), Positives = 42/45 (93%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREIVH+QAGQCGNQIGAKFWEVISDEHGID TG Y GDSDLQLE
Sbjct: 1   MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLE 45


>BC029529-1|AAH29529.1|  445|Homo sapiens tubulin, beta 2C protein.
          Length = 445

 Score =  182 bits (444), Expect = 6e-46
 Identities = 82/87 (94%), Positives = 85/87 (97%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           INVYYNEA+GGKYVPRAV+VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY
Sbjct: 47  INVYYNEATGGKYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 106

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAELVDSVLDVVRKEAE CDCL+ F
Sbjct: 107 TEGAELVDSVLDVVRKEAESCDCLQGF 133



 Score = 93.9 bits (223), Expect = 4e-19
 Identities = 41/45 (91%), Positives = 42/45 (93%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREIVH+QAGQCGNQIGAKFWEVISDEHGID TG Y GDSDLQLE
Sbjct: 1   MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLE 45


>BC024038-1|AAH24038.1|  445|Homo sapiens tubulin, beta 2C protein.
          Length = 445

 Score =  182 bits (444), Expect = 6e-46
 Identities = 82/87 (94%), Positives = 85/87 (97%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           INVYYNEA+GGKYVPRAV+VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY
Sbjct: 47  INVYYNEATGGKYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 106

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAELVDSVLDVVRKEAE CDCL+ F
Sbjct: 107 TEGAELVDSVLDVVRKEAESCDCLQGF 133



 Score = 93.9 bits (223), Expect = 4e-19
 Identities = 41/45 (91%), Positives = 42/45 (93%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREIVH+QAGQCGNQIGAKFWEVISDEHGID TG Y GDSDLQLE
Sbjct: 1   MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLE 45


>BC019829-1|AAH19829.1|  445|Homo sapiens tubulin, beta 2C protein.
          Length = 445

 Score =  182 bits (444), Expect = 6e-46
 Identities = 82/87 (94%), Positives = 85/87 (97%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           INVYYNEA+GGKYVPRAV+VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY
Sbjct: 47  INVYYNEATGGKYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 106

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAELVDSVLDVVRKEAE CDCL+ F
Sbjct: 107 TEGAELVDSVLDVVRKEAESCDCLQGF 133



 Score = 93.9 bits (223), Expect = 4e-19
 Identities = 41/45 (91%), Positives = 42/45 (93%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREIVH+QAGQCGNQIGAKFWEVISDEHGID TG Y GDSDLQLE
Sbjct: 1   MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLE 45


>BC019359-1|AAH19359.1|  445|Homo sapiens tubulin, beta 2C protein.
          Length = 445

 Score =  182 bits (444), Expect = 6e-46
 Identities = 82/87 (94%), Positives = 85/87 (97%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           INVYYNEA+GGKYVPRAV+VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY
Sbjct: 47  INVYYNEATGGKYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 106

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAELVDSVLDVVRKEAE CDCL+ F
Sbjct: 107 TEGAELVDSVLDVVRKEAESCDCLQGF 133



 Score = 93.9 bits (223), Expect = 4e-19
 Identities = 41/45 (91%), Positives = 42/45 (93%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREIVH+QAGQCGNQIGAKFWEVISDEHGID TG Y GDSDLQLE
Sbjct: 1   MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLE 45


>BC012835-1|AAH12835.1|  445|Homo sapiens tubulin, beta 2C protein.
          Length = 445

 Score =  182 bits (444), Expect = 6e-46
 Identities = 82/87 (94%), Positives = 85/87 (97%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           INVYYNEA+GGKYVPRAV+VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY
Sbjct: 47  INVYYNEATGGKYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 106

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAELVDSVLDVVRKEAE CDCL+ F
Sbjct: 107 TEGAELVDSVLDVVRKEAESCDCLQGF 133



 Score = 93.9 bits (223), Expect = 4e-19
 Identities = 41/45 (91%), Positives = 42/45 (93%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREIVH+QAGQCGNQIGAKFWEVISDEHGID TG Y GDSDLQLE
Sbjct: 1   MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLE 45


>BC007889-1|AAH07889.1|  445|Homo sapiens tubulin, beta 2C protein.
          Length = 445

 Score =  182 bits (444), Expect = 6e-46
 Identities = 82/87 (94%), Positives = 85/87 (97%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           INVYYNEA+GGKYVPRAV+VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY
Sbjct: 47  INVYYNEATGGKYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 106

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAELVDSVLDVVRKEAE CDCL+ F
Sbjct: 107 TEGAELVDSVLDVVRKEAESCDCLQGF 133



 Score = 93.9 bits (223), Expect = 4e-19
 Identities = 41/45 (91%), Positives = 42/45 (93%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREIVH+QAGQCGNQIGAKFWEVISDEHGID TG Y GDSDLQLE
Sbjct: 1   MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLE 45


>BC004188-1|AAH04188.1|  445|Homo sapiens tubulin, beta 2C protein.
          Length = 445

 Score =  182 bits (444), Expect = 6e-46
 Identities = 82/87 (94%), Positives = 85/87 (97%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           INVYYNEA+GGKYVPRAV+VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY
Sbjct: 47  INVYYNEATGGKYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 106

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAELVDSVLDVVRKEAE CDCL+ F
Sbjct: 107 TEGAELVDSVLDVVRKEAESCDCLQGF 133



 Score = 93.9 bits (223), Expect = 4e-19
 Identities = 41/45 (91%), Positives = 42/45 (93%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREIVH+QAGQCGNQIGAKFWEVISDEHGID TG Y GDSDLQLE
Sbjct: 1   MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLE 45


>BC002885-1|AAH02885.1|  445|Homo sapiens tubulin, beta 2C protein.
          Length = 445

 Score =  182 bits (444), Expect = 6e-46
 Identities = 82/87 (94%), Positives = 85/87 (97%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           INVYYNEA+GGKYVPRAV+VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY
Sbjct: 47  INVYYNEATGGKYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 106

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAELVDSVLDVVRKEAE CDCL+ F
Sbjct: 107 TEGAELVDSVLDVVRKEAESCDCLQGF 133



 Score = 93.9 bits (223), Expect = 4e-19
 Identities = 41/45 (91%), Positives = 42/45 (93%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREIVH+QAGQCGNQIGAKFWEVISDEHGID TG Y GDSDLQLE
Sbjct: 1   MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLE 45


>BC002783-1|AAH02783.1|  445|Homo sapiens tubulin, beta 2C protein.
          Length = 445

 Score =  182 bits (444), Expect = 6e-46
 Identities = 82/87 (94%), Positives = 85/87 (97%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           INVYYNEA+GGKYVPRAV+VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY
Sbjct: 47  INVYYNEATGGKYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 106

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAELVDSVLDVVRKEAE CDCL+ F
Sbjct: 107 TEGAELVDSVLDVVRKEAESCDCLQGF 133



 Score = 93.9 bits (223), Expect = 4e-19
 Identities = 41/45 (91%), Positives = 42/45 (93%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREIVH+QAGQCGNQIGAKFWEVISDEHGID TG Y GDSDLQLE
Sbjct: 1   MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLE 45


>BC001911-1|AAH01911.1|  445|Homo sapiens tubulin, beta 2C protein.
          Length = 445

 Score =  182 bits (444), Expect = 6e-46
 Identities = 82/87 (94%), Positives = 85/87 (97%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           INVYYNEA+GGKYVPRAV+VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY
Sbjct: 47  INVYYNEATGGKYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 106

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAELVDSVLDVVRKEAE CDCL+ F
Sbjct: 107 TEGAELVDSVLDVVRKEAESCDCLQGF 133



 Score = 93.9 bits (223), Expect = 4e-19
 Identities = 41/45 (91%), Positives = 42/45 (93%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREIVH+QAGQCGNQIGAKFWEVISDEHGID TG Y GDSDLQLE
Sbjct: 1   MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLE 45


>AY167990-1|AAN87335.1|  445|Homo sapiens class IVb beta tubulin
           protein.
          Length = 445

 Score =  182 bits (444), Expect = 6e-46
 Identities = 82/87 (94%), Positives = 85/87 (97%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           INVYYNEA+GGKYVPRAV+VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY
Sbjct: 47  INVYYNEATGGKYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 106

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAELVDSVLDVVRKEAE CDCL+ F
Sbjct: 107 TEGAELVDSVLDVVRKEAESCDCLQGF 133



 Score = 93.9 bits (223), Expect = 4e-19
 Identities = 41/45 (91%), Positives = 42/45 (93%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREIVH+QAGQCGNQIGAKFWEVISDEHGID TG Y GDSDLQLE
Sbjct: 1   MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLE 45


>V00599-1|CAA23844.1|  437|Homo sapiens protein ( Human mRNA
           fragment encoding beta-tubulin. (from clone D-beta-1).
           ).
          Length = 437

 Score =  180 bits (438), Expect = 3e-45
 Identities = 80/87 (91%), Positives = 85/87 (97%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           I+VYYNEA+GGKYVPRA++VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY
Sbjct: 40  ISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 99

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAELVDSVLDVVRKEAE CDCL+ F
Sbjct: 100 TEGAELVDSVLDVVRKEAESCDCLQGF 126



 Score = 79.4 bits (187), Expect = 9e-15
 Identities = 34/38 (89%), Positives = 35/38 (92%)
 Frame = +3

Query: 141 QAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           QAGQCGNQIGAKFWEVISDEHGID TG Y GDSDLQL+
Sbjct: 1   QAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLD 38


>J00314-1|AAB59507.1|  444|Homo sapiens protein ( Human beta-tubulin
           gene, clone m40. ).
          Length = 444

 Score =  180 bits (438), Expect = 3e-45
 Identities = 80/87 (91%), Positives = 85/87 (97%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           I+VYYNEA+GGKYVPRA++VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY
Sbjct: 47  ISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 106

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAELVDSVLDVVRKEAE CDCL+ F
Sbjct: 107 TEGAELVDSVLDVVRKEAESCDCLQGF 133



 Score = 93.5 bits (222), Expect = 5e-19
 Identities = 41/45 (91%), Positives = 42/45 (93%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREIVHIQAGQCGNQIGAKFWEVISDEHGID TG Y GDSDLQL+
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLD 45


>BX248307-7|CAM25934.1|  426|Homo sapiens tubulin beta polypeptide
           protein.
          Length = 426

 Score =  180 bits (438), Expect = 3e-45
 Identities = 80/87 (91%), Positives = 85/87 (97%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           I+VYYNEA+GGKYVPRA++VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY
Sbjct: 29  ISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 88

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAELVDSVLDVVRKEAE CDCL+ F
Sbjct: 89  TEGAELVDSVLDVVRKEAESCDCLQGF 115



 Score = 53.2 bits (122), Expect = 7e-07
 Identities = 22/26 (84%), Positives = 23/26 (88%)
 Frame = +3

Query: 177 FWEVISDEHGIDATGAYSGDSDLQLE 254
           FWEVISDEHGID TG Y GDSDLQL+
Sbjct: 2   FWEVISDEHGIDPTGTYHGDSDLQLD 27


>BX248307-6|CAM25933.1|  444|Homo sapiens tubulin beta polypeptide
           protein.
          Length = 444

 Score =  180 bits (438), Expect = 3e-45
 Identities = 80/87 (91%), Positives = 85/87 (97%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           I+VYYNEA+GGKYVPRA++VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY
Sbjct: 47  ISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 106

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAELVDSVLDVVRKEAE CDCL+ F
Sbjct: 107 TEGAELVDSVLDVVRKEAESCDCLQGF 133



 Score = 93.5 bits (222), Expect = 5e-19
 Identities = 41/45 (91%), Positives = 42/45 (93%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREIVHIQAGQCGNQIGAKFWEVISDEHGID TG Y GDSDLQL+
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLD 45


>BC103746-1|AAI03747.1|  444|Homo sapiens tubulin, beta protein.
          Length = 444

 Score =  180 bits (438), Expect = 3e-45
 Identities = 80/87 (91%), Positives = 85/87 (97%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           I+VYYNEA+GGKYVPRA++VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY
Sbjct: 47  ISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 106

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAELVDSVLDVVRKEAE CDCL+ F
Sbjct: 107 TEGAELVDSVLDVVRKEAESCDCLQGF 133



 Score = 93.5 bits (222), Expect = 5e-19
 Identities = 41/45 (91%), Positives = 42/45 (93%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREIVHIQAGQCGNQIGAKFWEVISDEHGID TG Y GDSDLQL+
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLD 45


>BC070326-1|AAH70326.1|  444|Homo sapiens tubulin, beta protein.
          Length = 444

 Score =  180 bits (438), Expect = 3e-45
 Identities = 80/87 (91%), Positives = 85/87 (97%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           I+VYYNEA+GGKYVPRA++VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY
Sbjct: 47  ISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 106

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAELVDSVLDVVRKEAE CDCL+ F
Sbjct: 107 TEGAELVDSVLDVVRKEAESCDCLQGF 133



 Score = 93.5 bits (222), Expect = 5e-19
 Identities = 41/45 (91%), Positives = 42/45 (93%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREIVHIQAGQCGNQIGAKFWEVISDEHGID TG Y GDSDLQL+
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLD 45


>BC021909-1|AAH21909.1|  444|Homo sapiens tubulin, beta protein.
          Length = 444

 Score =  180 bits (438), Expect = 3e-45
 Identities = 80/87 (91%), Positives = 85/87 (97%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           I+VYYNEA+GGKYVPRA++VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY
Sbjct: 47  ISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 106

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAELVDSVLDVVRKEAE CDCL+ F
Sbjct: 107 TEGAELVDSVLDVVRKEAESCDCLQGF 133



 Score = 93.5 bits (222), Expect = 5e-19
 Identities = 41/45 (91%), Positives = 42/45 (93%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREIVHIQAGQCGNQIGAKFWEVISDEHGID TG Y GDSDLQL+
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLD 45


>BC020946-1|AAH20946.1|  444|Homo sapiens tubulin, beta protein.
          Length = 444

 Score =  180 bits (438), Expect = 3e-45
 Identities = 80/87 (91%), Positives = 85/87 (97%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           I+VYYNEA+GGKYVPRA++VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY
Sbjct: 47  ISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 106

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAELVDSVLDVVRKEAE CDCL+ F
Sbjct: 107 TEGAELVDSVLDVVRKEAESCDCLQGF 133



 Score = 93.5 bits (222), Expect = 5e-19
 Identities = 41/45 (91%), Positives = 42/45 (93%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREIVHIQAGQCGNQIGAKFWEVISDEHGID TG Y GDSDLQL+
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLD 45


>BC019924-1|AAH19924.1|  444|Homo sapiens tubulin, beta protein.
          Length = 444

 Score =  180 bits (438), Expect = 3e-45
 Identities = 80/87 (91%), Positives = 85/87 (97%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           I+VYYNEA+GGKYVPRA++VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY
Sbjct: 47  ISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 106

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAELVDSVLDVVRKEAE CDCL+ F
Sbjct: 107 TEGAELVDSVLDVVRKEAESCDCLQGF 133



 Score = 93.5 bits (222), Expect = 5e-19
 Identities = 41/45 (91%), Positives = 42/45 (93%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREIVHIQAGQCGNQIGAKFWEVISDEHGID TG Y GDSDLQL+
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLD 45


>BC013374-1|AAH13374.1|  444|Homo sapiens tubulin, beta protein.
          Length = 444

 Score =  180 bits (438), Expect = 3e-45
 Identities = 80/87 (91%), Positives = 85/87 (97%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           I+VYYNEA+GGKYVPRA++VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY
Sbjct: 47  ISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 106

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAELVDSVLDVVRKEAE CDCL+ F
Sbjct: 107 TEGAELVDSVLDVVRKEAESCDCLQGF 133



 Score = 93.5 bits (222), Expect = 5e-19
 Identities = 41/45 (91%), Positives = 42/45 (93%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREIVHIQAGQCGNQIGAKFWEVISDEHGID TG Y GDSDLQL+
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLD 45


>BC007605-1|AAH07605.1|  444|Homo sapiens tubulin, beta protein.
          Length = 444

 Score =  180 bits (438), Expect = 3e-45
 Identities = 80/87 (91%), Positives = 85/87 (97%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           I+VYYNEA+GGKYVPRA++VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY
Sbjct: 47  ISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 106

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAELVDSVLDVVRKEAE CDCL+ F
Sbjct: 107 TEGAELVDSVLDVVRKEAESCDCLQGF 133



 Score = 93.5 bits (222), Expect = 5e-19
 Identities = 41/45 (91%), Positives = 42/45 (93%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREIVHIQAGQCGNQIGAKFWEVISDEHGID TG Y GDSDLQL+
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLD 45


>BC005838-1|AAH05838.1|  444|Homo sapiens tubulin, beta protein.
          Length = 444

 Score =  180 bits (438), Expect = 3e-45
 Identities = 80/87 (91%), Positives = 85/87 (97%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           I+VYYNEA+GGKYVPRA++VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY
Sbjct: 47  ISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 106

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAELVDSVLDVVRKEAE CDCL+ F
Sbjct: 107 TEGAELVDSVLDVVRKEAESCDCLQGF 133



 Score = 93.5 bits (222), Expect = 5e-19
 Identities = 41/45 (91%), Positives = 42/45 (93%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREIVHIQAGQCGNQIGAKFWEVISDEHGID TG Y GDSDLQL+
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLD 45


>BC002347-1|AAH02347.1|  444|Homo sapiens tubulin, beta protein.
          Length = 444

 Score =  180 bits (438), Expect = 3e-45
 Identities = 80/87 (91%), Positives = 85/87 (97%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           I+VYYNEA+GGKYVPRA++VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY
Sbjct: 47  ISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 106

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAELVDSVLDVVRKEAE CDCL+ F
Sbjct: 107 TEGAELVDSVLDVVRKEAESCDCLQGF 133



 Score = 93.5 bits (222), Expect = 5e-19
 Identities = 41/45 (91%), Positives = 42/45 (93%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREIVHIQAGQCGNQIGAKFWEVISDEHGID TG Y GDSDLQL+
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLD 45


>BC001938-1|AAH01938.1|  444|Homo sapiens tubulin, beta protein.
          Length = 444

 Score =  180 bits (438), Expect = 3e-45
 Identities = 80/87 (91%), Positives = 85/87 (97%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           I+VYYNEA+GGKYVPRA++VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY
Sbjct: 47  ISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 106

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAELVDSVLDVVRKEAE CDCL+ F
Sbjct: 107 TEGAELVDSVLDVVRKEAESCDCLQGF 133



 Score = 93.5 bits (222), Expect = 5e-19
 Identities = 41/45 (91%), Positives = 42/45 (93%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREIVHIQAGQCGNQIGAKFWEVISDEHGID TG Y GDSDLQL+
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLD 45


>BA000025-69|BAB63321.1|  444|Homo sapiens Beta-tubulin protein.
          Length = 444

 Score =  180 bits (438), Expect = 3e-45
 Identities = 80/87 (91%), Positives = 85/87 (97%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           I+VYYNEA+GGKYVPRA++VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY
Sbjct: 47  ISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 106

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAELVDSVLDVVRKEAE CDCL+ F
Sbjct: 107 TEGAELVDSVLDVVRKEAESCDCLQGF 133



 Score = 93.5 bits (222), Expect = 5e-19
 Identities = 41/45 (91%), Positives = 42/45 (93%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREIVHIQAGQCGNQIGAKFWEVISDEHGID TG Y GDSDLQL+
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLD 45


>AL845353-24|CAI41893.1|  426|Homo sapiens tubulin, beta polypeptide
           protein.
          Length = 426

 Score =  180 bits (438), Expect = 3e-45
 Identities = 80/87 (91%), Positives = 85/87 (97%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           I+VYYNEA+GGKYVPRA++VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY
Sbjct: 29  ISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 88

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAELVDSVLDVVRKEAE CDCL+ F
Sbjct: 89  TEGAELVDSVLDVVRKEAESCDCLQGF 115



 Score = 53.2 bits (122), Expect = 7e-07
 Identities = 22/26 (84%), Positives = 23/26 (88%)
 Frame = +3

Query: 177 FWEVISDEHGIDATGAYSGDSDLQLE 254
           FWEVISDEHGID TG Y GDSDLQL+
Sbjct: 2   FWEVISDEHGIDPTGTYHGDSDLQLD 27


>AL845353-23|CAI41892.1|  444|Homo sapiens tubulin, beta polypeptide
           protein.
          Length = 444

 Score =  180 bits (438), Expect = 3e-45
 Identities = 80/87 (91%), Positives = 85/87 (97%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           I+VYYNEA+GGKYVPRA++VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY
Sbjct: 47  ISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 106

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAELVDSVLDVVRKEAE CDCL+ F
Sbjct: 107 TEGAELVDSVLDVVRKEAESCDCLQGF 133



 Score = 93.5 bits (222), Expect = 5e-19
 Identities = 41/45 (91%), Positives = 42/45 (93%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREIVHIQAGQCGNQIGAKFWEVISDEHGID TG Y GDSDLQL+
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLD 45


>AL662848-8|CAM24851.1|  426|Homo sapiens tubulin, beta protein.
          Length = 426

 Score =  180 bits (438), Expect = 3e-45
 Identities = 80/87 (91%), Positives = 85/87 (97%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           I+VYYNEA+GGKYVPRA++VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY
Sbjct: 29  ISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 88

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAELVDSVLDVVRKEAE CDCL+ F
Sbjct: 89  TEGAELVDSVLDVVRKEAESCDCLQGF 115



 Score = 53.2 bits (122), Expect = 7e-07
 Identities = 22/26 (84%), Positives = 23/26 (88%)
 Frame = +3

Query: 177 FWEVISDEHGIDATGAYSGDSDLQLE 254
           FWEVISDEHGID TG Y GDSDLQL+
Sbjct: 2   FWEVISDEHGIDPTGTYHGDSDLQLD 27


>AL662848-7|CAI17441.1|  444|Homo sapiens tubulin, beta protein.
          Length = 444

 Score =  180 bits (438), Expect = 3e-45
 Identities = 80/87 (91%), Positives = 85/87 (97%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           I+VYYNEA+GGKYVPRA++VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY
Sbjct: 47  ISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 106

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAELVDSVLDVVRKEAE CDCL+ F
Sbjct: 107 TEGAELVDSVLDVVRKEAESCDCLQGF 133



 Score = 93.5 bits (222), Expect = 5e-19
 Identities = 41/45 (91%), Positives = 42/45 (93%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREIVHIQAGQCGNQIGAKFWEVISDEHGID TG Y GDSDLQL+
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLD 45


>AL662797-12|CAM25516.1|  426|Homo sapiens tubulin, beta protein.
          Length = 426

 Score =  180 bits (438), Expect = 3e-45
 Identities = 80/87 (91%), Positives = 85/87 (97%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           I+VYYNEA+GGKYVPRA++VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY
Sbjct: 29  ISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 88

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAELVDSVLDVVRKEAE CDCL+ F
Sbjct: 89  TEGAELVDSVLDVVRKEAESCDCLQGF 115



 Score = 53.2 bits (122), Expect = 7e-07
 Identities = 22/26 (84%), Positives = 23/26 (88%)
 Frame = +3

Query: 177 FWEVISDEHGIDATGAYSGDSDLQLE 254
           FWEVISDEHGID TG Y GDSDLQL+
Sbjct: 2   FWEVISDEHGIDPTGTYHGDSDLQLD 27


>AL662797-11|CAI18196.1|  444|Homo sapiens tubulin, beta protein.
          Length = 444

 Score =  180 bits (438), Expect = 3e-45
 Identities = 80/87 (91%), Positives = 85/87 (97%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           I+VYYNEA+GGKYVPRA++VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY
Sbjct: 47  ISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 106

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAELVDSVLDVVRKEAE CDCL+ F
Sbjct: 107 TEGAELVDSVLDVVRKEAESCDCLQGF 133



 Score = 93.5 bits (222), Expect = 5e-19
 Identities = 41/45 (91%), Positives = 42/45 (93%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREIVHIQAGQCGNQIGAKFWEVISDEHGID TG Y GDSDLQL+
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLD 45


>AF141349-1|AAD33873.1|  444|Homo sapiens beta-tubulin protein.
          Length = 444

 Score =  180 bits (438), Expect = 3e-45
 Identities = 80/87 (91%), Positives = 85/87 (97%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           I+VYYNEA+GGKYVPRA++VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY
Sbjct: 47  ISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 106

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAELVDSVLDVVRKEAE CDCL+ F
Sbjct: 107 TEGAELVDSVLDVVRKEAESCDCLQGF 133



 Score = 93.5 bits (222), Expect = 5e-19
 Identities = 41/45 (91%), Positives = 42/45 (93%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREIVHIQAGQCGNQIGAKFWEVISDEHGID TG Y GDSDLQL+
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLD 45


>AF070600-1|AAC28654.1|  444|Homo sapiens beta-tubulin protein.
          Length = 444

 Score =  180 bits (438), Expect = 3e-45
 Identities = 80/87 (91%), Positives = 85/87 (97%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           I+VYYNEA+GGKYVPRA++VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY
Sbjct: 47  ISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 106

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAELVDSVLDVVRKEAE CDCL+ F
Sbjct: 107 TEGAELVDSVLDVVRKEAESCDCLQGF 133



 Score = 93.5 bits (222), Expect = 5e-19
 Identities = 41/45 (91%), Positives = 42/45 (93%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREIVHIQAGQCGNQIGAKFWEVISDEHGID TG Y GDSDLQL+
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLD 45


>AF070593-1|AAC28650.1|  444|Homo sapiens beta-tubulin protein.
          Length = 444

 Score =  180 bits (438), Expect = 3e-45
 Identities = 80/87 (91%), Positives = 85/87 (97%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           I+VYYNEA+GGKYVPRA++VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY
Sbjct: 47  ISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 106

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAELVDSVLDVVRKEAE CDCL+ F
Sbjct: 107 TEGAELVDSVLDVVRKEAESCDCLQGF 133



 Score = 93.5 bits (222), Expect = 5e-19
 Identities = 41/45 (91%), Positives = 42/45 (93%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREIVHIQAGQCGNQIGAKFWEVISDEHGID TG Y GDSDLQL+
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLD 45


>AF070561-1|AAC28642.1|  444|Homo sapiens beta-tubulin protein.
          Length = 444

 Score =  180 bits (438), Expect = 3e-45
 Identities = 80/87 (91%), Positives = 85/87 (97%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           I+VYYNEA+GGKYVPRA++VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY
Sbjct: 47  ISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 106

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAELVDSVLDVVRKEAE CDCL+ F
Sbjct: 107 TEGAELVDSVLDVVRKEAESCDCLQGF 133



 Score = 93.5 bits (222), Expect = 5e-19
 Identities = 41/45 (91%), Positives = 42/45 (93%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREIVHIQAGQCGNQIGAKFWEVISDEHGID TG Y GDSDLQL+
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLD 45


>AB202098-1|BAE78618.1|  444|Homo sapiens beta 5-tubulin protein.
          Length = 444

 Score =  180 bits (438), Expect = 3e-45
 Identities = 80/87 (91%), Positives = 85/87 (97%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           I+VYYNEA+GGKYVPRA++VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY
Sbjct: 47  ISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 106

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAELVDSVLDVVRKEAE CDCL+ F
Sbjct: 107 TEGAELVDSVLDVVRKEAESCDCLQGF 133



 Score = 93.5 bits (222), Expect = 5e-19
 Identities = 41/45 (91%), Positives = 42/45 (93%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREIVHIQAGQCGNQIGAKFWEVISDEHGID TG Y GDSDLQL+
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLD 45


>AB103606-1|BAF31267.1|  444|Homo sapiens beta-tubulin protein
           protein.
          Length = 444

 Score =  180 bits (438), Expect = 3e-45
 Identities = 80/87 (91%), Positives = 85/87 (97%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           I+VYYNEA+GGKYVPRA++VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY
Sbjct: 47  ISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 106

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAELVDSVLDVVRKEAE CDCL+ F
Sbjct: 107 TEGAELVDSVLDVVRKEAESCDCLQGF 133



 Score = 93.5 bits (222), Expect = 5e-19
 Identities = 41/45 (91%), Positives = 42/45 (93%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREIVHIQAGQCGNQIGAKFWEVISDEHGID TG Y GDSDLQL+
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLD 45


>AB088100-1|BAC54932.1|  444|Homo sapiens tubulin, beta polypeptide
           protein.
          Length = 444

 Score =  180 bits (438), Expect = 3e-45
 Identities = 80/87 (91%), Positives = 85/87 (97%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           I+VYYNEA+GGKYVPRA++VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY
Sbjct: 47  ISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 106

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAELVDSVLDVVRKEAE CDCL+ F
Sbjct: 107 TEGAELVDSVLDVVRKEAESCDCLQGF 133



 Score = 93.5 bits (222), Expect = 5e-19
 Identities = 41/45 (91%), Positives = 42/45 (93%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREIVHIQAGQCGNQIGAKFWEVISDEHGID TG Y GDSDLQL+
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLD 45


>AB062393-1|BAB93480.1|  444|Homo sapiens beta 5-tubulin protein.
          Length = 444

 Score =  180 bits (438), Expect = 3e-45
 Identities = 80/87 (91%), Positives = 85/87 (97%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           I+VYYNEA+GGKYVPRA++VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY
Sbjct: 47  ISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 106

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAELVDSVLDVVRKEAE CDCL+ F
Sbjct: 107 TEGAELVDSVLDVVRKEAESCDCLQGF 133



 Score = 93.5 bits (222), Expect = 5e-19
 Identities = 41/45 (91%), Positives = 42/45 (93%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREIVHIQAGQCGNQIGAKFWEVISDEHGID TG Y GDSDLQL+
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLD 45


>X00734-1|CAA25318.1|  444|Homo sapiens tubulin 5-beta protein.
          Length = 444

 Score =  179 bits (436), Expect = 6e-45
 Identities = 80/87 (91%), Positives = 84/87 (96%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           INVYYNEA+GG YVPRAV+VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY
Sbjct: 47  INVYYNEATGGNYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 106

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAELVD+VLDVVRKEAE CDCL+ F
Sbjct: 107 TEGAELVDAVLDVVRKEAESCDCLQGF 133



 Score = 93.9 bits (223), Expect = 4e-19
 Identities = 41/45 (91%), Positives = 42/45 (93%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREIVH+QAGQCGNQIGAKFWEVISDEHGID TG Y GDSDLQLE
Sbjct: 1   MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLE 45


>BC013683-1|AAH13683.1|  444|Homo sapiens tubulin, beta 4 protein.
          Length = 444

 Score =  179 bits (436), Expect = 6e-45
 Identities = 80/87 (91%), Positives = 84/87 (96%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           INVYYNEA+GG YVPRAV+VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY
Sbjct: 47  INVYYNEATGGNYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 106

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAELVD+VLDVVRKEAE CDCL+ F
Sbjct: 107 TEGAELVDAVLDVVRKEAESCDCLQGF 133



 Score = 93.9 bits (223), Expect = 4e-19
 Identities = 41/45 (91%), Positives = 42/45 (93%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREIVH+QAGQCGNQIGAKFWEVISDEHGID TG Y GDSDLQLE
Sbjct: 1   MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLE 45


>BC006570-1|AAH06570.1|  444|Homo sapiens TUBB4 protein protein.
          Length = 444

 Score =  179 bits (436), Expect = 6e-45
 Identities = 80/87 (91%), Positives = 84/87 (96%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           INVYYNEA+GG YVPRAV+VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY
Sbjct: 47  INVYYNEATGGNYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 106

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAELVD+VLDVVRKEAE CDCL+ F
Sbjct: 107 TEGAELVDAVLDVVRKEAESCDCLQGF 133



 Score = 93.9 bits (223), Expect = 4e-19
 Identities = 41/45 (91%), Positives = 42/45 (93%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREIVH+QAGQCGNQIGAKFWEVISDEHGID TG Y GDSDLQLE
Sbjct: 1   MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLE 45


>X79535-1|CAA56071.1|  445|Homo sapiens beta tubulin protein.
          Length = 445

 Score =  178 bits (434), Expect = 1e-44
 Identities = 79/87 (90%), Positives = 84/87 (96%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           INVYYNEA+G KYVPRA++VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY
Sbjct: 47  INVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 106

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAELVDSVLDVVRKE+E CDCL+ F
Sbjct: 107 TEGAELVDSVLDVVRKESESCDCLQGF 133



 Score = 95.1 bits (226), Expect = 2e-19
 Identities = 42/45 (93%), Positives = 43/45 (95%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREIVHIQAGQCGNQIGAKFWEVISDEHGID TG+Y GDSDLQLE
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLE 45


>CR541958-1|CAG46756.1|  445|Homo sapiens TUBB protein.
          Length = 445

 Score =  178 bits (434), Expect = 1e-44
 Identities = 79/87 (90%), Positives = 84/87 (96%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           INVYYNEA+G KYVPRA++VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY
Sbjct: 47  INVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 106

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAELVDSVLDVVRKE+E CDCL+ F
Sbjct: 107 TEGAELVDSVLDVVRKESESCDCLQGF 133



 Score = 95.1 bits (226), Expect = 2e-19
 Identities = 42/45 (93%), Positives = 43/45 (95%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREIVHIQAGQCGNQIGAKFWEVISDEHGID TG+Y GDSDLQLE
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLE 45


>CR456788-1|CAG33069.1|  445|Homo sapiens MGC8685 protein.
          Length = 445

 Score =  178 bits (434), Expect = 1e-44
 Identities = 79/87 (90%), Positives = 84/87 (96%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           INVYYNEA+G KYVPRA++VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY
Sbjct: 47  INVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 106

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAELVDSVLDVVRKE+E CDCL+ F
Sbjct: 107 TEGAELVDSVLDVVRKESESCDCLQGF 133



 Score = 95.1 bits (226), Expect = 2e-19
 Identities = 42/45 (93%), Positives = 43/45 (95%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREIVHIQAGQCGNQIGAKFWEVISDEHGID TG+Y GDSDLQLE
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLE 45


>BT019930-1|AAV38733.1|  445|Homo sapiens tubulin, beta polypeptide
           paralog protein.
          Length = 445

 Score =  178 bits (434), Expect = 1e-44
 Identities = 79/87 (90%), Positives = 84/87 (96%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           INVYYNEA+G KYVPRA++VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY
Sbjct: 47  INVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 106

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAELVDSVLDVVRKE+E CDCL+ F
Sbjct: 107 TEGAELVDSVLDVVRKESESCDCLQGF 133



 Score = 95.1 bits (226), Expect = 2e-19
 Identities = 42/45 (93%), Positives = 43/45 (95%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREIVHIQAGQCGNQIGAKFWEVISDEHGID TG+Y GDSDLQLE
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLE 45


>BC141925-1|AAI41926.1|  253|Homo sapiens TUBB2A protein protein.
          Length = 253

 Score =  178 bits (434), Expect = 1e-44
 Identities = 79/87 (90%), Positives = 84/87 (96%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           INVYYNEA+G KYVPRA++VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY
Sbjct: 40  INVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 99

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAELVDSVLDVVRKE+E CDCL+ F
Sbjct: 100 TEGAELVDSVLDVVRKESESCDCLQGF 126



 Score = 55.2 bits (127), Expect = 2e-07
 Identities = 23/27 (85%), Positives = 25/27 (92%)
 Frame = +3

Query: 174 KFWEVISDEHGIDATGAYSGDSDLQLE 254
           +FWEVISDEHGID TG+Y GDSDLQLE
Sbjct: 12  QFWEVISDEHGIDPTGSYHGDSDLQLE 38


>BC141924-1|AAI41925.1|  253|Homo sapiens TUBB2A protein protein.
          Length = 253

 Score =  178 bits (434), Expect = 1e-44
 Identities = 79/87 (90%), Positives = 84/87 (96%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           INVYYNEA+G KYVPRA++VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY
Sbjct: 40  INVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 99

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAELVDSVLDVVRKE+E CDCL+ F
Sbjct: 100 TEGAELVDSVLDVVRKESESCDCLQGF 126



 Score = 55.2 bits (127), Expect = 2e-07
 Identities = 23/27 (85%), Positives = 25/27 (92%)
 Frame = +3

Query: 174 KFWEVISDEHGIDATGAYSGDSDLQLE 254
           +FWEVISDEHGID TG+Y GDSDLQLE
Sbjct: 12  QFWEVISDEHGIDPTGSYHGDSDLQLE 38


>BC063610-1|AAH63610.1|  445|Homo sapiens tubulin, beta 2B protein.
          Length = 445

 Score =  178 bits (434), Expect = 1e-44
 Identities = 79/87 (90%), Positives = 84/87 (96%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           INVYYNEA+G KYVPRA++VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY
Sbjct: 47  INVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 106

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAELVDSVLDVVRKE+E CDCL+ F
Sbjct: 107 TEGAELVDSVLDVVRKESESCDCLQGF 133



 Score = 95.1 bits (226), Expect = 2e-19
 Identities = 42/45 (93%), Positives = 43/45 (95%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREIVHIQAGQCGNQIGAKFWEVISDEHGID TG+Y GDSDLQLE
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLE 45


>BC018780-1|AAH18780.1|  445|Homo sapiens tubulin, beta 2A protein.
          Length = 445

 Score =  178 bits (434), Expect = 1e-44
 Identities = 79/87 (90%), Positives = 84/87 (96%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           INVYYNEA+G KYVPRA++VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY
Sbjct: 47  INVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 106

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAELVDSVLDVVRKE+E CDCL+ F
Sbjct: 107 TEGAELVDSVLDVVRKESESCDCLQGF 133



 Score = 95.1 bits (226), Expect = 2e-19
 Identities = 42/45 (93%), Positives = 43/45 (95%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREIVHIQAGQCGNQIGAKFWEVISDEHGID TG+Y GDSDLQLE
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLE 45


>BC001352-1|AAH01352.1|  445|Homo sapiens tubulin, beta 2B protein.
          Length = 445

 Score =  178 bits (434), Expect = 1e-44
 Identities = 79/87 (90%), Positives = 84/87 (96%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           INVYYNEA+G KYVPRA++VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY
Sbjct: 47  INVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 106

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAELVDSVLDVVRKE+E CDCL+ F
Sbjct: 107 TEGAELVDSVLDVVRKESESCDCLQGF 133



 Score = 95.1 bits (226), Expect = 2e-19
 Identities = 42/45 (93%), Positives = 43/45 (95%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREIVHIQAGQCGNQIGAKFWEVISDEHGID TG+Y GDSDLQLE
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLE 45


>BC001194-1|AAH01194.1|  445|Homo sapiens tubulin, beta 2A protein.
          Length = 445

 Score =  178 bits (434), Expect = 1e-44
 Identities = 79/87 (90%), Positives = 84/87 (96%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           INVYYNEA+G KYVPRA++VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY
Sbjct: 47  INVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 106

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAELVDSVLDVVRKE+E CDCL+ F
Sbjct: 107 TEGAELVDSVLDVVRKESESCDCLQGF 133



 Score = 95.1 bits (226), Expect = 2e-19
 Identities = 42/45 (93%), Positives = 43/45 (95%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREIVHIQAGQCGNQIGAKFWEVISDEHGID TG+Y GDSDLQLE
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLE 45


>AY159127-1|AAN85571.1|  445|Homo sapiens class II beta tubulin
           isotype protein.
          Length = 445

 Score =  178 bits (434), Expect = 1e-44
 Identities = 79/87 (90%), Positives = 84/87 (96%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           INVYYNEA+G KYVPRA++VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY
Sbjct: 47  INVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 106

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAELVDSVLDVVRKE+E CDCL+ F
Sbjct: 107 TEGAELVDSVLDVVRKESESCDCLQGF 133



 Score = 95.1 bits (226), Expect = 2e-19
 Identities = 42/45 (93%), Positives = 43/45 (95%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREIVHIQAGQCGNQIGAKFWEVISDEHGID TG+Y GDSDLQLE
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLE 45


>AL445309-1|CAI40952.1|  445|Homo sapiens RP11-506K6.1 protein.
          Length = 445

 Score =  178 bits (434), Expect = 1e-44
 Identities = 79/87 (90%), Positives = 84/87 (96%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           INVYYNEA+G KYVPRA++VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY
Sbjct: 47  INVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 106

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAELVDSVLDVVRKE+E CDCL+ F
Sbjct: 107 TEGAELVDSVLDVVRKESESCDCLQGF 133



 Score = 95.1 bits (226), Expect = 2e-19
 Identities = 42/45 (93%), Positives = 43/45 (95%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREIVHIQAGQCGNQIGAKFWEVISDEHGID TG+Y GDSDLQLE
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLE 45


>AL031963-6|CAD70628.1|  445|Homo sapiens protein ( Human DNA
           sequence from clone RP1-40E16 on chromosome 6p24.1-25.3 
           Contains the gene for a novel protein similar to D.
           melanogaster  ).
          Length = 445

 Score =  178 bits (434), Expect = 1e-44
 Identities = 79/87 (90%), Positives = 84/87 (96%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           INVYYNEA+G KYVPRA++VDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY
Sbjct: 47  INVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 106

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAELVDSVLDVVRKE+E CDCL+ F
Sbjct: 107 TEGAELVDSVLDVVRKESESCDCLQGF 133



 Score = 95.1 bits (226), Expect = 2e-19
 Identities = 42/45 (93%), Positives = 43/45 (95%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREIVHIQAGQCGNQIGAKFWEVISDEHGID TG+Y GDSDLQLE
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLE 45


>BC101271-1|AAI01272.1|  441|Homo sapiens TUBB8 protein protein.
          Length = 441

 Score =  176 bits (428), Expect = 6e-44
 Identities = 76/87 (87%), Positives = 84/87 (96%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           INVYYNEASGG+YVPRAV+VDLEPGTMDSVRSGPFGQ+FRPDNF+FGQ GAGNNWAKGHY
Sbjct: 44  INVYYNEASGGRYVPRAVLVDLEPGTMDSVRSGPFGQVFRPDNFIFGQCGAGNNWAKGHY 103

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAEL++SV+DVVRKEAE CDCL+ F
Sbjct: 104 TEGAELMESVMDVVRKEAESCDCLQGF 130



 Score = 73.7 bits (173), Expect = 4e-13
 Identities = 33/42 (78%), Positives = 34/42 (80%)
 Frame = +3

Query: 129 IVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           IV  Q GQCGNQIGAKFWEVISDEH ID+ G Y GDS LQLE
Sbjct: 1   IVLTQIGQCGNQIGAKFWEVISDEHAIDSAGTYHGDSHLQLE 42


>BC101270-1|AAI01271.1|  441|Homo sapiens TUBB8 protein protein.
          Length = 441

 Score =  176 bits (428), Expect = 6e-44
 Identities = 76/87 (87%), Positives = 84/87 (96%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           INVYYNEASGG+YVPRAV+VDLEPGTMDSVRSGPFGQ+FRPDNF+FGQ GAGNNWAKGHY
Sbjct: 44  INVYYNEASGGRYVPRAVLVDLEPGTMDSVRSGPFGQVFRPDNFIFGQCGAGNNWAKGHY 103

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAEL++SV+DVVRKEAE CDCL+ F
Sbjct: 104 TEGAELMESVMDVVRKEAESCDCLQGF 130



 Score = 73.7 bits (173), Expect = 4e-13
 Identities = 33/42 (78%), Positives = 34/42 (80%)
 Frame = +3

Query: 129 IVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           IV  Q GQCGNQIGAKFWEVISDEH ID+ G Y GDS LQLE
Sbjct: 1   IVLTQIGQCGNQIGAKFWEVISDEHAIDSAGTYHGDSHLQLE 42


>AL713922-4|CAI16221.1|  435|Homo sapiens novel protein similar to
           beta-tubulin 4Q (TUBB4Q)kinase) II gamma protein.
          Length = 435

 Score =  176 bits (428), Expect = 6e-44
 Identities = 76/87 (87%), Positives = 84/87 (96%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           INVYYNEASGG+YVPRAV+VDLEPGTMDSVRSGPFGQ+FRPDNF+FGQ GAGNNWAKGHY
Sbjct: 47  INVYYNEASGGRYVPRAVLVDLEPGTMDSVRSGPFGQVFRPDNFIFGQCGAGNNWAKGHY 106

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAEL++SV+DVVRKEAE CDCL+ F
Sbjct: 107 TEGAELMESVMDVVRKEAESCDCLQGF 133



 Score = 79.8 bits (188), Expect = 7e-15
 Identities = 36/45 (80%), Positives = 37/45 (82%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREIV  Q GQCGNQIGAKFWEVISDEH ID+ G Y GDS LQLE
Sbjct: 1   MREIVLTQIGQCGNQIGAKFWEVISDEHAIDSAGTYHGDSHLQLE 45


>AF355127-1|AAL32434.1|  444|Homo sapiens beta-tubulin 4Q protein.
          Length = 444

 Score =  176 bits (428), Expect = 6e-44
 Identities = 76/87 (87%), Positives = 84/87 (96%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           INVYYNEASGG+YVPRAV+VDLEPGTMDSVRSGPFGQ+FRPDNF+FGQ GAGNNWAKGHY
Sbjct: 47  INVYYNEASGGRYVPRAVLVDLEPGTMDSVRSGPFGQVFRPDNFIFGQCGAGNNWAKGHY 106

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAEL++SV+DVVRKEAE CDCL+ F
Sbjct: 107 TEGAELMESVMDVVRKEAESCDCLQGF 133



 Score = 79.8 bits (188), Expect = 7e-15
 Identities = 36/45 (80%), Positives = 37/45 (82%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREIV  Q GQCGNQIGAKFWEVISDEH ID+ G Y GDS LQLE
Sbjct: 1   MREIVLTQIGQCGNQIGAKFWEVISDEHAIDSAGTYHGDSHLQLE 45


>AK022340-1|BAB14016.1|  446|Homo sapiens protein ( Homo sapiens
           cDNA FLJ12278 fis, clone MAMMA1001735, highly similar to
           TUBULIN BETA-5 CHAIN. ).
          Length = 446

 Score =  169 bits (412), Expect = 5e-42
 Identities = 75/87 (86%), Positives = 81/87 (93%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           INVYYNE+S  KYVPRA +VDLEPGTMDSVRSGPFGQ+FRPDNFVFGQ+GAGNNWAKGHY
Sbjct: 47  INVYYNESSSQKYVPRAALVDLEPGTMDSVRSGPFGQLFRPDNFVFGQTGAGNNWAKGHY 106

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAELVD+VLDVVRKE E CDCL+ F
Sbjct: 107 TEGAELVDAVLDVVRKECEHCDCLQGF 133



 Score = 87.4 bits (207), Expect = 3e-17
 Identities = 39/45 (86%), Positives = 39/45 (86%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREIVHIQAGQCGNQIG KFWEVISDEHGID  G Y GDS LQLE
Sbjct: 1   MREIVHIQAGQCGNQIGTKFWEVISDEHGIDPAGGYVGDSALQLE 45


>BC002654-1|AAH02654.1|  446|Homo sapiens tubulin, beta 6 protein.
          Length = 446

 Score =  169 bits (411), Expect = 6e-42
 Identities = 74/87 (85%), Positives = 81/87 (93%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           INVYYNE+S  KYVPRA +VDLEPGTMDSVRSGPFGQ+FRPDNF+FGQ+GAGNNWAKGHY
Sbjct: 47  INVYYNESSSQKYVPRAALVDLEPGTMDSVRSGPFGQLFRPDNFIFGQTGAGNNWAKGHY 106

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAELVD+VLDVVRKE E CDCL+ F
Sbjct: 107 TEGAELVDAVLDVVRKECEHCDCLQGF 133



 Score = 87.4 bits (207), Expect = 3e-17
 Identities = 39/45 (86%), Positives = 39/45 (86%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREIVHIQAGQCGNQIG KFWEVISDEHGID  G Y GDS LQLE
Sbjct: 1   MREIVHIQAGQCGNQIGTKFWEVISDEHGIDPAGGYVGDSALQLE 45


>BC111374-1|AAI11375.1|  447|Homo sapiens TUBB6 protein protein.
          Length = 447

 Score =  168 bits (409), Expect = 1e-41
 Identities = 74/87 (85%), Positives = 81/87 (93%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           I+VYYNE+S  KYVPRA +VDLEPGTMDSVRSGPFGQ+FRPDNF+FGQ+GAGNNWAKGHY
Sbjct: 47  ISVYYNESSSKKYVPRAALVDLEPGTMDSVRSGPFGQLFRPDNFIFGQTGAGNNWAKGHY 106

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAELVDSVLDVVRKE E CDCL+ F
Sbjct: 107 TEGAELVDSVLDVVRKECEHCDCLQGF 133



 Score = 87.4 bits (207), Expect = 3e-17
 Identities = 39/45 (86%), Positives = 39/45 (86%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREIVHIQAGQCGNQIG KFWEVISDEHGID  G Y GDS LQLE
Sbjct: 1   MREIVHIQAGQCGNQIGTKFWEVISDEHGIDQAGGYVGDSALQLE 45


>U47634-1|AAC52035.1|  450|Homo sapiens beta-tubulin protein.
          Length = 450

 Score =  167 bits (407), Expect = 2e-41
 Identities = 74/87 (85%), Positives = 80/87 (91%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           I+VYYNEAS  KYVPRA++VDLEPGTMDSVRSG FG +FRPDNF+FGQSGAGNNWAKGHY
Sbjct: 47  ISVYYNEASSHKYVPRAILVDLEPGTMDSVRSGAFGHLFRPDNFIFGQSGAGNNWAKGHY 106

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAELVDSVLDVVRKE E CDCL+ F
Sbjct: 107 TEGAELVDSVLDVVRKECENCDCLQGF 133



 Score = 91.9 bits (218), Expect = 2e-18
 Identities = 41/45 (91%), Positives = 42/45 (93%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREIVHIQAGQCGNQIGAKFWEVISDEHGID +G Y GDSDLQLE
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPSGNYVGDSDLQLE 45


>BT006971-1|AAP35617.1|  797|Homo sapiens tubulin, beta, 4 protein.
          Length = 797

 Score =  167 bits (407), Expect = 2e-41
 Identities = 74/87 (85%), Positives = 80/87 (91%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           I+VYYNEAS  KYVPRA++VDLEPGTMDSVRSG FG +FRPDNF+FGQSGAGNNWAKGHY
Sbjct: 394 ISVYYNEASSHKYVPRAILVDLEPGTMDSVRSGAFGHLFRPDNFIFGQSGAGNNWAKGHY 453

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAELVDSVLDVVRKE E CDCL+ F
Sbjct: 454 TEGAELVDSVLDVVRKECENCDCLQGF 480



 Score = 52.0 bits (119), Expect = 2e-06
 Identities = 22/27 (81%), Positives = 24/27 (88%)
 Frame = +3

Query: 174 KFWEVISDEHGIDATGAYSGDSDLQLE 254
           +FWEVISDEHGID +G Y GDSDLQLE
Sbjct: 366 EFWEVISDEHGIDPSGNYVGDSDLQLE 392


>BC003021-1|AAH03021.2|  450|Homo sapiens tubulin, beta 3 protein.
          Length = 450

 Score =  167 bits (407), Expect = 2e-41
 Identities = 74/87 (85%), Positives = 80/87 (91%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           I+VYYNEAS  KYVPRA++VDLEPGTMDSVRSG FG +FRPDNF+FGQSGAGNNWAKGHY
Sbjct: 47  ISVYYNEASSHKYVPRAILVDLEPGTMDSVRSGAFGHLFRPDNFIFGQSGAGNNWAKGHY 106

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAELVDSVLDVVRKE E CDCL+ F
Sbjct: 107 TEGAELVDSVLDVVRKECENCDCLQGF 133



 Score = 91.9 bits (218), Expect = 2e-18
 Identities = 41/45 (91%), Positives = 42/45 (93%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREIVHIQAGQCGNQIGAKFWEVISDEHGID +G Y GDSDLQLE
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPSGNYVGDSDLQLE 45


>BC001678-1|AAH01678.2|  406|Homo sapiens TUBB3 protein protein.
          Length = 406

 Score =  167 bits (407), Expect = 2e-41
 Identities = 74/87 (85%), Positives = 80/87 (91%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           I+VYYNEAS  KYVPRA++VDLEPGTMDSVRSG FG +FRPDNF+FGQSGAGNNWAKGHY
Sbjct: 3   ISVYYNEASSHKYVPRAILVDLEPGTMDSVRSGAFGHLFRPDNFIFGQSGAGNNWAKGHY 62

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAELVDSVLDVVRKE E CDCL+ F
Sbjct: 63  TEGAELVDSVLDVVRKECENCDCLQGF 89


>BC000748-1|AAH00748.1|  450|Homo sapiens tubulin, beta 3 protein.
          Length = 450

 Score =  167 bits (407), Expect = 2e-41
 Identities = 74/87 (85%), Positives = 80/87 (91%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           I+VYYNEAS  KYVPRA++VDLEPGTMDSVRSG FG +FRPDNF+FGQSGAGNNWAKGHY
Sbjct: 47  ISVYYNEASSHKYVPRAILVDLEPGTMDSVRSGAFGHLFRPDNFIFGQSGAGNNWAKGHY 106

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAELVDSVLDVVRKE E CDCL+ F
Sbjct: 107 TEGAELVDSVLDVVRKECENCDCLQGF 133



 Score = 91.9 bits (218), Expect = 2e-18
 Identities = 41/45 (91%), Positives = 42/45 (93%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREIVHIQAGQCGNQIGAKFWEVISDEHGID +G Y GDSDLQLE
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPSGNYVGDSDLQLE 45


>AK223039-1|BAD96759.1|  450|Homo sapiens tubulin, beta, 4 variant
           protein.
          Length = 450

 Score =  167 bits (407), Expect = 2e-41
 Identities = 74/87 (85%), Positives = 80/87 (91%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           I+VYYNEAS  KYVPRA++VDLEPGTMDSVRSG FG +FRPDNF+FGQSGAGNNWAKGHY
Sbjct: 47  ISVYYNEASSHKYVPRAILVDLEPGTMDSVRSGAFGHLFRPDNFIFGQSGAGNNWAKGHY 106

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAELVDSVLDVVRKE E CDCL+ F
Sbjct: 107 TEGAELVDSVLDVVRKECENCDCLQGF 133



 Score = 91.9 bits (218), Expect = 2e-18
 Identities = 41/45 (91%), Positives = 42/45 (93%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREIVHIQAGQCGNQIGAKFWEVISDEHGID +G Y GDSDLQLE
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPSGNYVGDSDLQLE 45


>AF427491-1|AAL28094.1|  450|Homo sapiens class III beta tubulin
           protein.
          Length = 450

 Score =  167 bits (407), Expect = 2e-41
 Identities = 74/87 (85%), Positives = 80/87 (91%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           I+VYYNEAS  KYVPRA++VDLEPGTMDSVRSG FG +FRPDNF+FGQSGAGNNWAKGHY
Sbjct: 47  ISVYYNEASSHKYVPRAILVDLEPGTMDSVRSGAFGHLFRPDNFIFGQSGAGNNWAKGHY 106

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAELVDSVLDVVRKE E CDCL+ F
Sbjct: 107 TEGAELVDSVLDVVRKECENCDCLQGF 133



 Score = 91.9 bits (218), Expect = 2e-18
 Identities = 41/45 (91%), Positives = 42/45 (93%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREIVHIQAGQCGNQIGAKFWEVISDEHGID +G Y GDSDLQLE
Sbjct: 1   MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPSGNYVGDSDLQLE 45


>U83110-1|AAB41497.1|  434|Homo sapiens beta-tubulin protein.
          Length = 434

 Score =  157 bits (380), Expect = 4e-38
 Identities = 68/87 (78%), Positives = 80/87 (91%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           INV+++EASGG+YVPRAV+VDLEPGTMDSVRSGPF ++FRPDNF+  Q GAGNNWAKG Y
Sbjct: 47  INVHHHEASGGRYVPRAVLVDLEPGTMDSVRSGPFAEVFRPDNFISRQCGAGNNWAKGRY 106

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAEL++SV+DVVRKEAE CDCL+ F
Sbjct: 107 TEGAELMESVMDVVRKEAESCDCLQGF 133



 Score = 80.2 bits (189), Expect = 5e-15
 Identities = 36/45 (80%), Positives = 37/45 (82%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREIV  Q GQCGNQIGAKFWEVISDEH ID+ G Y GDS LQLE
Sbjct: 1   MREIVLTQTGQCGNQIGAKFWEVISDEHAIDSAGTYHGDSHLQLE 45


>U83668-1|AAB48456.1|  433|Homo sapiens beta-tubulin protein.
          Length = 433

 Score =  150 bits (363), Expect = 4e-36
 Identities = 67/87 (77%), Positives = 79/87 (90%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           INV+++EASG +YVPRAV+VDLEPGTMDSVRSGPF ++FRPDNF+  Q GAGNNWAKG Y
Sbjct: 47  INVHHHEASG-RYVPRAVLVDLEPGTMDSVRSGPFAEVFRPDNFISRQCGAGNNWAKGRY 105

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAEL++SV+DVVRKEAE CDCL+ F
Sbjct: 106 TEGAELMESVMDVVRKEAESCDCLQGF 132



 Score = 80.2 bits (189), Expect = 5e-15
 Identities = 36/45 (80%), Positives = 37/45 (82%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREIV  Q GQCGNQIGAKFWEVISDEH ID+ G Y GDS LQLE
Sbjct: 1   MREIVLTQTGQCGNQIGAKFWEVISDEHAIDSAGTYHGDSHLQLE 45


>BC033679-1|AAH33679.1|  451|Homo sapiens tubulin, beta 1 protein.
          Length = 451

 Score =  147 bits (357), Expect = 2e-35
 Identities = 64/87 (73%), Positives = 76/87 (87%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           I+VYYNEA G KYVPRAV+VDLEPGTMDS+RS   G +F+PD+FV G SGAGNNWAKGHY
Sbjct: 47  ISVYYNEAYGRKYVPRAVLVDLEPGTMDSIRSSKLGALFQPDSFVHGNSGAGNNWAKGHY 106

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAEL+++VL+VVR E+E CDCL+ F
Sbjct: 107 TEGAELIENVLEVVRHESESCDCLQGF 133



 Score = 76.2 bits (179), Expect = 8e-14
 Identities = 34/45 (75%), Positives = 37/45 (82%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREIVHIQ GQCGNQIGAKFWE+I +EHGID  G+  G S LQLE
Sbjct: 1   MREIVHIQIGQCGNQIGAKFWEMIGEEHGIDLAGSDRGASALQLE 45


>AL109840-7|CAC09371.2|  451|Homo sapiens tubulin, beta 1 protein.
          Length = 451

 Score =  147 bits (357), Expect = 2e-35
 Identities = 64/87 (73%), Positives = 76/87 (87%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           I+VYYNEA G KYVPRAV+VDLEPGTMDS+RS   G +F+PD+FV G SGAGNNWAKGHY
Sbjct: 47  ISVYYNEAYGRKYVPRAVLVDLEPGTMDSIRSSKLGALFQPDSFVHGNSGAGNNWAKGHY 106

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAEL+++VL+VVR E+E CDCL+ F
Sbjct: 107 TEGAELIENVLEVVRHESESCDCLQGF 133



 Score = 76.2 bits (179), Expect = 8e-14
 Identities = 34/45 (75%), Positives = 37/45 (82%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREIVHIQ GQCGNQIGAKFWE+I +EHGID  G+  G S LQLE
Sbjct: 1   MREIVHIQIGQCGNQIGAKFWEMIGEEHGIDLAGSDRGASALQLE 45


>AJ292757-1|CAC16605.1|  451|Homo sapiens protein ( Homo sapiens
           TUBB1 gene for human beta tubulin 1, class VI. ).
          Length = 451

 Score =  147 bits (357), Expect = 2e-35
 Identities = 64/87 (73%), Positives = 76/87 (87%)
 Frame = +2

Query: 257 INVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHY 436
           I+VYYNEA G KYVPRAV+VDLEPGTMDS+RS   G +F+PD+FV G SGAGNNWAKGHY
Sbjct: 47  ISVYYNEAYGRKYVPRAVLVDLEPGTMDSIRSSKLGALFQPDSFVHGNSGAGNNWAKGHY 106

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
           TEGAEL+++VL+VVR E+E CDCL+ F
Sbjct: 107 TEGAELIENVLEVVRHESESCDCLQGF 133



 Score = 76.2 bits (179), Expect = 8e-14
 Identities = 34/45 (75%), Positives = 37/45 (82%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MREIVHIQ GQCGNQIGAKFWE+I +EHGID  G+  G S LQLE
Sbjct: 1   MREIVHIQIGQCGNQIGAKFWEMIGEEHGIDLAGSDRGASALQLE 45


>BC047518-1|AAH47518.1|  280|Homo sapiens TUBB3 protein protein.
          Length = 280

 Score =  138 bits (335), Expect = 1e-32
 Identities = 60/70 (85%), Positives = 65/70 (92%)
 Frame = +2

Query: 308 VMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKE 487
           ++VDLEPGTMDSVRSG FG +FRPDNF+FGQSGAGNNWAKGHYTEGAELVDSVLDVVRKE
Sbjct: 1   ILVDLEPGTMDSVRSGAFGHLFRPDNFIFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKE 60

Query: 488 AEGCDCLRVF 517
            E CDCL+ F
Sbjct: 61  CENCDCLQGF 70


>BX248307-8|CAM25935.1|  372|Homo sapiens tubulin beta polypeptide
           protein.
          Length = 372

 Score =  130 bits (313), Expect = 5e-30
 Identities = 58/61 (95%), Positives = 59/61 (96%)
 Frame = +2

Query: 335 MDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAEGCDCLRV 514
           MDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAE CDCL+ 
Sbjct: 1   MDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQG 60

Query: 515 F 517
           F
Sbjct: 61  F 61


>AL845353-25|CAI41894.1|  372|Homo sapiens tubulin, beta polypeptide
           protein.
          Length = 372

 Score =  130 bits (313), Expect = 5e-30
 Identities = 58/61 (95%), Positives = 59/61 (96%)
 Frame = +2

Query: 335 MDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAEGCDCLRV 514
           MDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAE CDCL+ 
Sbjct: 1   MDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQG 60

Query: 515 F 517
           F
Sbjct: 61  F 61


>AL662848-9|CAI17442.1|  372|Homo sapiens tubulin, beta protein.
          Length = 372

 Score =  130 bits (313), Expect = 5e-30
 Identities = 58/61 (95%), Positives = 59/61 (96%)
 Frame = +2

Query: 335 MDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAEGCDCLRV 514
           MDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAE CDCL+ 
Sbjct: 1   MDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQG 60

Query: 515 F 517
           F
Sbjct: 61  F 61


>AL662797-13|CAI18197.1|  372|Homo sapiens tubulin, beta protein.
          Length = 372

 Score =  130 bits (313), Expect = 5e-30
 Identities = 58/61 (95%), Positives = 59/61 (96%)
 Frame = +2

Query: 335 MDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAEGCDCLRV 514
           MDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAE CDCL+ 
Sbjct: 1   MDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQG 60

Query: 515 F 517
           F
Sbjct: 61  F 61


>BC127872-1|AAI27873.2|  188|Homo sapiens TUBB2B protein protein.
          Length = 188

 Score =  128 bits (310), Expect = 1e-29
 Identities = 57/61 (93%), Positives = 59/61 (96%)
 Frame = +2

Query: 335 MDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAEGCDCLRV 514
           MDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKE+E CDCL+ 
Sbjct: 1   MDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQG 60

Query: 515 F 517
           F
Sbjct: 61  F 61


>AL713922-2|CAI16219.1|  227|Homo sapiens novel protein similar to
           beta-tubulin 4Q (TUBB4Q)kinase) II gamma protein.
          Length = 227

 Score =  123 bits (297), Expect = 4e-28
 Identities = 52/61 (85%), Positives = 58/61 (95%)
 Frame = +2

Query: 335 MDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAEGCDCLRV 514
           MDSVRSGPFGQ+FRPDNF+FGQ GAGNNWAKGHYTEGAEL++SV+DVVRKEAE CDCL+ 
Sbjct: 1   MDSVRSGPFGQVFRPDNFIFGQCGAGNNWAKGHYTEGAELMESVMDVVRKEAESCDCLQG 60

Query: 515 F 517
           F
Sbjct: 61  F 61


>X01703-1|CAA25855.1|  451|Homo sapiens alpha-tubulin protein.
          Length = 451

 Score =  100 bits (239), Expect = 4e-21
 Identities = 43/88 (48%), Positives = 61/88 (69%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           S N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GH
Sbjct: 48  SFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGH 107

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           YT G E++D VLD +RK A+ C  L+ F
Sbjct: 108 YTIGKEIIDLVLDRIRKLADQCTRLQGF 135



 Score = 38.7 bits (86), Expect = 0.015
 Identities = 18/42 (42%), Positives = 21/42 (50%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 245
           MRE + I  GQ G QIG   WE+   EHGI   G    D  +
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI 42


>K00558-1|AAA91576.1|  451|Homo sapiens protein ( human
           alpha-tubulin mRNA, complete cds. ).
          Length = 451

 Score =  100 bits (239), Expect = 4e-21
 Identities = 43/88 (48%), Positives = 61/88 (69%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           S N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GH
Sbjct: 48  SFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGH 107

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           YT G E++D VLD +RK A+ C  L+ F
Sbjct: 108 YTIGKEIIDLVLDRIRKLADQCTRLQGF 135



 Score = 38.7 bits (86), Expect = 0.015
 Identities = 18/42 (42%), Positives = 21/42 (50%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 245
           MRE + I  GQ G QIG   WE+   EHGI   G    D  +
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI 42


>DQ400107-1|ABD60581.1|  451|Homo sapiens alpha tubulin protein.
          Length = 451

 Score =  100 bits (239), Expect = 4e-21
 Identities = 43/88 (48%), Positives = 61/88 (69%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           S N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GH
Sbjct: 48  SFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGH 107

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           YT G E++D VLD +RK A+ C  L+ F
Sbjct: 108 YTIGKEIIDLVLDRIRKLADQCTGLQGF 135



 Score = 38.7 bits (86), Expect = 0.015
 Identities = 18/42 (42%), Positives = 21/42 (50%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 245
           MRE + I  GQ G QIG   WE+   EHGI   G    D  +
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI 42


>BC071904-1|AAH71904.1|  451|Homo sapiens tubulin, alpha 1b protein.
          Length = 451

 Score =  100 bits (239), Expect = 4e-21
 Identities = 43/88 (48%), Positives = 61/88 (69%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           S N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GH
Sbjct: 48  SFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGH 107

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           YT G E++D VLD +RK A+ C  L+ F
Sbjct: 108 YTIGKEIIDLVLDRIRKLADQCTGLQGF 135



 Score = 38.7 bits (86), Expect = 0.015
 Identities = 18/42 (42%), Positives = 21/42 (50%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 245
           MRE + I  GQ G QIG   WE+   EHGI   G    D  +
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI 42


>BC063036-1|AAH63036.1|  449|Homo sapiens tubulin, alpha 1c protein.
          Length = 449

 Score =  100 bits (239), Expect = 4e-21
 Identities = 43/88 (48%), Positives = 61/88 (69%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           S N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GH
Sbjct: 48  SFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGH 107

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           YT G E++D VLD +RK A+ C  L+ F
Sbjct: 108 YTIGKEIIDLVLDRIRKLADQCTGLQGF 135



 Score = 38.7 bits (86), Expect = 0.015
 Identities = 18/42 (42%), Positives = 21/42 (50%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 245
           MRE + I  GQ G QIG   WE+   EHGI   G    D  +
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI 42


>BC051297-1|AAH51297.1|  449|Homo sapiens tubulin, alpha 1c protein.
          Length = 449

 Score =  100 bits (239), Expect = 4e-21
 Identities = 43/88 (48%), Positives = 61/88 (69%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           S N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GH
Sbjct: 48  SFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGH 107

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           YT G E++D VLD +RK A+ C  L+ F
Sbjct: 108 YTIGKEIIDLVLDRIRKLADQCTGLQGF 135



 Score = 38.7 bits (86), Expect = 0.015
 Identities = 18/42 (42%), Positives = 21/42 (50%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 245
           MRE + I  GQ G QIG   WE+   EHGI   G    D  +
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI 42


>BC050637-1|AAH50637.1|  451|Homo sapiens tubulin, alpha 1a protein.
          Length = 451

 Score =  100 bits (239), Expect = 4e-21
 Identities = 43/88 (48%), Positives = 61/88 (69%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           S N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GH
Sbjct: 48  SFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGH 107

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           YT G E++D VLD +RK A+ C  L+ F
Sbjct: 108 YTIGKEIIDLVLDRIRKLADQCTGLQGF 135



 Score = 38.7 bits (86), Expect = 0.015
 Identities = 18/42 (42%), Positives = 21/42 (50%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 245
           MRE + I  GQ G QIG   WE+   EHGI   G    D  +
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI 42


>BC030820-1|AAH30820.1|  451|Homo sapiens tubulin, alpha 1b protein.
          Length = 451

 Score =  100 bits (239), Expect = 4e-21
 Identities = 43/88 (48%), Positives = 61/88 (69%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           S N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GH
Sbjct: 48  SFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGH 107

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           YT G E++D VLD +RK A+ C  L+ F
Sbjct: 108 YTIGKEIIDLVLDRIRKLADQCTGLQGF 135



 Score = 38.7 bits (86), Expect = 0.015
 Identities = 18/42 (42%), Positives = 21/42 (50%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 245
           MRE + I  GQ G QIG   WE+   EHGI   G    D  +
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI 42


>BC021088-1|AAH21088.1|  449|Homo sapiens tubulin, alpha 1c protein.
          Length = 449

 Score =  100 bits (239), Expect = 4e-21
 Identities = 43/88 (48%), Positives = 61/88 (69%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           S N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GH
Sbjct: 48  SFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGH 107

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           YT G E++D VLD +RK A+ C  L+ F
Sbjct: 108 YTIGKEIIDLVLDRIRKLADQCTGLQGF 135



 Score = 38.7 bits (86), Expect = 0.015
 Identities = 18/42 (42%), Positives = 21/42 (50%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 245
           MRE + I  GQ G QIG   WE+   EHGI   G    D  +
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI 42


>BC019298-1|AAH19298.1|  449|Homo sapiens tubulin, alpha 1c protein.
          Length = 449

 Score =  100 bits (239), Expect = 4e-21
 Identities = 43/88 (48%), Positives = 61/88 (69%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           S N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GH
Sbjct: 48  SFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGH 107

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           YT G E++D VLD +RK A+ C  L+ F
Sbjct: 108 YTIGKEIIDLVLDRIRKLADQCTGLQGF 135



 Score = 38.7 bits (86), Expect = 0.015
 Identities = 18/42 (42%), Positives = 21/42 (50%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 245
           MRE + I  GQ G QIG   WE+   EHGI   G    D  +
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI 42


>BC017004-1|AAH17004.1|  451|Homo sapiens tubulin, alpha 1b protein.
          Length = 451

 Score =  100 bits (239), Expect = 4e-21
 Identities = 43/88 (48%), Positives = 61/88 (69%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           S N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GH
Sbjct: 48  SFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGH 107

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           YT G E++D VLD +RK A+ C  L+ F
Sbjct: 108 YTIGKEIIDLVLDRIRKLADQCTGLQGF 135



 Score = 38.7 bits (86), Expect = 0.015
 Identities = 18/42 (42%), Positives = 21/42 (50%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 245
           MRE + I  GQ G QIG   WE+   EHGI   G    D  +
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI 42


>BC015883-1|AAH15883.1|  451|Homo sapiens tubulin, alpha 1b protein.
          Length = 451

 Score =  100 bits (239), Expect = 4e-21
 Identities = 43/88 (48%), Positives = 61/88 (69%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           S N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GH
Sbjct: 48  SFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGH 107

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           YT G E++D VLD +RK A+ C  L+ F
Sbjct: 108 YTIGKEIIDLVLDRIRKLADQCTGLQGF 135



 Score = 38.7 bits (86), Expect = 0.015
 Identities = 18/42 (42%), Positives = 21/42 (50%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 245
           MRE + I  GQ G QIG   WE+   EHGI   G    D  +
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI 42


>BC011790-1|AAH11790.1|  449|Homo sapiens tubulin, alpha 1c protein.
          Length = 449

 Score =  100 bits (239), Expect = 4e-21
 Identities = 43/88 (48%), Positives = 61/88 (69%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           S N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GH
Sbjct: 48  SFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGH 107

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           YT G E++D VLD +RK A+ C  L+ F
Sbjct: 108 YTIGKEIIDLVLDRIRKLADQCTGLQGF 135



 Score = 38.7 bits (86), Expect = 0.015
 Identities = 18/42 (42%), Positives = 21/42 (50%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 245
           MRE + I  GQ G QIG   WE+   EHGI   G    D  +
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI 42


>BC011572-1|AAH11572.1|  451|Homo sapiens tubulin, alpha 1b protein.
          Length = 451

 Score =  100 bits (239), Expect = 4e-21
 Identities = 43/88 (48%), Positives = 61/88 (69%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           S N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GH
Sbjct: 48  SFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGH 107

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           YT G E++D VLD +RK A+ C  L+ F
Sbjct: 108 YTIGKEIIDLVLDRIRKLADQCTGLQGF 135



 Score = 38.7 bits (86), Expect = 0.015
 Identities = 18/42 (42%), Positives = 21/42 (50%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 245
           MRE + I  GQ G QIG   WE+   EHGI   G    D  +
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI 42


>BC010494-1|AAH10494.1|  451|Homo sapiens tubulin, alpha 1b protein.
          Length = 451

 Score =  100 bits (239), Expect = 4e-21
 Identities = 43/88 (48%), Positives = 61/88 (69%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           S N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GH
Sbjct: 48  SFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGH 107

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           YT G E++D VLD +RK A+ C  L+ F
Sbjct: 108 YTIGKEIIDLVLDRIRKLADQCTGLQGF 135



 Score = 38.7 bits (86), Expect = 0.015
 Identities = 18/42 (42%), Positives = 21/42 (50%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 245
           MRE + I  GQ G QIG   WE+   EHGI   G    D  +
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI 42


>BC009513-1|AAH09513.1|  451|Homo sapiens tubulin, alpha 1b protein.
          Length = 451

 Score =  100 bits (239), Expect = 4e-21
 Identities = 43/88 (48%), Positives = 61/88 (69%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           S N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GH
Sbjct: 48  SFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGH 107

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           YT G E++D VLD +RK A+ C  L+ F
Sbjct: 108 YTIGKEIIDLVLDRIRKLADQCTGLQGF 135



 Score = 38.7 bits (86), Expect = 0.015
 Identities = 18/42 (42%), Positives = 21/42 (50%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 245
           MRE + I  GQ G QIG   WE+   EHGI   G    D  +
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI 42


>BC009512-1|AAH09512.1|  451|Homo sapiens tubulin, alpha 1b protein.
          Length = 451

 Score =  100 bits (239), Expect = 4e-21
 Identities = 43/88 (48%), Positives = 61/88 (69%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           S N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GH
Sbjct: 48  SFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGH 107

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           YT G E++D VLD +RK A+ C  L+ F
Sbjct: 108 YTIGKEIIDLVLDRIRKLADQCTGLQGF 135



 Score = 38.7 bits (86), Expect = 0.015
 Identities = 18/42 (42%), Positives = 21/42 (50%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 245
           MRE + I  GQ G QIG   WE+   EHGI   G    D  +
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI 42


>BC009509-1|AAH09509.1|  451|Homo sapiens tubulin, alpha 1b protein.
          Length = 451

 Score =  100 bits (239), Expect = 4e-21
 Identities = 43/88 (48%), Positives = 61/88 (69%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           S N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GH
Sbjct: 48  SFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGH 107

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           YT G E++D VLD +RK A+ C  L+ F
Sbjct: 108 YTIGKEIIDLVLDRIRKLADQCTGLQGF 135



 Score = 38.7 bits (86), Expect = 0.015
 Identities = 18/42 (42%), Positives = 21/42 (50%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 245
           MRE + I  GQ G QIG   WE+   EHGI   G    D  +
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI 42


>BC009314-1|AAH09314.1|  451|Homo sapiens tubulin, alpha 1b protein.
          Length = 451

 Score =  100 bits (239), Expect = 4e-21
 Identities = 43/88 (48%), Positives = 61/88 (69%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           S N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GH
Sbjct: 48  SFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGH 107

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           YT G E++D VLD +RK A+ C  L+ F
Sbjct: 108 YTIGKEIIDLVLDRIRKLADQCTGLQGF 135



 Score = 38.7 bits (86), Expect = 0.015
 Identities = 18/42 (42%), Positives = 21/42 (50%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 245
           MRE + I  GQ G QIG   WE+   EHGI   G    D  +
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI 42


>BC008659-1|AAH08659.1|  451|Homo sapiens tubulin, alpha 1b protein.
          Length = 451

 Score =  100 bits (239), Expect = 4e-21
 Identities = 43/88 (48%), Positives = 61/88 (69%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           S N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GH
Sbjct: 48  SFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGH 107

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           YT G E++D VLD +RK A+ C  L+ F
Sbjct: 108 YTIGKEIIDLVLDRIRKLADQCTGLQGF 135



 Score = 38.7 bits (86), Expect = 0.015
 Identities = 18/42 (42%), Positives = 21/42 (50%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 245
           MRE + I  GQ G QIG   WE+   EHGI   G    D  +
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI 42


>BC006481-1|AAH06481.1|  451|Homo sapiens tubulin, alpha 1b protein.
          Length = 451

 Score =  100 bits (239), Expect = 4e-21
 Identities = 43/88 (48%), Positives = 61/88 (69%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           S N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GH
Sbjct: 48  SFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGH 107

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           YT G E++D VLD +RK A+ C  L+ F
Sbjct: 108 YTIGKEIIDLVLDRIRKLADQCTGLQGF 135



 Score = 38.7 bits (86), Expect = 0.015
 Identities = 18/42 (42%), Positives = 21/42 (50%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 245
           MRE + I  GQ G QIG   WE+   EHGI   G    D  +
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI 42


>BC006468-1|AAH06468.1|  451|Homo sapiens tubulin, alpha 1a protein.
          Length = 451

 Score =  100 bits (239), Expect = 4e-21
 Identities = 43/88 (48%), Positives = 61/88 (69%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           S N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GH
Sbjct: 48  SFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGH 107

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           YT G E++D VLD +RK A+ C  L+ F
Sbjct: 108 YTIGKEIIDLVLDRIRKLADQCTGLQGF 135



 Score = 38.7 bits (86), Expect = 0.015
 Identities = 18/42 (42%), Positives = 21/42 (50%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 245
           MRE + I  GQ G QIG   WE+   EHGI   G    D  +
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI 42


>BC006379-1|AAH06379.1|  451|Homo sapiens tubulin, alpha 1b protein.
          Length = 451

 Score =  100 bits (239), Expect = 4e-21
 Identities = 43/88 (48%), Positives = 61/88 (69%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           S N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GH
Sbjct: 48  SFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGH 107

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           YT G E++D VLD +RK A+ C  L+ F
Sbjct: 108 YTIGKEIIDLVLDRIRKLADQCTGLQGF 135



 Score = 38.7 bits (86), Expect = 0.015
 Identities = 18/42 (42%), Positives = 21/42 (50%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 245
           MRE + I  GQ G QIG   WE+   EHGI   G    D  +
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI 42


>BC005946-1|AAH05946.1|  449|Homo sapiens tubulin, alpha 1c protein.
          Length = 449

 Score =  100 bits (239), Expect = 4e-21
 Identities = 43/88 (48%), Positives = 61/88 (69%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           S N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GH
Sbjct: 48  SFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGH 107

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           YT G E++D VLD +RK A+ C  L+ F
Sbjct: 108 YTIGKEIIDLVLDRIRKLADQCTGLQGF 135



 Score = 38.7 bits (86), Expect = 0.015
 Identities = 18/42 (42%), Positives = 21/42 (50%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 245
           MRE + I  GQ G QIG   WE+   EHGI   G    D  +
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI 42


>BC004949-1|AAH04949.1|  449|Homo sapiens tubulin, alpha 1c protein.
          Length = 449

 Score =  100 bits (239), Expect = 4e-21
 Identities = 43/88 (48%), Positives = 61/88 (69%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           S N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GH
Sbjct: 48  SFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGH 107

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           YT G E++D VLD +RK A+ C  L+ F
Sbjct: 108 YTIGKEIIDLVLDRIRKLADQCTGLQGF 135



 Score = 38.7 bits (86), Expect = 0.015
 Identities = 18/42 (42%), Positives = 21/42 (50%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 245
           MRE + I  GQ G QIG   WE+   EHGI   G    D  +
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI 42


>BC001128-1|AAH01128.1|  451|Homo sapiens tubulin, alpha 1b protein.
          Length = 451

 Score =  100 bits (239), Expect = 4e-21
 Identities = 43/88 (48%), Positives = 61/88 (69%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           S N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GH
Sbjct: 48  SFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGH 107

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           YT G E++D VLD +RK A+ C  L+ F
Sbjct: 108 YTIGKEIIDLVLDRIRKLADQCTGLQGF 135



 Score = 38.7 bits (86), Expect = 0.015
 Identities = 18/42 (42%), Positives = 21/42 (50%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 245
           MRE + I  GQ G QIG   WE+   EHGI   G    D  +
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI 42


>BC000696-1|AAH00696.1|  451|Homo sapiens tubulin, alpha 1b protein.
          Length = 451

 Score =  100 bits (239), Expect = 4e-21
 Identities = 43/88 (48%), Positives = 61/88 (69%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           S N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GH
Sbjct: 48  SFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGH 107

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           YT G E++D VLD +RK A+ C  L+ F
Sbjct: 108 YTIGKEIIDLVLDRIRKLADQCTGLQGF 135



 Score = 38.7 bits (86), Expect = 0.015
 Identities = 18/42 (42%), Positives = 21/42 (50%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 245
           MRE + I  GQ G QIG   WE+   EHGI   G    D  +
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI 42


>AK223024-1|BAD96744.1|  449|Homo sapiens tubulin alpha 6 variant
           protein.
          Length = 449

 Score =  100 bits (239), Expect = 4e-21
 Identities = 43/88 (48%), Positives = 61/88 (69%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           S N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GH
Sbjct: 48  SFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGH 107

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           YT G E++D VLD +RK A+ C  L+ F
Sbjct: 108 YTIGKEIIDLVLDRIRKLADQCTGLQGF 135



 Score = 38.7 bits (86), Expect = 0.015
 Identities = 18/42 (42%), Positives = 21/42 (50%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 245
           MRE + I  GQ G QIG   WE+   EHGI   G    D  +
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI 42


>AF141347-1|AAD33871.1|  451|Homo sapiens alpha-tubulin protein.
          Length = 451

 Score =  100 bits (239), Expect = 4e-21
 Identities = 43/88 (48%), Positives = 61/88 (69%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           S N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GH
Sbjct: 48  SFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGH 107

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           YT G E++D VLD +RK A+ C  L+ F
Sbjct: 108 YTIGKEIIDLVLDRIRKLADQCTGLQGF 135



 Score = 38.7 bits (86), Expect = 0.015
 Identities = 18/42 (42%), Positives = 21/42 (50%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 245
           MRE + I  GQ G QIG   WE+   EHGI   G    D  +
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI 42


>AF081484-1|AAC31959.1|  451|Homo sapiens alpha-tubulin isoform 1
           protein.
          Length = 451

 Score =  100 bits (239), Expect = 4e-21
 Identities = 43/88 (48%), Positives = 61/88 (69%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           S N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GH
Sbjct: 48  SFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGH 107

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           YT G E++D VLD +RK A+ C  L+ F
Sbjct: 108 YTIGKEIIDLVLDRIRKLADQCTGLQGF 135



 Score = 38.7 bits (86), Expect = 0.015
 Identities = 18/42 (42%), Positives = 21/42 (50%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 245
           MRE + I  GQ G QIG   WE+   EHGI   G    D  +
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI 42


>DQ422808-1|ABD72607.1|  450|Homo sapiens tubulin, alpha 2 protein.
          Length = 450

 Score =   99 bits (238), Expect = 6e-21
 Identities = 44/88 (50%), Positives = 61/88 (69%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           S N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GH
Sbjct: 48  SFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGH 107

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           YT G E+VD VLD +RK A+ C  L+ F
Sbjct: 108 YTIGKEIVDLVLDRIRKLADLCTGLQGF 135



 Score = 38.7 bits (86), Expect = 0.015
 Identities = 18/42 (42%), Positives = 21/42 (50%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 245
           MRE + I  GQ G QIG   WE+   EHGI   G    D  +
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI 42


>BC057810-1|AAH57810.1|  450|Homo sapiens tubulin, alpha 3d protein.
          Length = 450

 Score =   99 bits (238), Expect = 6e-21
 Identities = 44/88 (50%), Positives = 61/88 (69%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           S N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GH
Sbjct: 48  SFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGH 107

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           YT G E+VD VLD +RK A+ C  L+ F
Sbjct: 108 YTIGKEIVDLVLDRIRKLADLCTGLQGF 135



 Score = 38.7 bits (86), Expect = 0.015
 Identities = 18/42 (42%), Positives = 21/42 (50%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 245
           MRE + I  GQ G QIG   WE+   EHGI   G    D  +
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI 42


>BC011721-1|AAH11721.1|  418|Homo sapiens tubulin, alpha 3c protein.
          Length = 418

 Score =   99 bits (238), Expect = 6e-21
 Identities = 44/88 (50%), Positives = 61/88 (69%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           S N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GH
Sbjct: 48  SFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGH 107

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           YT G E+VD VLD +RK A+ C  L+ F
Sbjct: 108 YTIGKEIVDLVLDRIRKLADLCTGLQGF 135



 Score = 38.7 bits (86), Expect = 0.015
 Identities = 18/42 (42%), Positives = 21/42 (50%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 245
           MRE + I  GQ G QIG   WE+   EHGI   G    D  +
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI 42


>AL139327-3|CAH73534.1|  450|Homo sapiens tubulin, alpha 3c protein.
          Length = 450

 Score =   99 bits (238), Expect = 6e-21
 Identities = 44/88 (50%), Positives = 61/88 (69%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           S N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GH
Sbjct: 48  SFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGH 107

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           YT G E+VD VLD +RK A+ C  L+ F
Sbjct: 108 YTIGKEIVDLVLDRIRKLADLCTGLQGF 135



 Score = 38.7 bits (86), Expect = 0.015
 Identities = 18/42 (42%), Positives = 21/42 (50%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 245
           MRE + I  GQ G QIG   WE+   EHGI   G    D  +
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI 42


>AF005392-1|AAC39578.1|  449|Homo sapiens alpha tubulin protein.
          Length = 449

 Score =   99 bits (238), Expect = 6e-21
 Identities = 44/88 (50%), Positives = 61/88 (69%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           S N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GH
Sbjct: 47  SFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGH 106

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           YT G E+VD VLD +RK A+ C  L+ F
Sbjct: 107 YTIGKEIVDLVLDRIRKLADLCTGLQGF 134



 Score = 36.7 bits (81), Expect = 0.062
 Identities = 17/41 (41%), Positives = 20/41 (48%)
 Frame = +3

Query: 123 REIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 245
           RE + I  GQ G QIG   WE+   EHGI   G    D  +
Sbjct: 1   RECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI 41


>X06956-1|CAA30026.1|  447|Homo sapiens alpha-tubulin protein.
          Length = 447

 Score = 98.3 bits (234), Expect = 2e-20
 Identities = 41/88 (46%), Positives = 60/88 (68%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           S   ++ E   GK+VPRAV VDLEP  +D +R+GP+ Q+F P+  + G+  A NN+A+GH
Sbjct: 47  SFTTFFCETGAGKHVPRAVFVDLEPTVIDEIRNGPYRQLFHPEQLITGKEDAANNYARGH 106

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           YT G E++D VLD +RK ++ C  L+ F
Sbjct: 107 YTIGKEIIDPVLDRIRKLSDQCTGLQGF 134



 Score = 35.1 bits (77), Expect = 0.19
 Identities = 15/41 (36%), Positives = 20/41 (48%)
 Frame = +3

Query: 123 REIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 245
           RE + +  GQ G Q+G   WE+   EHGI   G    D  +
Sbjct: 1   RECISVHVGQAGVQMGNACWELYCLEHGIQPDGQMPSDKTI 41


>BT006731-1|AAP35377.1|  448|Homo sapiens tubulin, alpha 1 (testis
           specific) protein.
          Length = 448

 Score = 98.3 bits (234), Expect = 2e-20
 Identities = 41/88 (46%), Positives = 60/88 (68%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           S   ++ E   GK+VPRAV VDLEP  +D +R+GP+ Q+F P+  + G+  A NN+A+GH
Sbjct: 48  SFTTFFCETGAGKHVPRAVFVDLEPTVIDEIRNGPYRQLFHPEQLITGKEDAANNYARGH 107

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           YT G E++D VLD +RK ++ C  L+ F
Sbjct: 108 YTIGKEIIDPVLDRIRKLSDQCTGLQGF 135



 Score = 37.1 bits (82), Expect = 0.047
 Identities = 16/42 (38%), Positives = 21/42 (50%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 245
           MRE + +  GQ G Q+G   WE+   EHGI   G    D  +
Sbjct: 1   MRECISVHVGQAGVQMGNACWELYCLEHGIQPDGQMPSDKTI 42


>BC009238-1|AAH09238.1|  448|Homo sapiens tubulin, alpha 4a protein.
          Length = 448

 Score = 98.3 bits (234), Expect = 2e-20
 Identities = 41/88 (46%), Positives = 60/88 (68%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           S   ++ E   GK+VPRAV VDLEP  +D +R+GP+ Q+F P+  + G+  A NN+A+GH
Sbjct: 48  SFTTFFCETGAGKHVPRAVFVDLEPTVIDEIRNGPYRQLFHPEQLITGKEDAANNYARGH 107

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           YT G E++D VLD +RK ++ C  L+ F
Sbjct: 108 YTIGKEIIDPVLDRIRKLSDQCTGLQGF 135



 Score = 37.1 bits (82), Expect = 0.047
 Identities = 16/42 (38%), Positives = 21/42 (50%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 245
           MRE + +  GQ G Q+G   WE+   EHGI   G    D  +
Sbjct: 1   MRECISVHVGQAGVQMGNACWELYCLEHGIQPDGQMPSDKTI 42


>AY895018-1|AAW65371.1|  448|Homo sapiens tubulin, alpha 1 (testis
           specific) protein.
          Length = 448

 Score = 98.3 bits (234), Expect = 2e-20
 Identities = 41/88 (46%), Positives = 60/88 (68%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           S   ++ E   GK+VPRAV VDLEP  +D +R+GP+ Q+F P+  + G+  A NN+A+GH
Sbjct: 48  SFTTFFCETGAGKHVPRAVFVDLEPTVIDEIRNGPYRQLFHPEQLITGKEDAANNYARGH 107

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           YT G E++D VLD +RK ++ C  L+ F
Sbjct: 108 YTIGKEIIDPVLDRIRKLSDQCTGLQGF 135



 Score = 37.1 bits (82), Expect = 0.047
 Identities = 16/42 (38%), Positives = 21/42 (50%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 245
           MRE + +  GQ G Q+G   WE+   EHGI   G    D  +
Sbjct: 1   MRECISVHVGQAGVQMGNACWELYCLEHGIQPDGQMPSDKTI 42


>CR456600-1|CAG30486.1|  449|Homo sapiens TUBA8 protein.
          Length = 449

 Score = 97.9 bits (233), Expect = 2e-20
 Identities = 41/88 (46%), Positives = 59/88 (67%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           S   +++E   GK+VPRAVM+DLEP  +D VR+G + Q+F P+  + G+  A NN+A+GH
Sbjct: 48  SFTTFFSETGNGKHVPRAVMIDLEPTVVDEVRAGTYRQLFHPEQLITGKEDAANNYARGH 107

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           YT G E +D VLD +RK  + C  L+ F
Sbjct: 108 YTVGKESIDLVLDRIRKLTDACSGLQGF 135



 Score = 40.7 bits (91), Expect = 0.004
 Identities = 17/40 (42%), Positives = 22/40 (55%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDS 239
           MRE + +  GQ G QIG   WE+   EHGI A G +   +
Sbjct: 1   MRECISVHVGQAGVQIGNACWELFCLEHGIQADGTFDAQA 40


>BX537702-1|CAD97815.1|  479|Homo sapiens hypothetical protein
           protein.
          Length = 479

 Score = 97.9 bits (233), Expect = 2e-20
 Identities = 41/88 (46%), Positives = 59/88 (67%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           S   +++E   GK+VPRAVM+DLEP  +D VR+G + Q+F P+  + G+  A NN+A+GH
Sbjct: 47  SFTTFFSETGNGKHVPRAVMIDLEPTVVDEVRAGTYRQLFHPEQLITGKEDAANNYARGH 106

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           YT G E +D VLD +RK  + C  L+ F
Sbjct: 107 YTVGKESIDLVLDRIRKLTDACSGLQGF 134



 Score = 38.7 bits (86), Expect = 0.015
 Identities = 16/39 (41%), Positives = 21/39 (53%)
 Frame = +3

Query: 123 REIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDS 239
           RE + +  GQ G QIG   WE+   EHGI A G +   +
Sbjct: 1   RECISVHVGQAGVQIGNACWELFCLEHGIQADGTFDAQA 39


>BC104845-1|AAI04846.1|  449|Homo sapiens tubulin, alpha 8 protein.
          Length = 449

 Score = 97.9 bits (233), Expect = 2e-20
 Identities = 41/88 (46%), Positives = 59/88 (67%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           S   +++E   GK+VPRAVM+DLEP  +D VR+G + Q+F P+  + G+  A NN+A+GH
Sbjct: 48  SFTTFFSETGNGKHVPRAVMIDLEPTVVDEVRAGTYRQLFHPEQLITGKEDAANNYARGH 107

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           YT G E +D VLD +RK  + C  L+ F
Sbjct: 108 YTVGKESIDLVLDRIRKLTDACSGLQGF 135



 Score = 40.7 bits (91), Expect = 0.004
 Identities = 17/40 (42%), Positives = 22/40 (55%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDS 239
           MRE + +  GQ G QIG   WE+   EHGI A G +   +
Sbjct: 1   MRECISVHVGQAGVQIGNACWELFCLEHGIQADGTFDAQA 40


>BC074827-1|AAH74827.1|  449|Homo sapiens tubulin, alpha 8 protein.
          Length = 449

 Score = 97.9 bits (233), Expect = 2e-20
 Identities = 41/88 (46%), Positives = 59/88 (67%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           S   +++E   GK+VPRAVM+DLEP  +D VR+G + Q+F P+  + G+  A NN+A+GH
Sbjct: 48  SFTTFFSETGNGKHVPRAVMIDLEPTVVDEVRAGTYRQLFHPEQLITGKEDAANNYARGH 107

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           YT G E +D VLD +RK  + C  L+ F
Sbjct: 108 YTVGKESIDLVLDRIRKLTDACSGLQGF 135



 Score = 40.7 bits (91), Expect = 0.004
 Identities = 17/40 (42%), Positives = 22/40 (55%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDS 239
           MRE + +  GQ G QIG   WE+   EHGI A G +   +
Sbjct: 1   MRECISVHVGQAGVQIGNACWELFCLEHGIQADGTFDAQA 40


>BC057811-1|AAH57811.1|  450|Homo sapiens tubulin, alpha 3e protein.
          Length = 450

 Score = 97.9 bits (233), Expect = 2e-20
 Identities = 43/88 (48%), Positives = 61/88 (69%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           S N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A +N+A+GH
Sbjct: 48  SFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAASNYARGH 107

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           YT G E+VD VLD +RK A+ C  L+ F
Sbjct: 108 YTIGKEIVDLVLDRIRKLADLCTGLQGF 135



 Score = 38.7 bits (86), Expect = 0.015
 Identities = 18/42 (42%), Positives = 21/42 (50%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 245
           MRE + I  GQ G QIG   WE+   EHGI   G    D  +
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI 42


>AJ245922-1|CAB88036.1|  449|Homo sapiens alpha-tubulin 8 protein.
          Length = 449

 Score = 97.9 bits (233), Expect = 2e-20
 Identities = 41/88 (46%), Positives = 59/88 (67%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           S   +++E   GK+VPRAVM+DLEP  +D VR+G + Q+F P+  + G+  A NN+A+GH
Sbjct: 48  SFTTFFSETGNGKHVPRAVMIDLEPTVVDEVRAGTYRQLFHPEQLITGKEDAANNYARGH 107

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           YT G E +D VLD +RK  + C  L+ F
Sbjct: 108 YTVGKESIDLVLDRIRKLTDACSGLQGF 135



 Score = 40.7 bits (91), Expect = 0.004
 Identities = 17/40 (42%), Positives = 22/40 (55%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDS 239
           MRE + +  GQ G QIG   WE+   EHGI A G +   +
Sbjct: 1   MRECISVHVGQAGVQIGNACWELFCLEHGIQADGTFDAQA 40


>BC033064-1|AAH33064.1|  325|Homo sapiens TUBA1C protein protein.
          Length = 325

 Score = 92.7 bits (220), Expect = 9e-19
 Identities = 38/77 (49%), Positives = 54/77 (70%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           S N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GH
Sbjct: 48  SFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGH 107

Query: 434 YTEGAELVDSVLDVVRK 484
           YT G E++D VLD + K
Sbjct: 108 YTIGKEIIDLVLDRIHK 124



 Score = 38.7 bits (86), Expect = 0.015
 Identities = 18/42 (42%), Positives = 21/42 (50%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 245
           MRE + I  GQ G QIG   WE+   EHGI   G    D  +
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI 42


>BC105634-1|AAI05635.1|  446|Homo sapiens tubulin, alpha-like 3
           protein.
          Length = 446

 Score = 84.6 bits (200), Expect = 2e-16
 Identities = 37/88 (42%), Positives = 57/88 (64%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           S + ++ E   GK+VPRA+ VDLEP  +D +R+G    +F P+  + G+  A NN+A+G 
Sbjct: 55  SFDTFFCETRAGKHVPRALFVDLEPTVIDGIRTGQHRSLFHPEQLLSGKEDAANNYARGR 114

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           Y+ G+E++D VL+  RK AE C  L+ F
Sbjct: 115 YSVGSEVIDLVLERTRKLAEQCGGLQGF 142



 Score = 38.3 bits (85), Expect = 0.020
 Identities = 20/45 (44%), Positives = 22/45 (48%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MRE + I  GQ G QIG   WE+   EHGI   G        QLE
Sbjct: 1   MRECLSIHIGQAGIQIGDACWELYCLEHGIQPNGVVLDTQQDQLE 45


>BC099716-1|AAH99716.1|  446|Homo sapiens tubulin, alpha-like 3
           protein.
          Length = 446

 Score = 84.6 bits (200), Expect = 2e-16
 Identities = 37/88 (42%), Positives = 57/88 (64%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           S + ++ E   GK+VPRA+ VDLEP  +D +R+G    +F P+  + G+  A NN+A+G 
Sbjct: 55  SFDTFFCETRAGKHVPRALFVDLEPTVIDGIRTGQHRSLFHPEQLLSGKEDAANNYARGR 114

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           Y+ G+E++D VL+  RK AE C  L+ F
Sbjct: 115 YSVGSEVIDLVLERTRKLAEQCGGLQGF 142



 Score = 38.3 bits (85), Expect = 0.020
 Identities = 20/45 (44%), Positives = 22/45 (48%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MRE + I  GQ G QIG   WE+   EHGI   G        QLE
Sbjct: 1   MRECLSIHIGQAGIQIGDACWELYCLEHGIQPNGVVLDTQQDQLE 45


>BC098247-1|AAH98247.1|  406|Homo sapiens TUBAL3 protein protein.
          Length = 406

 Score = 84.6 bits (200), Expect = 2e-16
 Identities = 37/88 (42%), Positives = 57/88 (64%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           S + ++ E   GK+VPRA+ VDLEP  +D +R+G    +F P+  + G+  A NN+A+G 
Sbjct: 15  SFDTFFCETRAGKHVPRALFVDLEPTVIDGIRTGQHRSLFHPEQLLSGKEDAANNYARGR 74

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           Y+ G+E++D VL+  RK AE C  L+ F
Sbjct: 75  YSVGSEVIDLVLERTRKLAEQCGGLQGF 102


>AL683826-2|CAI23625.1|  446|Homo sapiens tubulin, alpha-like 3
           protein.
          Length = 446

 Score = 84.6 bits (200), Expect = 2e-16
 Identities = 37/88 (42%), Positives = 57/88 (64%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           S + ++ E   GK+VPRA+ VDLEP  +D +R+G    +F P+  + G+  A NN+A+G 
Sbjct: 55  SFDTFFCETRAGKHVPRALFVDLEPTVIDGIRTGQHRSLFHPEQLLSGKEDAANNYARGR 114

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           Y+ G+E++D VL+  RK AE C  L+ F
Sbjct: 115 YSVGSEVIDLVLERTRKLAEQCGGLQGF 142



 Score = 38.3 bits (85), Expect = 0.020
 Identities = 20/45 (44%), Positives = 22/45 (48%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MRE + I  GQ G QIG   WE+   EHGI   G        QLE
Sbjct: 1   MRECLSIHIGQAGIQIGDACWELYCLEHGIQPNGVVLDTQQDQLE 45


>AK025318-1|BAB15110.1|  446|Homo sapiens protein ( Homo sapiens
           cDNA: FLJ21665 fis, clone COL08913. ).
          Length = 446

 Score = 84.6 bits (200), Expect = 2e-16
 Identities = 37/88 (42%), Positives = 57/88 (64%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           S + ++ E   GK+VPRA+ VDLEP  +D +R+G    +F P+  + G+  A NN+A+G 
Sbjct: 55  SFDTFFCETRAGKHVPRALFVDLEPTVIDGIRTGQHRSLFHPEQLLSGKEDAANNYARGR 114

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           Y+ G+E++D VL+  RK AE C  L+ F
Sbjct: 115 YSVGSEVIDLVLERTRKLAEQCGGLQGF 142



 Score = 38.3 bits (85), Expect = 0.020
 Identities = 20/45 (44%), Positives = 22/45 (48%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDLQLE 254
           MRE + I  GQ G QIG   WE+   EHGI   G        QLE
Sbjct: 1   MRECLSIHIGQAGIQIGDACWELYCLEHGIQPNGVVLDTQQDQLE 45


>AL713922-3|CAI16220.1|  410|Homo sapiens novel protein similar to
           beta-tubulin 4Q (TUBB4Q)kinase) II gamma protein.
          Length = 410

 Score = 81.8 bits (193), Expect = 2e-15
 Identities = 35/43 (81%), Positives = 39/43 (90%)
 Frame = +2

Query: 389 VFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           V GQ GAGNNWAKGHYTEGAEL++SV+DVVRKEAE CDCL+ F
Sbjct: 57  VAGQCGAGNNWAKGHYTEGAELMESVMDVVRKEAESCDCLQGF 99


>BC021564-1|AAH21564.1|  335|Homo sapiens TUBA1B protein protein.
          Length = 335

 Score = 81.0 bits (191), Expect = 3e-15
 Identities = 32/75 (42%), Positives = 49/75 (65%)
 Frame = +2

Query: 254 SINVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 433
           S N +++E   GK+VPRAV VDLEP  +D VR+G + Q+F P+  + G+  A NN+A+GH
Sbjct: 48  SFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGH 107

Query: 434 YTEGAELVDSVLDVV 478
           YT    L+  ++  +
Sbjct: 108 YTNLNRLISQIVSSI 122



 Score = 38.7 bits (86), Expect = 0.015
 Identities = 18/42 (42%), Positives = 21/42 (50%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEHGIDATGAYSGDSDL 245
           MRE + I  GQ G QIG   WE+   EHGI   G    D  +
Sbjct: 1   MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTI 42


>M61764-1|AAA52620.1|  451|Homo sapiens gamma-tubulin protein.
          Length = 451

 Score = 77.8 bits (183), Expect = 3e-14
 Identities = 31/88 (35%), Positives = 58/88 (65%), Gaps = 2/88 (2%)
 Frame = +2

Query: 260 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQ--SGAGNNWAKGH 433
           +V++ +A    Y+PRAV++DLEP  + S+ + P+ +++ P+N    +   GAGNNWA G 
Sbjct: 49  DVFFYQADDEHYIPRAVLLDLEPRVIHSILNSPYAKLYNPENIYLSEHGGGAGNNWASG- 107

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           +++G ++ + + D++ +EA+G D L  F
Sbjct: 108 FSQGEKIHEDIFDIIDREADGSDSLEGF 135



 Score = 46.4 bits (105), Expect = 8e-05
 Identities = 18/29 (62%), Positives = 23/29 (79%)
 Frame = +3

Query: 123 REIVHIQAGQCGNQIGAKFWEVISDEHGI 209
           REI+ +Q GQCGNQIG +FW+ +  EHGI
Sbjct: 3   REIITLQLGQCGNQIGFEFWKQLCAEHGI 31


>CR407642-1|CAG28570.1|  451|Homo sapiens TUBG1 protein.
          Length = 451

 Score = 77.8 bits (183), Expect = 3e-14
 Identities = 31/88 (35%), Positives = 58/88 (65%), Gaps = 2/88 (2%)
 Frame = +2

Query: 260 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQ--SGAGNNWAKGH 433
           +V++ +A    Y+PRAV++DLEP  + S+ + P+ +++ P+N    +   GAGNNWA G 
Sbjct: 49  DVFFYQADDEHYIPRAVLLDLEPRVIHSILNSPYAKLYNPENIYLSEHGGGAGNNWASG- 107

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           +++G ++ + + D++ +EA+G D L  F
Sbjct: 108 FSQGEKIHEDIFDIIDREADGSDSLEGF 135



 Score = 48.0 bits (109), Expect = 3e-05
 Identities = 19/33 (57%), Positives = 24/33 (72%)
 Frame = +3

Query: 123 REIVHIQAGQCGNQIGAKFWEVISDEHGIDATG 221
           REI+ +Q GQCGNQIG +FW+ +  EHGI   G
Sbjct: 3   REIITLQLGQCGNQIGFEFWKQLCAEHGISPEG 35


>BT019931-1|AAV38734.1|  451|Homo sapiens tubulin, gamma 1 protein.
          Length = 451

 Score = 77.8 bits (183), Expect = 3e-14
 Identities = 31/88 (35%), Positives = 58/88 (65%), Gaps = 2/88 (2%)
 Frame = +2

Query: 260 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQ--SGAGNNWAKGH 433
           +V++ +A    Y+PRAV++DLEP  + S+ + P+ +++ P+N    +   GAGNNWA G 
Sbjct: 49  DVFFYQADDEHYIPRAVLLDLEPRVIHSILNSPYAKLYNPENIYLSEHGGGAGNNWASG- 107

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           +++G ++ + + D++ +EA+G D L  F
Sbjct: 108 FSQGEKIHEDIFDIIDREADGSDSLEGF 135



 Score = 48.0 bits (109), Expect = 3e-05
 Identities = 19/33 (57%), Positives = 24/33 (72%)
 Frame = +3

Query: 123 REIVHIQAGQCGNQIGAKFWEVISDEHGIDATG 221
           REI+ +Q GQCGNQIG +FW+ +  EHGI   G
Sbjct: 3   REIITLQLGQCGNQIGFEFWKQLCAEHGISPEG 35


>BC108739-1|AAI08740.1|  451|Homo sapiens tubulin, gamma 2 protein.
          Length = 451

 Score = 77.8 bits (183), Expect = 3e-14
 Identities = 31/88 (35%), Positives = 58/88 (65%), Gaps = 2/88 (2%)
 Frame = +2

Query: 260 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQ--SGAGNNWAKGH 433
           +V++ +A    Y+PRAV++DLEP  + S+ + P+ +++ P+N    +   GAGNNWA G 
Sbjct: 49  DVFFYQADDEHYIPRAVLLDLEPRVIHSILNSPYAKLYNPENIYLSEHGGGAGNNWASG- 107

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           +++G ++ + + D++ +EA+G D L  F
Sbjct: 108 FSQGEKIHEDIFDIIDREADGSDSLEGF 135



 Score = 48.0 bits (109), Expect = 3e-05
 Identities = 19/33 (57%), Positives = 24/33 (72%)
 Frame = +3

Query: 123 REIVHIQAGQCGNQIGAKFWEVISDEHGIDATG 221
           REI+ +Q GQCGNQIG +FW+ +  EHGI   G
Sbjct: 3   REIITLQLGQCGNQIGFEFWKQLCAEHGISPEG 35


>BC051890-1|AAH51890.1|  451|Homo sapiens tubulin, gamma 2 protein.
          Length = 451

 Score = 77.8 bits (183), Expect = 3e-14
 Identities = 31/88 (35%), Positives = 58/88 (65%), Gaps = 2/88 (2%)
 Frame = +2

Query: 260 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQ--SGAGNNWAKGH 433
           +V++ +A    Y+PRAV++DLEP  + S+ + P+ +++ P+N    +   GAGNNWA G 
Sbjct: 49  DVFFYQADDEHYIPRAVLLDLEPRVIHSILNSPYAKLYNPENIYLSEHGGGAGNNWASG- 107

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           +++G ++ + + D++ +EA+G D L  F
Sbjct: 108 FSQGEKIHEDIFDIIDREADGSDSLEGF 135



 Score = 48.0 bits (109), Expect = 3e-05
 Identities = 19/33 (57%), Positives = 24/33 (72%)
 Frame = +3

Query: 123 REIVHIQAGQCGNQIGAKFWEVISDEHGIDATG 221
           REI+ +Q GQCGNQIG +FW+ +  EHGI   G
Sbjct: 3   REIITLQLGQCGNQIGFEFWKQLCAEHGISPEG 35


>BC009670-1|AAH09670.1|  451|Homo sapiens tubulin, gamma 2 protein.
          Length = 451

 Score = 77.8 bits (183), Expect = 3e-14
 Identities = 31/88 (35%), Positives = 58/88 (65%), Gaps = 2/88 (2%)
 Frame = +2

Query: 260 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQ--SGAGNNWAKGH 433
           +V++ +A    Y+PRAV++DLEP  + S+ + P+ +++ P+N    +   GAGNNWA G 
Sbjct: 49  DVFFYQADDEHYIPRAVLLDLEPRVIHSILNSPYAKLYNPENIYLSEHGGGAGNNWASG- 107

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           +++G ++ + + D++ +EA+G D L  F
Sbjct: 108 FSQGEKIHEDIFDIIDREADGSDSLEGF 135



 Score = 48.0 bits (109), Expect = 3e-05
 Identities = 19/33 (57%), Positives = 24/33 (72%)
 Frame = +3

Query: 123 REIVHIQAGQCGNQIGAKFWEVISDEHGIDATG 221
           REI+ +Q GQCGNQIG +FW+ +  EHGI   G
Sbjct: 3   REIITLQLGQCGNQIGFEFWKQLCAEHGISPEG 35


>BC000619-1|AAH00619.1|  451|Homo sapiens tubulin, gamma 1 protein.
          Length = 451

 Score = 77.8 bits (183), Expect = 3e-14
 Identities = 31/88 (35%), Positives = 58/88 (65%), Gaps = 2/88 (2%)
 Frame = +2

Query: 260 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQ--SGAGNNWAKGH 433
           +V++ +A    Y+PRAV++DLEP  + S+ + P+ +++ P+N    +   GAGNNWA G 
Sbjct: 49  DVFFYQADDEHYIPRAVLLDLEPRVIHSILNSPYAKLYNPENIYLSEHGGGAGNNWASG- 107

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           +++G ++ + + D++ +EA+G D L  F
Sbjct: 108 FSQGEKIHEDIFDIIDREADGSDSLEGF 135



 Score = 48.0 bits (109), Expect = 3e-05
 Identities = 19/33 (57%), Positives = 24/33 (72%)
 Frame = +3

Query: 123 REIVHIQAGQCGNQIGAKFWEVISDEHGIDATG 221
           REI+ +Q GQCGNQIG +FW+ +  EHGI   G
Sbjct: 3   REIITLQLGQCGNQIGFEFWKQLCAEHGISPEG 35


>AK022324-1|BAB14012.1|  451|Homo sapiens protein ( Homo sapiens
           cDNA FLJ12262 fis, clone MAMMA1001576, highly similar to
           Human gamma-tubulin mRNA. ).
          Length = 451

 Score = 77.8 bits (183), Expect = 3e-14
 Identities = 31/88 (35%), Positives = 58/88 (65%), Gaps = 2/88 (2%)
 Frame = +2

Query: 260 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQ--SGAGNNWAKGH 433
           +V++ +A    Y+PRAV++DLEP  + S+ + P+ +++ P+N    +   GAGNNWA G 
Sbjct: 49  DVFFYQADDEHYIPRAVLLDLEPRVIHSILNSPYAKLYNPENIYLSEHGGGAGNNWASG- 107

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           +++G ++ + + D++ +EA+G D L  F
Sbjct: 108 FSQGEKIHEDIFDIIDREADGSDSLEGF 135



 Score = 48.0 bits (109), Expect = 3e-05
 Identities = 19/33 (57%), Positives = 24/33 (72%)
 Frame = +3

Query: 123 REIVHIQAGQCGNQIGAKFWEVISDEHGIDATG 221
           REI+ +Q GQCGNQIG +FW+ +  EHGI   G
Sbjct: 3   REIITLQLGQCGNQIGFEFWKQLCAEHGISPEG 35


>AF225971-1|AAF34188.1|  451|Homo sapiens gamma-tubulin protein.
          Length = 451

 Score = 77.8 bits (183), Expect = 3e-14
 Identities = 31/88 (35%), Positives = 58/88 (65%), Gaps = 2/88 (2%)
 Frame = +2

Query: 260 NVYYNEASGGKYVPRAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQ--SGAGNNWAKGH 433
           +V++ +A    Y+PRAV++DLEP  + S+ + P+ +++ P+N    +   GAGNNWA G 
Sbjct: 49  DVFFYQADDEHYIPRAVLLDLEPRVIHSILNSPYAKLYNPENIYLSEHGGGAGNNWASG- 107

Query: 434 YTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           +++G ++ + + D++ +EA+G D L  F
Sbjct: 108 FSQGEKIHEDIFDIIDREADGSDSLEGF 135



 Score = 48.0 bits (109), Expect = 3e-05
 Identities = 19/33 (57%), Positives = 24/33 (72%)
 Frame = +3

Query: 123 REIVHIQAGQCGNQIGAKFWEVISDEHGIDATG 221
           REI+ +Q GQCGNQIG +FW+ +  EHGI   G
Sbjct: 3   REIITLQLGQCGNQIGFEFWKQLCAEHGISPEG 35


>Z99289-5|CAI42328.1|  163|Homo sapiens tubulin, epsilon 1 protein.
          Length = 163

 Score = 71.3 bits (167), Expect = 2e-12
 Identities = 30/72 (41%), Positives = 43/72 (59%)
 Frame = +2

Query: 302 RAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVR 481
           RAV++D+E G ++ +  GP   +F     +   SG+GNNWA GH   G+   D +L+  R
Sbjct: 70  RAVLIDMEEGVVNEILQGPLRDVFDTKQLITDISGSGNNWAVGHKVFGSLYQDQILEKFR 129

Query: 482 KEAEGCDCLRVF 517
           K AE CDCL+ F
Sbjct: 130 KSAEHCDCLQCF 141



 Score = 39.5 bits (88), Expect = 0.009
 Identities = 17/37 (45%), Positives = 23/37 (62%), Gaps = 1/37 (2%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEH-GIDATGAY 227
           M + V +Q GQCGNQIG  FW++   EH  ++  G Y
Sbjct: 1   MTQSVVVQVGQCGNQIGCCFWDLALREHAAVNQKGIY 37


>Z99289-4|CAI42327.1|  475|Homo sapiens tubulin, epsilon 1 protein.
          Length = 475

 Score = 71.3 bits (167), Expect = 2e-12
 Identities = 30/72 (41%), Positives = 43/72 (59%)
 Frame = +2

Query: 302 RAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVR 481
           RAV++D+E G ++ +  GP   +F     +   SG+GNNWA GH   G+   D +L+  R
Sbjct: 70  RAVLIDMEEGVVNEILQGPLRDVFDTKQLITDISGSGNNWAVGHKVFGSLYQDQILEKFR 129

Query: 482 KEAEGCDCLRVF 517
           K AE CDCL+ F
Sbjct: 130 KSAEHCDCLQCF 141



 Score = 39.5 bits (88), Expect = 0.009
 Identities = 17/37 (45%), Positives = 23/37 (62%), Gaps = 1/37 (2%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEH-GIDATGAY 227
           M + V +Q GQCGNQIG  FW++   EH  ++  G Y
Sbjct: 1   MTQSVVVQVGQCGNQIGCCFWDLALREHAAVNQKGIY 37


>Z99289-3|CAI42326.1|  206|Homo sapiens tubulin, epsilon 1 protein.
          Length = 206

 Score = 71.3 bits (167), Expect = 2e-12
 Identities = 30/72 (41%), Positives = 43/72 (59%)
 Frame = +2

Query: 302 RAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVR 481
           RAV++D+E G ++ +  GP   +F     +   SG+GNNWA GH   G+   D +L+  R
Sbjct: 26  RAVLIDMEEGVVNEILQGPLRDVFDTKQLITDISGSGNNWAVGHKVFGSLYQDQILEKFR 85

Query: 482 KEAEGCDCLRVF 517
           K AE CDCL+ F
Sbjct: 86  KSAEHCDCLQCF 97


>BC025405-1|AAH25405.1|  475|Homo sapiens tubulin, epsilon 1
           protein.
          Length = 475

 Score = 71.3 bits (167), Expect = 2e-12
 Identities = 30/72 (41%), Positives = 43/72 (59%)
 Frame = +2

Query: 302 RAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVR 481
           RAV++D+E G ++ +  GP   +F     +   SG+GNNWA GH   G+   D +L+  R
Sbjct: 70  RAVLIDMEEGVVNEILQGPLRDVFDTKQLITDISGSGNNWAVGHKVFGSLYQDQILEKFR 129

Query: 482 KEAEGCDCLRVF 517
           K AE CDCL+ F
Sbjct: 130 KSAEHCDCLQCF 141



 Score = 39.5 bits (88), Expect = 0.009
 Identities = 17/37 (45%), Positives = 23/37 (62%), Gaps = 1/37 (2%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEH-GIDATGAY 227
           M + V +Q GQCGNQIG  FW++   EH  ++  G Y
Sbjct: 1   MTQSVVVQVGQCGNQIGCCFWDLALREHAAVNQKGIY 37


>AF201334-1|AAF09585.1|  475|Homo sapiens epsilon-tubulin protein.
          Length = 475

 Score = 71.3 bits (167), Expect = 2e-12
 Identities = 30/72 (41%), Positives = 43/72 (59%)
 Frame = +2

Query: 302 RAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVR 481
           RAV++D+E G ++ +  GP   +F     +   SG+GNNWA GH   G+   D +L+  R
Sbjct: 70  RAVLIDMEEGVVNEILQGPLRDVFDTKQLITDISGSGNNWAVGHKVFGSLYQDQILEKFR 129

Query: 482 KEAEGCDCLRVF 517
           K AE CDCL+ F
Sbjct: 130 KSAEHCDCLQCF 141



 Score = 39.5 bits (88), Expect = 0.009
 Identities = 17/37 (45%), Positives = 23/37 (62%), Gaps = 1/37 (2%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEH-GIDATGAY 227
           M + V +Q GQCGNQIG  FW++   EH  ++  G Y
Sbjct: 1   MTQSVVVQVGQCGNQIGCCFWDLALREHAAVNQKGIY 37


>BC031101-1|AAH31101.1|  475|Homo sapiens tubulin, epsilon 1
           protein.
          Length = 475

 Score = 70.5 bits (165), Expect = 4e-12
 Identities = 30/72 (41%), Positives = 43/72 (59%)
 Frame = +2

Query: 302 RAVMVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVR 481
           RAV++D+E G ++ +  GP   +F     +   SG+GNNWA GH   G+   D +L+  R
Sbjct: 70  RAVLIDMEEGVVNEILQGPLRGVFDTKQLITDISGSGNNWAVGHKVFGSLYQDQILEKFR 129

Query: 482 KEAEGCDCLRVF 517
           K AE CDCL+ F
Sbjct: 130 KSAEHCDCLQCF 141



 Score = 39.5 bits (88), Expect = 0.009
 Identities = 17/37 (45%), Positives = 23/37 (62%), Gaps = 1/37 (2%)
 Frame = +3

Query: 120 MREIVHIQAGQCGNQIGAKFWEVISDEH-GIDATGAY 227
           M + V +Q GQCGNQIG  FW++   EH  ++  G Y
Sbjct: 1   MTQSVVVQVGQCGNQIGCCFWDLALREHAAVNQKGIY 37


>AY533484-1|AAS86429.1|   98|Homo sapiens tubulin alpha-1 protein.
          Length = 98

 Score = 63.3 bits (147), Expect = 6e-10
 Identities = 27/61 (44%), Positives = 41/61 (67%)
 Frame = +2

Query: 335 MDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAEGCDCLRV 514
           +D VR+G + Q+F P+  + G+  A NN+A+GHYT G E++D VL  +RK A+ C  L+ 
Sbjct: 1   IDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLYRIRKLADQCTGLQG 60

Query: 515 F 517
           F
Sbjct: 61  F 61


>AF035316-1|AAB88188.1|  342|Homo sapiens protein ( Homo sapiens
           clone 23678 mRNA, partial cds. ).
          Length = 342

 Score = 60.1 bits (139), Expect = 6e-09
 Identities = 26/30 (86%), Positives = 28/30 (93%)
 Frame = +2

Query: 428 GHYTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           GHYTEGAELVDSVLDVVRKE+E CDCL+ F
Sbjct: 1   GHYTEGAELVDSVLDVVRKESESCDCLQGF 30


>BC001896-1|AAH01896.1|  340|Homo sapiens TUBB protein protein.
          Length = 340

 Score = 58.8 bits (136), Expect = 1e-08
 Identities = 26/29 (89%), Positives = 27/29 (93%)
 Frame = +2

Query: 431 HYTEGAELVDSVLDVVRKEAEGCDCLRVF 517
           HYTEGAELVDSVLDVVRKEAE CDCL+ F
Sbjct: 1   HYTEGAELVDSVLDVVRKEAESCDCLQGF 29


>AK024002-1|BAB14767.1|  241|Homo sapiens protein ( Homo sapiens
           cDNA FLJ13940 fis, clone Y79AA1000833, moderately
           similar to TUBULIN ALPHA-1 CHAIN. ).
          Length = 241

 Score = 58.0 bits (134), Expect = 2e-08
 Identities = 27/65 (41%), Positives = 39/65 (60%)
 Frame = +2

Query: 323 EPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAEGCD 502
           +P    S + G + QIF P+  + G+  A NN+A GHYT G E +D +LD +RK A+ C 
Sbjct: 10  DPSQPLSRQHGTYRQIFHPEQLITGKEDAANNYAWGHYTIGKEFIDLLLDRIRKLADQCT 69

Query: 503 CLRVF 517
            L+ F
Sbjct: 70  GLQGF 74


>BC000258-1|AAH00258.1|  398|Homo sapiens TUBD1 protein protein.
          Length = 398

 Score = 57.6 bits (133), Expect = 3e-08
 Identities = 29/87 (33%), Positives = 49/87 (56%), Gaps = 3/87 (3%)
 Frame = +2

Query: 266 YYNEASGGKYVPRAVMVDLEPGTMDSV--RSGPFGQIFRPDNFVFGQS-GAGNNWAKGHY 436
           +++E   G  + RAV+VD+EP  ++ +  ++   GQ     +  F Q  G+GNNWA G+ 
Sbjct: 50  FFSEEENGVPIARAVLVDMEPKVINQMLSKAAQSGQWKYGQHACFCQKQGSGNNWAYGYS 109

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
             G    +S+++++RKE E CD    F
Sbjct: 110 VHGPRHEESIMNIIRKEVEKCDSFSGF 136



 Score = 32.7 bits (71), Expect = 1.0
 Identities = 14/26 (53%), Positives = 20/26 (76%), Gaps = 1/26 (3%)
 Frame = +3

Query: 129 IVHIQAGQCGNQIGAKFWE-VISDEH 203
           IV +Q GQCGNQIG + ++ ++SD H
Sbjct: 3   IVTVQLGQCGNQIGFEVFDALLSDSH 28


>AF201333-1|AAF09584.1|  453|Homo sapiens delta-tubulin protein.
          Length = 453

 Score = 57.2 bits (132), Expect = 4e-08
 Identities = 29/87 (33%), Positives = 48/87 (55%), Gaps = 3/87 (3%)
 Frame = +2

Query: 266 YYNEASGGKYVPRAVMVDLEPGTMDSV--RSGPFGQIFRPDNFVFGQS-GAGNNWAKGHY 436
           +++E   G  + RAV+VD+EP  ++    ++   GQ     +  F Q  G+GNNWA G+ 
Sbjct: 50  FFSEEENGVPIARAVLVDMEPKVINQTLSKAAQSGQWKYGQHACFCQKQGSGNNWAYGYS 109

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
             G    +S+++++RKE E CD    F
Sbjct: 110 VHGPRHEESIMNIIRKEVEKCDSFSGF 136



 Score = 32.7 bits (71), Expect = 1.0
 Identities = 14/26 (53%), Positives = 20/26 (76%), Gaps = 1/26 (3%)
 Frame = +3

Query: 129 IVHIQAGQCGNQIGAKFWE-VISDEH 203
           IV +Q GQCGNQIG + ++ ++SD H
Sbjct: 3   IVTVQLGQCGNQIGFEVFDALLSDSH 28


>AB031045-1|BAD83581.1|  351|Homo sapiens delta-tubulin isoform
           protein.
          Length = 351

 Score = 57.2 bits (132), Expect = 4e-08
 Identities = 29/87 (33%), Positives = 48/87 (55%), Gaps = 3/87 (3%)
 Frame = +2

Query: 266 YYNEASGGKYVPRAVMVDLEPGTMDSV--RSGPFGQIFRPDNFVFGQS-GAGNNWAKGHY 436
           +++E   G  + RAV+VD+EP  ++    ++   GQ     +  F Q  G+GNNWA G+ 
Sbjct: 50  FFSEEENGVPIARAVLVDMEPKVINQTLSKAAQSGQWKYGQHACFCQKQGSGNNWAYGYS 109

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
             G    +S+++++RKE E CD    F
Sbjct: 110 VHGPRHEESIMNIIRKEVEKCDSFSGF 136



 Score = 32.7 bits (71), Expect = 1.0
 Identities = 14/26 (53%), Positives = 20/26 (76%), Gaps = 1/26 (3%)
 Frame = +3

Query: 129 IVHIQAGQCGNQIGAKFWE-VISDEH 203
           IV +Q GQCGNQIG + ++ ++SD H
Sbjct: 3   IVTVQLGQCGNQIGFEVFDALLSDSH 28


>AB031044-1|BAD83580.1|  398|Homo sapiens delta-tubulin isoform
           protein.
          Length = 398

 Score = 57.2 bits (132), Expect = 4e-08
 Identities = 29/87 (33%), Positives = 48/87 (55%), Gaps = 3/87 (3%)
 Frame = +2

Query: 266 YYNEASGGKYVPRAVMVDLEPGTMDSV--RSGPFGQIFRPDNFVFGQS-GAGNNWAKGHY 436
           +++E   G  + RAV+VD+EP  ++    ++   GQ     +  F Q  G+GNNWA G+ 
Sbjct: 50  FFSEEENGVPIARAVLVDMEPKVINQTLSKAAQSGQWKYGQHACFCQKQGSGNNWAYGYS 109

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
             G    +S+++++RKE E CD    F
Sbjct: 110 VHGPRHEESIMNIIRKEVEKCDSFSGF 136



 Score = 32.7 bits (71), Expect = 1.0
 Identities = 14/26 (53%), Positives = 20/26 (76%), Gaps = 1/26 (3%)
 Frame = +3

Query: 129 IVHIQAGQCGNQIGAKFWE-VISDEH 203
           IV +Q GQCGNQIG + ++ ++SD H
Sbjct: 3   IVTVQLGQCGNQIGFEVFDALLSDSH 28


>AB030837-1|BAD16590.1|  453|Homo sapiens delta tubulin protein.
          Length = 453

 Score = 57.2 bits (132), Expect = 4e-08
 Identities = 29/87 (33%), Positives = 48/87 (55%), Gaps = 3/87 (3%)
 Frame = +2

Query: 266 YYNEASGGKYVPRAVMVDLEPGTMDSV--RSGPFGQIFRPDNFVFGQS-GAGNNWAKGHY 436
           +++E   G  + RAV+VD+EP  ++    ++   GQ     +  F Q  G+GNNWA G+ 
Sbjct: 50  FFSEEENGVPIARAVLVDMEPKVINQTLSKAAQSGQWKYGQHACFCQKQGSGNNWAYGYS 109

Query: 437 TEGAELVDSVLDVVRKEAEGCDCLRVF 517
             G    +S+++++RKE E CD    F
Sbjct: 110 VHGPRHEESIMNIIRKEVEKCDSFSGF 136



 Score = 32.7 bits (71), Expect = 1.0
 Identities = 14/26 (53%), Positives = 20/26 (76%), Gaps = 1/26 (3%)
 Frame = +3

Query: 129 IVHIQAGQCGNQIGAKFWE-VISDEH 203
           IV +Q GQCGNQIG + ++ ++SD H
Sbjct: 3   IVTVQLGQCGNQIGFEVFDALLSDSH 28


>AK024096-1|BAB14825.1|  199|Homo sapiens protein ( Homo sapiens
           cDNA FLJ14034 fis, clone HEMBA1004499, weakly similar to
           Homo sapiens delta-tubulin mRNA. ).
          Length = 199

 Score = 32.7 bits (71), Expect = 1.0
 Identities = 14/26 (53%), Positives = 20/26 (76%), Gaps = 1/26 (3%)
 Frame = +3

Query: 129 IVHIQAGQCGNQIGAKFWE-VISDEH 203
           IV +Q GQCGNQIG + ++ ++SD H
Sbjct: 3   IVTVQLGQCGNQIGFEVFDALLSDSH 28


>X07882-1|CAA30729.1|  226|Homo sapiens Po protein protein.
          Length = 226

 Score = 31.5 bits (68), Expect = 2.3
 Identities = 18/55 (32%), Positives = 26/55 (47%)
 Frame = -3

Query: 470 PVPNQPVQPPLCNXLSPSYSPPQTVRRRSCPVGRFAQTARNGRSPWFQAQGPPSQ 306
           P P +P +PP     + S  PP    +   P  +    +R+ RSP  + QGPP Q
Sbjct: 115 PPPGKPERPPPQGG-NQSQGPPPHPGKPEGPPPQEGNKSRSARSPPGKPQGPPQQ 168


>X07704-1|CAA30542.1|  234|Homo sapiens Po protein protein.
          Length = 234

 Score = 31.5 bits (68), Expect = 2.3
 Identities = 18/55 (32%), Positives = 26/55 (47%)
 Frame = -3

Query: 470 PVPNQPVQPPLCNXLSPSYSPPQTVRRRSCPVGRFAQTARNGRSPWFQAQGPPSQ 306
           P P +P +PP     + S  PP    +   P  +    +R+ RSP  + QGPP Q
Sbjct: 123 PPPGKPERPPPQGG-NQSQGPPPHPGKPEGPPPQEGNKSRSARSPPGKPQGPPQQ 176


>S80916-1|AAB50687.2|  238|Homo sapiens parotid 'o' protein protein.
          Length = 238

 Score = 31.5 bits (68), Expect = 2.3
 Identities = 18/55 (32%), Positives = 26/55 (47%)
 Frame = -3

Query: 470 PVPNQPVQPPLCNXLSPSYSPPQTVRRRSCPVGRFAQTARNGRSPWFQAQGPPSQ 306
           P P +P +PP     + S  PP    +   P  +    +R+ RSP  + QGPP Q
Sbjct: 127 PPPGKPERPPPQGG-NQSQGPPPHPGKPEGPPPQEGNKSRSARSPPGKPQGPPQQ 180


>S80905-1|AAB50686.1|  382|Homo sapiens Con1 protein.
          Length = 382

 Score = 31.5 bits (68), Expect = 2.3
 Identities = 19/55 (34%), Positives = 24/55 (43%)
 Frame = -3

Query: 470 PVPNQPVQPPLCNXLSPSYSPPQTVRRRSCPVGRFAQTARNGRSPWFQAQGPPSQ 306
           P P +P  PP      P   PP    +   P G     +R+ RSP  + QGPP Q
Sbjct: 286 PPPGKPQGPPPQGGNKPQGPPPPGKPQGPPPQG--GSKSRSARSPPGKPQGPPQQ 338



 Score = 30.3 bits (65), Expect = 5.4
 Identities = 19/55 (34%), Positives = 24/55 (43%)
 Frame = -3

Query: 470 PVPNQPVQPPLCNXLSPSYSPPQTVRRRSCPVGRFAQTARNGRSPWFQAQGPPSQ 306
           P P +P  PP      P   PP    +   P G     +R+ RSP  + QGPP Q
Sbjct: 100 PPPGKPQGPPPQGGNKPQGPPPPGKPQGPPPQGD--NKSRSSRSPPGKPQGPPPQ 152



 Score = 29.5 bits (63), Expect = 9.5
 Identities = 19/55 (34%), Positives = 24/55 (43%)
 Frame = -3

Query: 470 PVPNQPVQPPLCNXLSPSYSPPQTVRRRSCPVGRFAQTARNGRSPWFQAQGPPSQ 306
           P P +P  PP      P   PP    +   P G     +R+ RSP  + QGPP Q
Sbjct: 39  PPPGKPQGPPPQGGNKPQGPPPPGKPQGPPPQG---DKSRSPRSPPGKPQGPPPQ 90


>K03208-1|AAA60189.1|  251|Homo sapiens PRB2 protein.
          Length = 251

 Score = 31.5 bits (68), Expect = 2.3
 Identities = 19/55 (34%), Positives = 24/55 (43%)
 Frame = -3

Query: 470 PVPNQPVQPPLCNXLSPSYSPPQTVRRRSCPVGRFAQTARNGRSPWFQAQGPPSQ 306
           P P +P  PP      P   PP    +   P G     +R+ RSP  + QGPP Q
Sbjct: 155 PPPGKPQGPPPQGGNKPQGPPPPGKPQGPPPQG--GSKSRSARSPPGKPQGPPQQ 207


>K03207-1|AAA60188.1|  247|Homo sapiens salivary proline-rich
           protein precursor protein.
          Length = 247

 Score = 31.5 bits (68), Expect = 2.3
 Identities = 18/55 (32%), Positives = 26/55 (47%)
 Frame = -3

Query: 470 PVPNQPVQPPLCNXLSPSYSPPQTVRRRSCPVGRFAQTARNGRSPWFQAQGPPSQ 306
           P P +P +PP     + S  PP    +   P  +    +R+ RSP  + QGPP Q
Sbjct: 136 PPPGKPERPPPQGG-NQSQGPPPHPGKPEGPPPQEGNKSRSARSPPGKPQGPPQQ 189


>BC130386-1|AAI30387.1|  268|Homo sapiens PRB4 protein protein.
          Length = 268

 Score = 31.5 bits (68), Expect = 2.3
 Identities = 18/55 (32%), Positives = 26/55 (47%)
 Frame = -3

Query: 470 PVPNQPVQPPLCNXLSPSYSPPQTVRRRSCPVGRFAQTARNGRSPWFQAQGPPSQ 306
           P P +P +PP     + S  PP    +   P  +    +R+ RSP  + QGPP Q
Sbjct: 157 PPPGKPERPPPQGG-NQSQGPPPHPGKPEGPPPQEGNKSRSARSPPGKPQGPPQQ 210


>K02575-1|AAA36502.1|  173|Homo sapiens protein ( Human salivary
           proline-rich protein 1 gene, segment 1. ).
          Length = 173

 Score = 30.7 bits (66), Expect = 4.1
 Identities = 19/55 (34%), Positives = 25/55 (45%)
 Frame = -3

Query: 470 PVPNQPVQPPLCNXLSPSYSPPQTVRRRSCPVGRFAQTARNGRSPWFQAQGPPSQ 306
           P P +P  PP      P   PP    +   P G   + +R+ RSP  + QGPP Q
Sbjct: 35  PPPGKPQGPPPQGGNKPQGPPPPGKPQGPPPQG--GKRSRSPRSPPGKPQGPPPQ 87



 Score = 30.3 bits (65), Expect = 5.4
 Identities = 19/55 (34%), Positives = 24/55 (43%)
 Frame = -3

Query: 470 PVPNQPVQPPLCNXLSPSYSPPQTVRRRSCPVGRFAQTARNGRSPWFQAQGPPSQ 306
           P P +P  PP      P   PP    +   P G  +Q+ R+ R P    QGPP Q
Sbjct: 97  PPPGKPQGPPPQGGNKPQGPPPPGKPQGPPPQGDKSQSPRSPRKP----QGPPPQ 147


>X07517-1|CAA30395.2|  236|Homo sapiens salivary proline-rich
           protein protein.
          Length = 236

 Score = 29.5 bits (63), Expect = 9.5
 Identities = 19/55 (34%), Positives = 24/55 (43%)
 Frame = -3

Query: 470 PVPNQPVQPPLCNXLSPSYSPPQTVRRRSCPVGRFAQTARNGRSPWFQAQGPPSQ 306
           P P +P  PP      P   PP    +   P G     +R+ RSP  + QGPP Q
Sbjct: 18  PPPGKPQGPPPQGGNKPQGPPPPGKPQGPPPQG---DKSRSPRSPPGKPQGPPPQ 69


>X07516-1|CAA30394.2|  297|Homo sapiens salivary proline-rich
           protein protein.
          Length = 297

 Score = 29.5 bits (63), Expect = 9.5
 Identities = 19/55 (34%), Positives = 24/55 (43%)
 Frame = -3

Query: 470 PVPNQPVQPPLCNXLSPSYSPPQTVRRRSCPVGRFAQTARNGRSPWFQAQGPPSQ 306
           P P +P  PP      P   PP    +   P G     +R+ RSP  + QGPP Q
Sbjct: 18  PPPGKPQGPPPQGGNKPQGPPPPGKPQGPPPQG---DKSRSPRSPPGKPQGPPPQ 69


>S62941-1|AAB27289.1|  358|Homo sapiens Ps 2 protein.
          Length = 358

 Score = 29.5 bits (63), Expect = 9.5
 Identities = 19/55 (34%), Positives = 24/55 (43%)
 Frame = -3

Query: 470 PVPNQPVQPPLCNXLSPSYSPPQTVRRRSCPVGRFAQTARNGRSPWFQAQGPPSQ 306
           P P +P  PP      P   PP    +   P G     +R+ RSP  + QGPP Q
Sbjct: 18  PPPGKPQGPPPQGGNKPQGPPPPGKPQGPPPQG---DKSRSPRSPPGKPQGPPPQ 69


>S62928-1|AAB27288.2|  297|Homo sapiens PRB1M protein precursor
           protein.
          Length = 297

 Score = 29.5 bits (63), Expect = 9.5
 Identities = 19/55 (34%), Positives = 24/55 (43%)
 Frame = -3

Query: 470 PVPNQPVQPPLCNXLSPSYSPPQTVRRRSCPVGRFAQTARNGRSPWFQAQGPPSQ 306
           P P +P  PP      P   PP    +   P G     +R+ RSP  + QGPP Q
Sbjct: 18  PPPGKPQGPPPQGGNKPQGPPPPGKPQGPPPQG---DKSRSPRSPPGKPQGPPPQ 69


>S52986-1|AAA13341.2|  331|Homo sapiens basic salivary proline-rich
           protein protein.
          Length = 331

 Score = 29.5 bits (63), Expect = 9.5
 Identities = 19/55 (34%), Positives = 24/55 (43%)
 Frame = -3

Query: 470 PVPNQPVQPPLCNXLSPSYSPPQTVRRRSCPVGRFAQTARNGRSPWFQAQGPPSQ 306
           P P +P  PP      P   PP    +   P G     +R+ RSP  + QGPP Q
Sbjct: 52  PPPGKPQGPPPQGGNKPQGPPPPGKPQGPPPQG---DKSRSPRSPPGKPQGPPPQ 103


>M97220-1|AAB05816.1|  331|Homo sapiens salivary proline-rich
           protein protein.
          Length = 331

 Score = 29.5 bits (63), Expect = 9.5
 Identities = 19/55 (34%), Positives = 24/55 (43%)
 Frame = -3

Query: 470 PVPNQPVQPPLCNXLSPSYSPPQTVRRRSCPVGRFAQTARNGRSPWFQAQGPPSQ 306
           P P +P  PP      P   PP    +   P G     +R+ RSP  + QGPP Q
Sbjct: 52  PPPGKPQGPPPQGGNKPQGPPPPGKPQGPPPQG---DKSRSPRSPPGKPQGPPPQ 103


>K03206-1|AAA60187.1|  178|Homo sapiens PRB1 protein.
          Length = 178

 Score = 29.5 bits (63), Expect = 9.5
 Identities = 19/55 (34%), Positives = 24/55 (43%)
 Frame = -3

Query: 470 PVPNQPVQPPLCNXLSPSYSPPQTVRRRSCPVGRFAQTARNGRSPWFQAQGPPSQ 306
           P P +P  PP      P   PP    +   P G     +R+ RSP  + QGPP Q
Sbjct: 52  PPPGKPQGPPPQGGNKPQGPPPPGKPQGPPPQG---DKSRSPRSPPGKPQGPPPQ 103


>K03205-1|AAA60186.1|  198|Homo sapiens PRB1 protein.
          Length = 198

 Score = 29.5 bits (63), Expect = 9.5
 Identities = 19/55 (34%), Positives = 24/55 (43%)
 Frame = -3

Query: 470 PVPNQPVQPPLCNXLSPSYSPPQTVRRRSCPVGRFAQTARNGRSPWFQAQGPPSQ 306
           P P +P  PP      P   PP    +   P G     +R+ RSP  + QGPP Q
Sbjct: 52  PPPGKPQGPPPQGGNKPQGPPPPGKPQGPPPQG---DKSRSPRSPPGKPQGPPPQ 103


>K03204-1|AAA60185.1|  331|Homo sapiens PRB1 protein.
          Length = 331

 Score = 29.5 bits (63), Expect = 9.5
 Identities = 19/55 (34%), Positives = 24/55 (43%)
 Frame = -3

Query: 470 PVPNQPVQPPLCNXLSPSYSPPQTVRRRSCPVGRFAQTARNGRSPWFQAQGPPSQ 306
           P P +P  PP      P   PP    +   P G     +R+ RSP  + QGPP Q
Sbjct: 52  PPPGKPQGPPPQGGNKPQGPPPPGKPQGPPPQG---DKSRSPRSPPGKPQGPPPQ 103


>BC141917-1|AAI41918.1|  198|Homo sapiens PRB1 protein protein.
          Length = 198

 Score = 29.5 bits (63), Expect = 9.5
 Identities = 19/55 (34%), Positives = 24/55 (43%)
 Frame = -3

Query: 470 PVPNQPVQPPLCNXLSPSYSPPQTVRRRSCPVGRFAQTARNGRSPWFQAQGPPSQ 306
           P P +P  PP      P   PP    +   P G     +R+ RSP  + QGPP Q
Sbjct: 52  PPPGKPQGPPPQGGNKPQGPPPPGKPQGPPPQG---DKSRSPRSPPGKPQGPPPQ 103


>BC044827-1|AAH44827.1|  338|Homo sapiens PRB2 protein protein.
          Length = 338

 Score = 29.5 bits (63), Expect = 9.5
 Identities = 19/55 (34%), Positives = 24/55 (43%)
 Frame = -3

Query: 470 PVPNQPVQPPLCNXLSPSYSPPQTVRRRSCPVGRFAQTARNGRSPWFQAQGPPSQ 306
           P P +P  PP      P   PP    +   P G     +R+ RSP  + QGPP Q
Sbjct: 59  PPPGKPQGPPPQGGNKPQGPPPPGKPQGPPPQG---DKSRSPRSPPGKPQGPPPQ 110


>AK074085-1|BAB84911.1| 1887|Homo sapiens FLJ00156 protein protein.
          Length = 1887

 Score = 29.5 bits (63), Expect = 9.5
 Identities = 12/43 (27%), Positives = 25/43 (58%)
 Frame = +3

Query: 72   CLFNIRFGGFQIFSAIMREIVHIQAGQCGNQIGAKFWEVISDE 200
            C+ N R  G ++++++ ++  H+Q  +CGN   A  W  I ++
Sbjct: 937  CIENYRRRGQELYASLYKD--HVQRRKCGNIKAANAWARIQEQ 977


>AB046827-1|BAB13433.1| 1270|Homo sapiens KIAA1607 protein protein.
          Length = 1270

 Score = 29.5 bits (63), Expect = 9.5
 Identities = 12/43 (27%), Positives = 25/43 (58%)
 Frame = +3

Query: 72  CLFNIRFGGFQIFSAIMREIVHIQAGQCGNQIGAKFWEVISDE 200
           C+ N R  G ++++++ ++  H+Q  +CGN   A  W  I ++
Sbjct: 312 CIENYRRRGQELYASLYKD--HVQRRKCGNIKAANAWARIQEQ 352


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 92,140,589
Number of Sequences: 237096
Number of extensions: 2049366
Number of successful extensions: 13705
Number of sequences better than 10.0: 185
Number of HSP's better than 10.0 without gapping: 13081
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 13677
length of database: 76,859,062
effective HSP length: 86
effective length of database: 56,468,806
effective search space used: 6324506272
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).